F315748

General Info

Members Datasets Scaffolds Average Seq Length
206 147 206 300

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0044684|Ga0500641_0044684_98_1054
Length 318
Sequence VNDLALSYSWRSVRGCRLRRTLLILALAVSPALVFAPAARADEPKVEPKVELLWPSGAPGAKGMKETDRPNLTIFLPDPDKATGAAAIICPGGGYGHLAEVHEGSDVAKWLNSLGIAGFVLKYRLATNGYHHPAPLDDVQRAVRLVRSRAAEWKLDPQKIGVVGFSAGGHLASSVGTHFDKGKTDAADAVDRASCRPDFLVLCYPVISFVGKKIHQGSKDNLLGKKPDPELVKLMSNETQVTAETPPTFIFQTNEDKSVPAENAVAFYLALREANVPAELHIYEPGRHGIGLAKDNEDLKGWPDLCGKWLSRRGLVKK

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
75 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
76 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
77 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
87 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
88 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
146 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.43
Nodule 0
Rhizoplane 4.85
Rhizosphere 91.26
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10001047 3300003323 Bacteria 4760
2 Ga0065712_10152467 3300005290 Bacteria 1359
3 Ga0065715_10096271 3300005293 Bacteria 3892
4 Ga0065707_10106632 3300005295 Bacteria 2588
5 Ga0070683_100002380 3300005329 Bacteria 14928
6 Ga0070683_100422177 3300005329 Unclassified 1272
7 Ga0070670_100001316 3300005331 Bacteria 19823
8 Ga0070670_100011257 3300005331 Bacteria 7647
9 Ga0070666_10088631 3300005335 Bacteria 2123
10 Ga0070689_100074846 3300005340 Bacteria 2650
11 Ga0070661_100153072 3300005344 Bacteria 1744
12 Ga0070669_100047677 3300005353 Unclassified 3126
13 Ga0070669_100110736 3300005353 Bacteria 2083
14 Ga0070669_100112829 3300005353 Bacteria 2065
15 Ga0070675_100096458 3300005354 Bacteria 2484
16 Ga0070688_100115775 3300005365 Bacteria 1789
17 Ga0070713_100016973 3300005436 Bacteria 5489
18 Ga0070701_10136119 3300005438 Unclassified 1400
19 Ga0070711_100005905 3300005439 Bacteria 7350
20 Ga0070700_100063034 3300005441 Bacteria 2344
21 Ga0070662_100085286 3300005457 Bacteria 2360
22 Ga0070679_100243482 3300005530 Bacteria 1756
23 Ga0070679_100371945 3300005530 Unclassified 1376
24 Ga0070684_100000359 3300005535 Bacteria 31395
25 Ga0070686_100234542 3300005544 Bacteria 1333
26 Ga0070693_100085993 3300005547 Bacteria 1886
27 Ga0070664_100001797 3300005564 Bacteria 17204
28 Ga0070664_100196962 3300005564 Bacteria 1796
29 Ga0068858_100066998 3300005842 Bacteria 3325
30 Ga0068860_100022080 3300005843 Bacteria 6160
31 Ga0070717_10132246 3300006028 Bacteria 2147
32 Ga0075362_10077035 3300006177 Bacteria 1532
33 Ga0075367_10003625 3300006178 Bacteria 7404
34 Ga0075428_100001361 3300006844 Bacteria 25954
35 Ga0075428_100044455 3300006844 Bacteria 4881
36 Ga0075428_100139140 3300006844 Unclassified 2639
37 Ga0075430_100014629 3300006846 Bacteria 6683
38 Ga0075430_100082284 3300006846 Bacteria 2698
39 Ga0075431_100088879 3300006847 Bacteria 3189
40 Ga0075431_100096767 3300006847 Bacteria 3047
41 Ga0075431_100112756 3300006847 Bacteria 2806
42 Ga0075431_100155817 3300006847 Unclassified 2350
43 Ga0075431_100194835 3300006847 Bacteria 2075
44 Ga0075431_100274158 3300006847 Bacteria 1709
45 Ga0075431_100355957 3300006847 Bacteria 1471
46 Ga0075433_10029189 3300006852 Bacteria 4697
47 Ga0075434_100001482 3300006871 Bacteria 19785
48 Ga0075434_100149579 3300006871 Bacteria 2355
49 Ga0075429_100131662 3300006880 Bacteria 2188
50 Ga0097620_100642630 3300006931 Unclassified 1153
51 Ga0075435_100104477 3300007076 Bacteria 2350
52 Ga0105240_10585048 3300009093 Unclassified 1231
53 Ga0111539_10000112 3300009094 Bacteria 89047
54 Ga0111539_10001762 3300009094 Bacteria 28733
55 Ga0111539_10010736 3300009094 Bacteria 11525
56 Ga0111539_10035374 3300009094 Bacteria 6048
57 Ga0111539_10086884 3300009094 Bacteria 3674
58 Ga0111539_10102300 3300009094 Bacteria 3362
59 Ga0111539_10661669 3300009094 Bacteria 1216
60 Ga0105245_10138654 3300009098 Bacteria 2288
61 Ga0114129_10005085 3300009147 Bacteria 18518
62 Ga0114129_10050736 3300009147 Bacteria 5827
63 Ga0114129_10082940 3300009147 Bacteria 4454
64 Ga0114129_10124481 3300009147 Bacteria 3545
65 Ga0114129_11010962 3300009147 Bacteria 1046
66 Ga0105243_10039715 3300009148 Unclassified 3671
67 Ga0105249_10000263 3300009553 Bacteria 56064
68 Ga0105249_10327459 3300009553 Bacteria 1545
69 Ga0105239_10743226 3300010375 Bacteria 1123
70 Ga0105246_10030587 3300011119 Bacteria 3558
71 Ga0105246_10096341 3300011119 Bacteria 2145
72 Ga0105246_10156964 3300011119 Bacteria 1729
73 Ga0157375_10062693 3300013308 Bacteria 3695
74 Ga0157375_10200578 3300013308 Bacteria 2151
75 Ga0163163_10210809 3300014325 Bacteria 1992
76 Ga0157380_10523556 3300014326 Unclassified 1157
77 Ga0157379_10677511 3300014968 Unclassified 967
78 Ga0209050_1001077 3300025298 Bacteria 33401
79 Ga0207649_10115918 3300025920 Bacteria 1798
80 Ga0207652_10390027 3300025921 Unclassified 1257
81 Ga0207681_10073600 3300025923 Bacteria 2390
82 Ga0207681_10135287 3300025923 Bacteria 1828
83 Ga0207650_10055926 3300025925 Bacteria 2930
84 Ga0207659_10092474 3300025926 Bacteria 2261
85 Ga0207687_10382630 3300025927 Bacteria 1153
86 Ga0207700_10000223 3300025928 Bacteria 33978
87 Ga0207664_10000872 3300025929 Bacteria 20393
88 Ga0207670_10250356 3300025936 Bacteria 1369
89 Ga0207691_10078654 3300025940 Bacteria 2969
90 Ga0207689_10349427 3300025942 Bacteria 1229
91 Ga0207679_10027324 3300025945 Bacteria 3945
92 Ga0207679_10174524 3300025945 Bacteria 1773
93 Ga0207712_10009547 3300025961 Bacteria 6140
94 Ga0207668_10143119 3300025972 Bacteria 1842
95 Ga0207703_10160494 3300026035 Bacteria 1969
96 Ga0207708_10086397 3300026075 Bacteria 2414
97 Ga0207675_100077382 3300026118 Bacteria 3116
98 Ga0207428_10004510 3300027907 Bacteria 13207
99 Ga0268264_10082952 3300028381 Bacteria 2744
100 Ga0268264_10267801 3300028381 Bacteria 1595
101 Ga0265338_10295417 3300028800 Bacteria 1179
102 Ga0307408_100034905 3300031548 Bacteria 3526
103 Ga0265314_10001217 3300031711 Bacteria 29592
104 Ga0307405_10453476 3300031731 Bacteria 1017
105 Ga0307413_10335238 3300031824 Bacteria 1161
106 Ga0307411_10198413 3300032005 Bacteria 1539
107 Ga0373934_0006563 3300035086 Bacteria 4315
108 Ga0373954_0000559 3300035118 Bacteria 13997
109 Ga0373954_0010522 3300035118 Bacteria 4082
110 Ga0373946_0071388 3300035171 Unclassified 1501
111 Ga0373955_0001771 3300035172 Bacteria 9266
112 Ga0373927_0240078 3300035695 Unclassified 1191
113 Ga0373933_0005559 3300035724 Bacteria 6866
114 Ga0373933_0030104 3300035724 Bacteria 3142
115 Ga0373937_0007075 3300036401 Bacteria 9692
116 Ga0373937_0132410 3300036401 Bacteria 2329
117 Ga0373937_0301938 3300036401 Bacteria 1513
118 Ga0373925_0435737 3300037068 Unclassified 1072
119 Ga0395900_0489149 3300037418 Unclassified 1182
120 Ga0436364_1135269 3300037853 Bacteria 21600
121 Ga0436365_0203974 3300039437 Bacteria 6457
122 Ga0436362_0163725 3300039453 Bacteria 7906
123 Ga0439434_0053353 3300042435 Bacteria 1256
124 Ga0439435_0009073 3300042436 Bacteria 2326
125 Ga0439464_0040033 3300042439 Bacteria 1334
126 Ga0451577_0055465 3300042876 Bacteria 3536
127 Ga0466972_0017307 3300044658 Bacteria 3607
128 Ga0466965_0015854 3300044683 Bacteria 3580
129 Ga0466963_0109509 3300044694 Unclassified 1895
130 Ga0466968_0004215 3300044735 Bacteria 5359
131 Ga0466960_0037701 3300044901 Bacteria 2268
132 Ga0495582_0030835 3300046473 Bacteria 2945
133 Ga0495664_0038762 3300046477 Bacteria 2814
134 Ga0495608_0074844 3300046511 Unclassified 2207
135 Ga0495586_0013052 3300046535 Bacteria 4402
136 Ga0495645_0276367 3300046543 Unclassified 1106
137 Ga0495658_0269299 3300046683 Unclassified 1073
138 Ga0495613_0104034 3300046689 Bacteria 2050
139 Ga0495636_0061505 3300047318 Bacteria 1588
140 Ga0496102_0514547 3300048905 Bacteria 1119
141 Ga0496104_0091889 3300048907 Bacteria 2902
142 Ga0496105_0088156 3300048908 Bacteria 2563
143 Ga0496108_0011195 3300048911 Bacteria 7289
144 Ga0496109_0001090 3300048912 Bacteria 22529
145 Ga0496110_0006587 3300048913 Bacteria 9225
146 Ga0496111_0166836 3300048914 Bacteria 1635
147 Ga0496112_0000177 3300048915 Bacteria 40717
148 Ga0496112_0104812 3300048915 Unclassified 2798
149 Ga0496114_0197487 3300048917 Bacteria 1761
150 Ga0501299_002610 3300049522 Bacteria 2508
151 Ga0501034_0019255 3300049571 Bacteria 6986
152 Ga0501036_0161877 3300049572 Bacteria 1886
153 Ga0501039_0057949 3300049575 Bacteria 2999
154 Ga0501040_0141377 3300049576 Unclassified 1696
155 Ga0501048_0030073 3300049582 Bacteria 3933
156 Ga0501068_0066932 3300049584 Unclassified 2188
157 Ga0501070_0519302 3300049586 Bacteria 956
158 Ga0501071_0107566 3300049587 Bacteria 2059
159 Ga0501072_0158487 3300049588 Unclassified 1805
160 Ga0501073_0032972 3300049589 Bacteria 3690
161 Ga0501075_0030774 3300049591 Bacteria 3978
162 Ga0501076_0031743 3300049592 Bacteria 4122
163 Ga0501077_0065849 3300049593 Bacteria 2298
164 Ga0501079_0018643 3300049741 Bacteria 5302
165 Ga0501079_0252144 3300049741 Bacteria 1379
166 Ga0501079_0280545 3300049741 Bacteria 1303
167 Ga0501080_0007704 3300049742 Bacteria 9734
168 Ga0501080_0059680 3300049742 Bacteria 3549
169 Ga0501080_0076286 3300049742 Bacteria 3118
170 Ga0501080_0443625 3300049742 Unclassified 1164
171 Ga0501081_0099930 3300049743 Unclassified 2050
172 Ga0501083_0002229 3300049744 Bacteria 13244
173 Ga0501035_0377498 3300049822 Bacteria 1183
174 Ga0501044_0109553 3300049823 Bacteria 2770
175 Ga0501045_0281080 3300049824 Bacteria 1239
176 nmdc:mga06z11_20742_c1 3300050494 Bacteria 3042
177 nmdc:mga05p37_26261_c2 3300050507 Bacteria 5786
178 nmdc:mga05p37_28029_c1 3300050507 Bacteria 6863
179 nmdc:mga05p37_60206_c1 3300050507 Bacteria 4676
180 nmdc:mga05p37_83919_c1 3300050507 Bacteria 3925
181 nmdc:mga09592_20149_c1 3300050508 Bacteria 5481
182 nmdc:mga09592_45165_c1 3300050508 Bacteria 3710
183 nmdc:mga0qj67_36363_c1 3300050509 Unclassified 3852
184 nmdc:mga0qj67_64732_c1 3300050509 Bacteria 2909
185 nmdc:mga06r32_101785_c1 3300050510 Bacteria 2820
186 nmdc:mga06r32_129475_c1 3300050510 Unclassified 2494
187 nmdc:mga06r32_256332_c1 3300050510 Bacteria 1737
188 nmdc:mga06r32_414645_c1 3300050510 Bacteria 1328
189 nmdc:mga06r32_4485_c1 3300050510 Bacteria 12498
190 nmdc:mga08y16_122096_c1 3300050511 Bacteria 2711
191 nmdc:mga08y16_29809_c1 3300050511 Bacteria 5745
192 nmdc:mga08y16_44600_c1 3300050511 Bacteria 4646
193 nmdc:mga08y16_75_c1 3300050511 Bacteria 82530
194 nmdc:mga0n895_16789_c1 3300050512 Bacteria 6727
195 nmdc:mga0rr50_167630_c1 3300050513 Bacteria 1787
196 nmdc:mga0a205_144981_c1 3300050515 Bacteria 2275
197 nmdc:mga0a205_191765_c1 3300050515 Unclassified 1935
198 nmdc:mga0a205_63257_c1 3300050515 Bacteria 3575
199 Ga0495619_0270867 3300053085 Bacteria 1177
200 Ga0500641_0044684 3300053096 Bacteria 1802
201 Ga0501084_0016020 3300054114 Bacteria 6221
202 Ga0501084_0215369 3300054114 Bacteria 1620
203 Ga0501084_0476191 3300054114 Bacteria 1055
204 Ga0590071_001861 3300059421 Bacteria 5443
205 Ga0590074_004751 3300059423 Bacteria 2242
206 Ga0501082_0024036 3300060353 Bacteria 5255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10062693 Ga0157375_100626933 207
2 3300025942 Ga0207689_10349427 Ga0207689_103494271 221
3 3300009147 Ga0114129_10082940 Ga0114129_100829403 227
4 3300005842 Ga0068858_100066998 Ga0068858_1000669983 228
5 3300006847 Ga0075431_100112756 Ga0075431_1001127562 228
6 3300005290 Ga0065712_10152467 Ga0065712_101524671 230
7 3300009147 Ga0114129_10050736 Ga0114129_100507365 230
8 3300025936 Ga0207670_10250356 Ga0207670_102503562 230
9 3300026035 Ga0207703_10160494 Ga0207703_101604942 230
10 3300044694 Ga0466963_0109509 Ga0466963_0109509_786_1739 230
11 3300050507 nmdc:mga05p37_28029_c1 nmdc:mga05p37_28029_c1_1892_2839 230
12 3300050515 nmdc:mga0a205_144981_c1 nmdc:mga0a205_144981_c1_1318_2262 230
13 3300009094 Ga0111539_10102300 Ga0111539_101023001 231
14 3300031731 Ga0307405_10453476 Ga0307405_104534761 231
15 3300039453 Ga0436362_0163725 Ga0436362_0163725_5782_6660 231
16 3300048915 Ga0496112_0104812 Ga0496112_0104812_1844_2701 231
17 3300059421 Ga0590071_001861 Ga0590071_001861_971_1870 231
18 3300059423 Ga0590074_004751 Ga0590074_004751_650_1549 231
19 3300006846 Ga0075430_100014629 Ga0075430_1000146293 232
20 3300006847 Ga0075431_100088879 Ga0075431_1000888792 232
21 3300009147 Ga0114129_11010962 Ga0114129_110109621 232
22 3300031548 Ga0307408_100034905 Ga0307408_1000349055 232
23 3300042435 Ga0439434_0053353 Ga0439434_0053353_272_1228 232
24 3300049742 Ga0501080_0076286 Ga0501080_0076286_986_1882 232
25 3300050508 nmdc:mga09592_20149_c1 nmdc:mga09592_20149_c1_1811_2758 232
26 3300050510 nmdc:mga06r32_4485_c1 nmdc:mga06r32_4485_c1_7770_8717 232
27 3300054114 Ga0501084_0476191 Ga0501084_0476191_78_974 232
28 3300006844 Ga0075428_100044455 Ga0075428_1000444552 233
29 3300006844 Ga0075428_100139140 Ga0075428_1001391402 233
30 3300006847 Ga0075431_100096767 Ga0075431_1000967672 233
31 3300006847 Ga0075431_100155817 Ga0075431_1001558172 233
32 3300006847 Ga0075431_100355957 Ga0075431_1003559572 233
33 3300006852 Ga0075433_10029189 Ga0075433_100291892 233
34 3300009094 Ga0111539_10001762 Ga0111539_1000176228 233
35 3300009147 Ga0114129_10124481 Ga0114129_101244812 233
36 3300032005 Ga0307411_10198413 Ga0307411_101984132 233
37 3300036401 Ga0373937_0301938 Ga0373937_0301938_180_1076 233
38 3300037853 Ga0436364_1135269 Ga0436364_1135269_17620_18513 233
39 3300050507 nmdc:mga05p37_26261_c2 nmdc:mga05p37_26261_c2_3293_4231 233
40 3300050507 nmdc:mga05p37_60206_c1 nmdc:mga05p37_60206_c1_3386_4297 233
41 3300050508 nmdc:mga09592_45165_c1 nmdc:mga09592_45165_c1_2627_3538 233
42 3300050509 nmdc:mga0qj67_36363_c1 nmdc:mga0qj67_36363_c1_121_1032 233
43 3300050510 nmdc:mga06r32_101785_c1 nmdc:mga06r32_101785_c1_1145_2056 233
44 3300050510 nmdc:mga06r32_129475_c1 nmdc:mga06r32_129475_c1_1145_2098 233
45 3300050510 nmdc:mga06r32_256332_c1 nmdc:mga06r32_256332_c1_103_987 233
46 3300050510 nmdc:mga06r32_414645_c1 nmdc:mga06r32_414645_c1_64_933 233
47 3300050511 nmdc:mga08y16_75_c1 nmdc:mga08y16_75_c1_60193_61131 233
48 3300005329 Ga0070683_100002380 Ga0070683_1000023803 234
49 3300005331 Ga0070670_100011257 Ga0070670_1000112573 234
50 3300005335 Ga0070666_10088631 Ga0070666_100886312 234
51 3300005344 Ga0070661_100153072 Ga0070661_1001530722 234
52 3300005354 Ga0070675_100096458 Ga0070675_1000964582 234
53 3300005365 Ga0070688_100115775 Ga0070688_1001157752 234
54 3300005535 Ga0070684_100000359 Ga0070684_10000035929 234
55 3300005564 Ga0070664_100001797 Ga0070664_1000017971 234
56 3300006177 Ga0075362_10077035 Ga0075362_100770352 234
57 3300006178 Ga0075367_10003625 Ga0075367_100036252 234
58 3300006871 Ga0075434_100001482 Ga0075434_1000014824 234
59 3300006880 Ga0075429_100131662 Ga0075429_1001316623 234
60 3300010375 Ga0105239_10743226 Ga0105239_107432261 234
61 3300014325 Ga0163163_10210809 Ga0163163_102108092 234
62 3300014968 Ga0157379_10677511 Ga0157379_106775111 234
63 3300025298 Ga0209050_1001077 Ga0209050_100107715 234
64 3300025920 Ga0207649_10115918 Ga0207649_101159182 234
65 3300025926 Ga0207659_10092474 Ga0207659_100924742 234
66 3300025940 Ga0207691_10078654 Ga0207691_100786542 234
67 3300025945 Ga0207679_10027324 Ga0207679_100273243 234
68 3300028381 Ga0268264_10267801 Ga0268264_102678012 234
69 3300028800 Ga0265338_10295417 Ga0265338_102954172 234
70 3300048908 Ga0496105_0088156 Ga0496105_0088156_60_1082 234
71 3300048911 Ga0496108_0011195 Ga0496108_0011195_2579_3601 234
72 3300048912 Ga0496109_0001090 Ga0496109_0001090_21443_22465 234
73 3300048913 Ga0496110_0006587 Ga0496110_0006587_181_1203 234
74 3300048914 Ga0496111_0166836 Ga0496111_0166836_551_1573 234
75 3300048915 Ga0496112_0000177 Ga0496112_0000177_14055_15077 234
76 3300048917 Ga0496114_0197487 Ga0496114_0197487_693_1715 234
77 3300049571 Ga0501034_0019255 Ga0501034_0019255_1002_1988 234
78 3300049572 Ga0501036_0161877 Ga0501036_0161877_493_1479 234
79 3300049575 Ga0501039_0057949 Ga0501039_0057949_712_1698 234
80 3300049582 Ga0501048_0030073 Ga0501048_0030073_2205_3191 234
81 3300049584 Ga0501068_0066932 Ga0501068_0066932_487_1473 234
82 3300049589 Ga0501073_0032972 Ga0501073_0032972_763_1749 234
83 3300049742 Ga0501080_0059680 Ga0501080_0059680_535_1521 234
84 3300049823 Ga0501044_0109553 Ga0501044_0109553_749_1735 234
85 3300050494 nmdc:mga06z11_20742_c1 nmdc:mga06z11_20742_c1_931_1839 234
86 3300006847 Ga0075431_100194835 Ga0075431_1001948353 235
87 3300009093 Ga0105240_10585048 Ga0105240_105850481 235
88 3300009098 Ga0105245_10138654 Ga0105245_101386542 235
89 3300011119 Ga0105246_10030587 Ga0105246_100305872 235
90 3300025927 Ga0207687_10382630 Ga0207687_103826302 235
91 3300031711 Ga0265314_10001217 Ga0265314_100012173 235
92 3300035724 Ga0373933_0005559 Ga0373933_0005559_5268_6137 235
93 3300036401 Ga0373937_0132410 Ga0373937_0132410_1084_1953 235
94 3300042436 Ga0439435_0009073 Ga0439435_0009073_436_1341 235
95 3300042439 Ga0439464_0040033 Ga0439464_0040033_345_1250 235
96 3300042876 Ga0451577_0055465 Ga0451577_0055465_36_977 235
97 3300047318 Ga0495636_0061505 Ga0495636_0061505_688_1536 235
98 3300048907 Ga0496104_0091889 Ga0496104_0091889_1166_2062 235
99 3300005293 Ga0065715_10096271 Ga0065715_100962713 236
100 3300005340 Ga0070689_100074846 Ga0070689_1000748462 236
101 3300005353 Ga0070669_100047677 Ga0070669_1000476772 236
102 3300005436 Ga0070713_100016973 Ga0070713_1000169732 236
103 3300005439 Ga0070711_100005905 Ga0070711_1000059052 236
104 3300005530 Ga0070679_100371945 Ga0070679_1003719451 236
105 3300005544 Ga0070686_100234542 Ga0070686_1002345421 236
106 3300005547 Ga0070693_100085993 Ga0070693_1000859931 236
107 3300006028 Ga0070717_10132246 Ga0070717_101322461 236
108 3300007076 Ga0075435_100104477 Ga0075435_1001044772 236
109 3300009094 Ga0111539_10010736 Ga0111539_100107367 236
110 3300025921 Ga0207652_10390027 Ga0207652_103900271 236
111 3300025923 Ga0207681_10135287 Ga0207681_101352872 236
112 3300025928 Ga0207700_10000223 Ga0207700_1000022313 236
113 3300025929 Ga0207664_10000872 Ga0207664_100008727 236
114 3300048905 Ga0496102_0514547 Ga0496102_0514547_148_1089 236
115 3300049522 Ga0501299_002610 Ga0501299_002610_12_899 236
116 3300049576 Ga0501040_0141377 Ga0501040_0141377_219_1136 236
117 3300049586 Ga0501070_0519302 Ga0501070_0519302_16_933 236
118 3300049587 Ga0501071_0107566 Ga0501071_0107566_892_1860 236
119 3300049588 Ga0501072_0158487 Ga0501072_0158487_502_1455 236
120 3300049591 Ga0501075_0030774 Ga0501075_0030774_2290_3243 236
121 3300049592 Ga0501076_0031743 Ga0501076_0031743_2154_3122 236
122 3300049593 Ga0501077_0065849 Ga0501077_0065849_1317_2234 236
123 3300049741 Ga0501079_0018643 Ga0501079_0018643_72_989 236
124 3300049741 Ga0501079_0280545 Ga0501079_0280545_144_1097 236
125 3300049742 Ga0501080_0007704 Ga0501080_0007704_6234_7151 236
126 3300049742 Ga0501080_0443625 Ga0501080_0443625_57_962 236
127 3300049743 Ga0501081_0099930 Ga0501081_0099930_704_1621 236
128 3300049822 Ga0501035_0377498 Ga0501035_0377498_39_956 236
129 3300049824 Ga0501045_0281080 Ga0501045_0281080_63_980 236
130 3300050511 nmdc:mga08y16_122096_c1 nmdc:mga08y16_122096_c1_417_1355 236
131 3300050511 nmdc:mga08y16_29809_c1 nmdc:mga08y16_29809_c1_2341_3306 236
132 3300050513 nmdc:mga0rr50_167630_c1 nmdc:mga0rr50_167630_c1_600_1565 236
133 3300050515 nmdc:mga0a205_191765_c1 nmdc:mga0a205_191765_c1_984_1919 236
134 3300053096 Ga0500641_0044684 Ga0500641_0044684_98_1054 236
135 3300054114 Ga0501084_0016020 Ga0501084_0016020_1936_2853 236
136 3300005295 Ga0065707_10106632 Ga0065707_101066322 237
137 3300005331 Ga0070670_100001316 Ga0070670_10000131616 237
138 3300005353 Ga0070669_100110736 Ga0070669_1001107362 237
139 3300005353 Ga0070669_100112829 Ga0070669_1001128292 237
140 3300005438 Ga0070701_10136119 Ga0070701_101361192 237
141 3300005441 Ga0070700_100063034 Ga0070700_1000630343 237
142 3300005457 Ga0070662_100085286 Ga0070662_1000852862 237
143 3300005564 Ga0070664_100196962 Ga0070664_1001969622 237
144 3300006844 Ga0075428_100001361 Ga0075428_1000013614 237
145 3300006846 Ga0075430_100082284 Ga0075430_1000822842 237
146 3300006847 Ga0075431_100274158 Ga0075431_1002741582 237
147 3300006871 Ga0075434_100149579 Ga0075434_1001495792 237
148 3300009094 Ga0111539_10000112 Ga0111539_1000011268 237
149 3300009094 Ga0111539_10035374 Ga0111539_100353743 237
150 3300009094 Ga0111539_10086884 Ga0111539_100868843 237
151 3300009094 Ga0111539_10661669 Ga0111539_106616691 237
152 3300009147 Ga0114129_10005085 Ga0114129_1000508515 237
153 3300009148 Ga0105243_10039715 Ga0105243_100397153 237
154 3300009553 Ga0105249_10000263 Ga0105249_1000026317 237
155 3300009553 Ga0105249_10327459 Ga0105249_103274592 237
156 3300011119 Ga0105246_10096341 Ga0105246_100963412 237
157 3300013308 Ga0157375_10200578 Ga0157375_102005782 237
158 3300014326 Ga0157380_10523556 Ga0157380_105235561 237
159 3300025923 Ga0207681_10073600 Ga0207681_100736002 237
160 3300025925 Ga0207650_10055926 Ga0207650_100559261 237
161 3300025945 Ga0207679_10174524 Ga0207679_101745242 237
162 3300025961 Ga0207712_10009547 Ga0207712_100095475 237
163 3300025972 Ga0207668_10143119 Ga0207668_101431191 237
164 3300026075 Ga0207708_10086397 Ga0207708_100863972 237
165 3300026118 Ga0207675_100077382 Ga0207675_1000773822 237
166 3300027907 Ga0207428_10004510 Ga0207428_100045105 237
167 3300035086 Ga0373934_0006563 Ga0373934_0006563_661_1530 237
168 3300035118 Ga0373954_0000559 Ga0373954_0000559_2712_3584 237
169 3300035118 Ga0373954_0010522 Ga0373954_0010522_1781_2650 237
170 3300035171 Ga0373946_0071388 Ga0373946_0071388_551_1423 237
171 3300035172 Ga0373955_0001771 Ga0373955_0001771_3035_3904 237
172 3300035695 Ga0373927_0240078 Ga0373927_0240078_219_1091 237
173 3300035724 Ga0373933_0030104 Ga0373933_0030104_1494_2363 237
174 3300036401 Ga0373937_0007075 Ga0373937_0007075_8205_9074 237
175 3300037068 Ga0373925_0435737 Ga0373925_0435737_27_899 237
176 3300046473 Ga0495582_0030835 Ga0495582_0030835_389_1258 237
177 3300046477 Ga0495664_0038762 Ga0495664_0038762_496_1368 237
178 3300046511 Ga0495608_0074844 Ga0495608_0074844_1223_2092 237
179 3300046535 Ga0495586_0013052 Ga0495586_0013052_477_1346 237
180 3300046543 Ga0495645_0276367 Ga0495645_0276367_29_901 237
181 3300046683 Ga0495658_0269299 Ga0495658_0269299_138_1007 237
182 3300046689 Ga0495613_0104034 Ga0495613_0104034_320_1189 237
183 3300049741 Ga0501079_0252144 Ga0501079_0252144_25_966 237
184 3300049744 Ga0501083_0002229 Ga0501083_0002229_4150_5145 237
185 3300050507 nmdc:mga05p37_83919_c1 nmdc:mga05p37_83919_c1_2419_3363 237
186 3300050509 nmdc:mga0qj67_64732_c1 nmdc:mga0qj67_64732_c1_1409_2362 237
187 3300050511 nmdc:mga08y16_44600_c1 nmdc:mga08y16_44600_c1_3040_3978 237
188 3300050512 nmdc:mga0n895_16789_c1 nmdc:mga0n895_16789_c1_5807_6712 237
189 3300050515 nmdc:mga0a205_63257_c1 nmdc:mga0a205_63257_c1_25_963 237
190 3300053085 Ga0495619_0270867 Ga0495619_0270867_107_976 237
191 3300054114 Ga0501084_0215369 Ga0501084_0215369_309_1304 237
192 3300060353 Ga0501082_0024036 Ga0501082_0024036_954_1949 237
193 3300005843 Ga0068860_100022080 Ga0068860_1000220802 238
194 3300006931 Ga0097620_100642630 Ga0097620_1006426301 238
195 3300011119 Ga0105246_10156964 Ga0105246_101569642 238
196 3300028381 Ga0268264_10082952 Ga0268264_100829523 238
197 3300037418 Ga0395900_0489149 Ga0395900_0489149_112_1080 238
198 3300031824 Ga0307413_10335238 Ga0307413_103352381 253
199 3300005329 Ga0070683_100422177 Ga0070683_1004221772 265
200 3300005530 Ga0070679_100243482 Ga0070679_1002434821 265
201 3300039437 Ga0436365_0203974 Ga0436365_0203974_723_1616 268
202 3300003323 rootH1_10001047 rootH1_100010473 273
203 3300044658 Ga0466972_0017307 Ga0466972_0017307_2548_3408 273
204 3300044683 Ga0466965_0015854 Ga0466965_0015854_182_1042 273
205 3300044735 Ga0466968_0004215 Ga0466968_0004215_2015_2875 273
206 3300044901 Ga0466960_0037701 Ga0466960_0037701_174_1034 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00326

Peptidase_S9

Prolyl oligopeptidase family

209

303

0.86

PF20434

BD-FAE

BD-FAE

72

271

0.86

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

92

292

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dwc-assembly4.cif.gz_D bacteroides thetaiotaomicron vpi5482 btaxe1 0.7927 47 264
7bfu-assembly1.cif.gz_A thermogutta terrifontis esterase 2 phosphonylated by sarin 0.7678 42 267
5nn0-assembly1.cif.gz_A crystal structure of hubche with n-((1-(2,3-dihydro-1h-inden-2-yl)piperidin-3-yl)methyl)-n-(2-(dimethylamino)ethyl)-2-naphthamide. 0.7646 46 186
5thm-assembly1.cif.gz_A esterase-6 from drosophila melanogaster 0.7642 44 186
7auy-assembly2.cif.gz_B structure of estd11 in complex with fluorescein 0.7519 26 264
ID Description Score Start End Superfamily
af_D4A8F5_4_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7685 126 264 3.40.50.1820
1xlwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7647 46 186 3.40.50.1820
4b4uA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.7525 199 235 3.40.50.10860
af_Q6ZIJ0_29_342_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.75 46 262 3.40.50.1820
af_A1ZA97_18_558_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.744 47 186 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1U7CRV8-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9698 6 272 GO:0005507
GO:0016715
GO:0016787
AF-A0A840PD74-F1-model_v4 Acetyl esterase/lipase 0.9671 9 266 GO:0016787
AF-A0A2S8WBY8-F1-model_v4 Esterase 0.9593 1 269 GO:0016787
AF-D1CHM3-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9588 3 267 GO:0016787
AF-A0A2V8QYV4-F1-model_v4 Alpha/beta hydrolase 0.9524 8 161 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.82 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map