F315331

General Info

Members Datasets Scaffolds Average Seq Length
206 146 412 194

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100177281|Ga0307415_1001772813
Length 216
Sequence MTGAKPVPLLNAANVLTVVRMVLVPVFVVFVVAGRMTDTGWQLAAGITFVVASATDYVDGWIARTYNLVTSFGKVVDPIADKALTGTALVLLSLYDRLPWWVTVLILVREWGVTALRFWVLRHGVIPASRGGKVKTALQILAIGWYLTPLPDGLAAVGPWLMAGALIVTVVTGLDYVLRAYRVRRDSLRRRAGRDAARMSSQDSMLSAPTADEPVA

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
57 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
64 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
65 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
66 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
72 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
73 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
74 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
75 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
76 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
77 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
78 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
81 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
82 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
83 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
84 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
85 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
86 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
87 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
88 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
89 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
90 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
91 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
92 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
93 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
94 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
95 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
96 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
97 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
98 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
119 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
123 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
126 2501939600 Micromonospora sp. L5 Isolate Unclassified
127 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
128 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
129 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
130 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
131 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
132 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
133 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
134 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
135 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
136 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
137 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
138 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
139 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
140 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
141 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
142 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
143 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
144 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
145 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
146 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.35
Metatranscriptomes 1.46
Isolates 10.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 4.85
Rhizosphere 83.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100177281 3300032126 Bacteria 1669
2 LJQas_1003029 3300000549 Bacteria 2278
3 LJQas_1003749 3300000549 Bacteria 2016
4 JGI24740J21852_10091637 3300001979 Bacteria 783
5 JGI25152J39213_1000655 3300002773 Bacteria 18121
6 JGI25406J46586_10008268 3300003203 Bacteria 4723
7 JGI25406J46586_10025536 3300003203 Bacteria 2292
8 JGI25406J46586_10049297 3300003203 Bacteria 1422
9 Ga0006562J51391_1005672 3300003578 Bacteria 4790
10 Ga0070683_100245713 3300005329 Bacteria 1702
11 Ga0070668_100250929 3300005347 Bacteria 1469
12 Ga0070694_100416253 3300005444 Bacteria 1055
13 Ga0070678_100475018 3300005456 Bacteria 1099
14 Ga0070679_100036055 3300005530 Bacteria 4907
15 Ga0070679_100406129 3300005530 Bacteria 1308
16 Ga0070665_100004987 3300005548 Bacteria 13770
17 Ga0070665_100067641 3300005548 Bacteria 3582
18 Ga0070664_100371912 3300005564 Bacteria 1303
19 Ga0070664_100746021 3300005564 Bacteria 914
20 Ga0068857_100032828 3300005577 Bacteria 4588
21 Ga0068857_100451972 3300005577 Bacteria 1201
22 Ga0068857_100720113 3300005577 Bacteria 949
23 Ga0068852_101006388 3300005616 Bacteria 852
24 Ga0068861_100410760 3300005719 Bacteria 1204
25 Ga0068863_100011022 3300005841 Bacteria 8768
26 Ga0068858_100059095 3300005842 Bacteria 3544
27 Ga0068860_100096523 3300005843 Bacteria 2817
28 Ga0081540_1020008 3300005983 Bacteria 4043
29 Ga0081539_10000357 3300005985 Bacteria 100714
30 Ga0081539_10000465 3300005985 Bacteria 85809
31 Ga0081539_10000536 3300005985 Bacteria 78807
32 Ga0075428_100000251 3300006844 Bacteria 52691
33 Ga0075428_100387676 3300006844 Bacteria 1498
34 Ga0075430_100000441 3300006846 Bacteria 30890
35 Ga0075430_100000968 3300006846 Bacteria 22624
36 Ga0075430_100440834 3300006846 Bacteria 1075
37 Ga0075430_100467466 3300006846 Bacteria 1041
38 Ga0075431_100000579 3300006847 Bacteria 30982
39 Ga0075431_100035822 3300006847 Bacteria 5110
40 Ga0075431_101019446 3300006847 Bacteria 794
41 Ga0075434_100958582 3300006871 Bacteria 870
42 Ga0075429_100000942 3300006880 Bacteria 23044
43 Ga0075429_100022094 3300006880 Bacteria 5517
44 Ga0075429_100243556 3300006880 Bacteria 1575
45 Ga0075429_100288455 3300006880 Bacteria 1437
46 Ga0075429_100314195 3300006880 Bacteria 1371
47 Ga0105244_10002059 3300009036 Bacteria 15489
48 Ga0105247_10248114 3300009101 Bacteria 1216
49 Ga0105247_10305267 3300009101 Bacteria 1105
50 Ga0114129_10000024 3300009147 Bacteria 116794
51 Ga0114129_10009311 3300009147 Bacteria 14011
52 Ga0114129_10015115 3300009147 Bacteria 10985
53 Ga0114129_10205131 3300009147 Bacteria 2668
54 Ga0114129_10313242 3300009147 Bacteria 2088
55 Ga0114129_10635372 3300009147 Bacteria 1379
56 Ga0114129_10730591 3300009147 Bacteria 1269
57 Ga0105249_11259415 3300009553 Bacteria 811
58 Ga0105246_10074431 3300011119 Bacteria 2401
59 Ga0163162_10306976 3300013306 Bacteria 1719
60 Ga0157372_10362448 3300013307 Bacteria 1689
61 Ga0157375_10265788 3300013308 Bacteria 1877
62 Ga0163163_10038260 3300014325 Bacteria 4674
63 Ga0163163_10364770 3300014325 Bacteria 1501
64 Ga0206356_10244172 3300020070 Bacteria 1050
65 Ga0206353_10168740 3300020082 Bacteria 2123
66 Ga0209051_1015037 3300025303 Bacteria 3581
67 Ga0207652_10271284 3300025921 Bacteria 1530
68 Ga0207650_10136731 3300025925 Bacteria 1923
69 Ga0207661_10205880 3300025944 Bacteria 1732
70 Ga0207679_10439022 3300025945 Bacteria 1155
71 Ga0207668_10015484 3300025972 Bacteria 4739
72 Ga0207658_10373429 3300025986 Bacteria 1247
73 Ga0207677_10485558 3300026023 Bacteria 1065
74 Ga0207703_10227814 3300026035 Bacteria 1669
75 Ga0207702_10495208 3300026078 Bacteria 1191
76 Ga0207641_10879884 3300026088 Bacteria 889
77 Ga0207674_10040769 3300026116 Bacteria 4807
78 Ga0207698_10503990 3300026142 Bacteria 1178
79 Ga0268266_10057428 3300028379 Bacteria 3349
80 Ga0268266_10439291 3300028379 Bacteria 1239
81 Ga0268264_10096103 3300028381 Bacteria 2565
82 Ga0307515_10016444 3300028794 Bacteria 13540
83 Ga0307515_10120011 3300028794 Bacteria 2986
84 Ga0307512_10133320 3300030522 Bacteria 1549
85 Ga0307513_10017253 3300031456 Bacteria 8663
86 Ga0307513_10623078 3300031456 Bacteria 787
87 Ga0307405_10096569 3300031731 Bacteria 1971
88 Ga0307410_10108310 3300031852 Bacteria 2006
89 Ga0307410_10123450 3300031852 Bacteria 1892
90 Ga0307406_10111269 3300031901 Bacteria 1886
91 Ga0307406_10349442 3300031901 Bacteria 1155
92 Ga0307407_10576235 3300031903 Bacteria 835
93 Ga0307412_10004200 3300031911 Bacteria 8035
94 Ga0307409_100008362 3300031995 Bacteria 6275
95 Ga0307416_100527552 3300032002 Bacteria 1250
96 Ga0307415_100049308 3300032126 Bacteria 2846
97 Ga0307415_100302244 3300032126 Bacteria 1326
98 Ga0373950_0019380 3300034818 Bacteria 1187
99 Ga0373941_0182691 3300035115 Bacteria 788
100 Ga0373942_0000094 3300035207 Bacteria 19686
101 Ga0373942_0021564 3300035207 Bacteria 1626
102 Ga0373962_0000690 3300035242 Bacteria 7632
103 Ga0373962_0169265 3300035242 Bacteria 725
104 Ga0395900_0114023 3300037418 Bacteria 2774
105 Ga0395898_0022855 3300037466 Bacteria 6325
106 Ga0395905_0780560 3300037471 Bacteria 858
107 Ga0395901_0076674 3300038443 Bacteria 3488
108 Ga0395901_0764068 3300038443 Bacteria 958
109 Ga0439436_0049060 3300041404 Bacteria 1196
110 Ga0439438_002552 3300041405 Bacteria 7723
111 Ga0439439_0000073 3300041406 Bacteria 12878
112 Ga0439447_048566 3300041407 Bacteria 1018
113 Ga0439461_0001111 3300041410 Bacteria 4070
114 Ga0439466_0003826 3300041411 Bacteria 5811
115 Ga0451802_1470320 3300041460 Bacteria 1260
116 Ga0451833_0655731 3300041491 Bacteria 603
117 Ga0451853_0940374 3300041512 Bacteria 4767
118 Ga0439431_0037497 3300041997 Bacteria 1224
119 Ga0439433_0000428 3300041999 Bacteria 7696
120 Ga0439442_002190 3300042002 Bacteria 3850
121 Ga0439432_037813 3300042006 Bacteria 1538
122 Ga0439449_0001670 3300042007 Bacteria 8722
123 Ga0439449_0048355 3300042007 Bacteria 1574
124 Ga0439449_0137522 3300042007 Bacteria 909
125 Ga0439452_022808 3300042010 Bacteria 1616
126 Ga0439457_014183 3300042014 Bacteria 1785
127 Ga0439462_0008716 3300042015 Bacteria 2562
128 Ga0450911_004163 3300042115 Bacteria 2410
129 Ga0450919_000773 3300042121 Bacteria 4091
130 Ga0450920_033002 3300042122 Bacteria 1022
131 Ga0450922_008203 3300042124 Bacteria 983
132 Ga0450906_027977 3300042145 Bacteria 999
133 Ga0450910_030833 3300042147 Bacteria 842
134 Ga0439446_0006556 3300042156 Bacteria 3041
135 Ga0450908_006812 3300042184 Bacteria 2162
136 Ga0450909_000315 3300042185 Bacteria 6014
137 Ga0439434_0000627 3300042435 Bacteria 10180
138 Ga0450918_001127 3300042531 Bacteria 5481
139 Ga0466957_0229945 3300044842 Bacteria 1227
140 Ga0466967_0171086 3300045976 Bacteria 2044
141 Ga0495629_0354310 3300046459 Bacteria 1001
142 Ga0495651_0276547 3300046462 Bacteria 1136
143 Ga0495594_0010399 3300046499 Bacteria 4826
144 Ga0495594_0111300 3300046499 Bacteria 1544
145 Ga0495632_0024534 3300046519 Bacteria 3201
146 Ga0495668_0000103 3300046616 Bacteria 135853
147 Ga0495625_0000643 3300046660 Bacteria 50299
148 Ga0495658_0010943 3300046683 Bacteria 4549
149 Ga0495676_0060748 3300047321 Bacteria 2960
150 Ga0495626_0000197 3300048091 Bacteria 73484
151 Ga0496104_0048474 3300048907 Bacteria 4005
152 Ga0496104_0355197 3300048907 Bacteria 1378
153 Ga0496108_0526951 3300048911 Bacteria 1031
154 Ga0496108_0583225 3300048911 Bacteria 975
155 Ga0496109_0165083 3300048912 Bacteria 2076
156 Ga0496112_0035307 3300048915 Bacteria 4869
157 Ga0496112_0069440 3300048915 Bacteria 3480
158 Ga0496112_1089124 3300048915 Bacteria 717
159 Ga0496113_0306989 3300048916 Bacteria 1271
160 Ga0501048_0176826 3300049582 Bacteria 1513
161 nmdc:mga05p37_1365024_c1 3300050507 Bacteria 717
162 nmdc:mga05p37_151090_c1 3300050507 Bacteria 2840
163 nmdc:mga05p37_189_c1 3300050507 Bacteria 61137
164 nmdc:mga09592_115533_c1 3300050508 Bacteria 2303
165 nmdc:mga09592_123892_c1 3300050508 Bacteria 2221
166 nmdc:mga09592_164532_c1 3300050508 Bacteria 1917
167 nmdc:mga09592_2_c1 3300050508 Bacteria 168133
168 nmdc:mga09592_493652_c1 3300050508 Bacteria 1054
169 nmdc:mga09592_501846_c1 3300050508 Bacteria 1045
170 nmdc:mga0qj67_10_c2 3300050509 Bacteria 57980
171 nmdc:mga0qj67_278839_c1 3300050509 Bacteria 1355
172 nmdc:mga0qj67_279_c1 3300050509 Bacteria 35505
173 nmdc:mga0qj67_335208_c1 3300050509 Bacteria 1224
174 nmdc:mga0qj67_507030_c1 3300050509 Bacteria 970
175 nmdc:mga06r32_1015622_c1 3300050510 Bacteria 781
176 nmdc:mga06r32_3340_c1 3300050510 Bacteria 14363
177 nmdc:mga06r32_39_c1 3300050510 Bacteria 54656
178 nmdc:mga06r32_471068_c1 3300050510 Bacteria 1234
179 nmdc:mga06r32_929608_c1 3300050510 Bacteria 825
180 nmdc:mga0a205_845646_c1 3300050515 Bacteria 762
181 Ga0495619_0441151 3300053085 Bacteria 898
182 Ga0500644_0028737 3300053088 Bacteria 1742
183 Ga0500646_0027782 3300053090 Bacteria 1541
184 Ga0501082_0610952 3300060353 Bacteria 954
185 Ga0530510_0018802 3300061734 Bacteria 4900
186 2501944774 2501939600 Bacteria 6907073
187 2643853380 2643221567 Bacteria 4163945
188 2644137340 2643221624 Bacteria 4384879
189 2848551882 2848551377 Bacteria 3720646
190 2856861168 2856858025 Bacteria 7255264
191 2857743753 2857740372 Bacteria 4782044
192 2858903877 2858902515 Bacteria 7086037
193 2867324484 2867319477 Bacteria 7069771
194 2868091114 2868088558 Bacteria 7609351
195 2887481919 2887478801 Bacteria 8972725
196 2904499655 2904497146 Bacteria 4731781
197 2904780311 2904776348 Bacteria 4658726
198 2910814757 2910809715 Bacteria 4982797
199 2919036106 2919034639 Bacteria 4763403
200 2919447144 2919446982 Bacteria 3994487
201 2919538679 2919538618 Bacteria 4677069
202 2932431054 2932426870 Bacteria 4547726
203 2933419135 2933418574 Bacteria 4476724
204 2939678501 2939674588 Bacteria 4844420
205 2996226629 2996221748 Bacteria 6799777
206 649811927 649633069 Bacteria 6962533
207 Ga0307415_100177281
208 LJQas_1003029
209 LJQas_1003749
210 JGI24740J21852_10091637
211 JGI25152J39213_1000655
212 JGI25406J46586_10008268
213 JGI25406J46586_10025536
214 JGI25406J46586_10049297
215 Ga0006562J51391_1005672
216 Ga0070683_100245713
217 Ga0070668_100250929
218 Ga0070694_100416253
219 Ga0070678_100475018
220 Ga0070679_100036055
221 Ga0070679_100406129
222 Ga0070665_100004987
223 Ga0070665_100067641
224 Ga0070664_100371912
225 Ga0070664_100746021
226 Ga0068857_100032828
227 Ga0068857_100451972
228 Ga0068857_100720113
229 Ga0068852_101006388
230 Ga0068861_100410760
231 Ga0068863_100011022
232 Ga0068858_100059095
233 Ga0068860_100096523
234 Ga0081540_1020008
235 Ga0081539_10000357
236 Ga0081539_10000465
237 Ga0081539_10000536
238 Ga0075428_100000251
239 Ga0075428_100387676
240 Ga0075430_100000441
241 Ga0075430_100000968
242 Ga0075430_100440834
243 Ga0075430_100467466
244 Ga0075431_100000579
245 Ga0075431_100035822
246 Ga0075431_101019446
247 Ga0075434_100958582
248 Ga0075429_100000942
249 Ga0075429_100022094
250 Ga0075429_100243556
251 Ga0075429_100288455
252 Ga0075429_100314195
253 Ga0105244_10002059
254 Ga0105247_10248114
255 Ga0105247_10305267
256 Ga0114129_10000024
257 Ga0114129_10009311
258 Ga0114129_10015115
259 Ga0114129_10205131
260 Ga0114129_10313242
261 Ga0114129_10635372
262 Ga0114129_10730591
263 Ga0105249_11259415
264 Ga0105246_10074431
265 Ga0163162_10306976
266 Ga0157372_10362448
267 Ga0157375_10265788
268 Ga0163163_10038260
269 Ga0163163_10364770
270 Ga0206356_10244172
271 Ga0206353_10168740
272 Ga0209051_1015037
273 Ga0207652_10271284
274 Ga0207650_10136731
275 Ga0207661_10205880
276 Ga0207679_10439022
277 Ga0207668_10015484
278 Ga0207658_10373429
279 Ga0207677_10485558
280 Ga0207703_10227814
281 Ga0207702_10495208
282 Ga0207641_10879884
283 Ga0207674_10040769
284 Ga0207698_10503990
285 Ga0268266_10057428
286 Ga0268266_10439291
287 Ga0268264_10096103
288 Ga0307515_10016444
289 Ga0307515_10120011
290 Ga0307512_10133320
291 Ga0307513_10017253
292 Ga0307513_10623078
293 Ga0307405_10096569
294 Ga0307410_10108310
295 Ga0307410_10123450
296 Ga0307406_10111269
297 Ga0307406_10349442
298 Ga0307407_10576235
299 Ga0307412_10004200
300 Ga0307409_100008362
301 Ga0307416_100527552
302 Ga0307415_100049308
303 Ga0307415_100302244
304 Ga0373950_0019380
305 Ga0373941_0182691
306 Ga0373942_0000094
307 Ga0373942_0021564
308 Ga0373962_0000690
309 Ga0373962_0169265
310 Ga0395900_0114023
311 Ga0395898_0022855
312 Ga0395905_0780560
313 Ga0395901_0076674
314 Ga0395901_0764068
315 Ga0439436_0049060
316 Ga0439438_002552
317 Ga0439439_0000073
318 Ga0439447_048566
319 Ga0439461_0001111
320 Ga0439466_0003826
321 Ga0451802_1470320
322 Ga0451833_0655731
323 Ga0451853_0940374
324 Ga0439431_0037497
325 Ga0439433_0000428
326 Ga0439442_002190
327 Ga0439432_037813
328 Ga0439449_0001670
329 Ga0439449_0048355
330 Ga0439449_0137522
331 Ga0439452_022808
332 Ga0439457_014183
333 Ga0439462_0008716
334 Ga0450911_004163
335 Ga0450919_000773
336 Ga0450920_033002
337 Ga0450922_008203
338 Ga0450906_027977
339 Ga0450910_030833
340 Ga0439446_0006556
341 Ga0450908_006812
342 Ga0450909_000315
343 Ga0439434_0000627
344 Ga0450918_001127
345 Ga0466957_0229945
346 Ga0466967_0171086
347 Ga0495629_0354310
348 Ga0495651_0276547
349 Ga0495594_0010399
350 Ga0495594_0111300
351 Ga0495632_0024534
352 Ga0495668_0000103
353 Ga0495625_0000643
354 Ga0495658_0010943
355 Ga0495676_0060748
356 Ga0495626_0000197
357 Ga0496104_0048474
358 Ga0496104_0355197
359 Ga0496108_0526951
360 Ga0496108_0583225
361 Ga0496109_0165083
362 Ga0496112_0035307
363 Ga0496112_0069440
364 Ga0496112_1089124
365 Ga0496113_0306989
366 Ga0501048_0176826
367 nmdc:mga05p37_1365024_c1
368 nmdc:mga05p37_151090_c1
369 nmdc:mga05p37_189_c1
370 nmdc:mga09592_115533_c1
371 nmdc:mga09592_123892_c1
372 nmdc:mga09592_164532_c1
373 nmdc:mga09592_2_c1
374 nmdc:mga09592_493652_c1
375 nmdc:mga09592_501846_c1
376 nmdc:mga0qj67_10_c2
377 nmdc:mga0qj67_278839_c1
378 nmdc:mga0qj67_279_c1
379 nmdc:mga0qj67_335208_c1
380 nmdc:mga0qj67_507030_c1
381 nmdc:mga06r32_1015622_c1
382 nmdc:mga06r32_3340_c1
383 nmdc:mga06r32_39_c1
384 nmdc:mga06r32_471068_c1
385 nmdc:mga06r32_929608_c1
386 nmdc:mga0a205_845646_c1
387 Ga0495619_0441151
388 Ga0500644_0028737
389 Ga0500646_0027782
390 Ga0501082_0610952
391 Ga0530510_0018802
392 2501944774
393 2643853380
394 2644137340
395 2848551882
396 2856861168
397 2857743753
398 2858903877
399 2867324484
400 2868091114
401 2887481919
402 2904499655
403 2904780311
404 2910814757
405 2919036106
406 2919447144
407 2919538679
408 2932431054
409 2933419135
410 2939678501
411 2996226629
412 649811927

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

10

171

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.8342 17 192
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.7926 17 192
8ero-assembly1.cif.gz_A structure of xenopus cholinephosphotransferase1 in complex with cdp 0.6467 15 193
6wm5-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii 0.6375 9 192
6wmv-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding 0.634 9 194
ID Description Score Start End Superfamily
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9246 11 196 1.20.120.1760
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9051 11 196 1.20.120.1760
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9028 16 195 1.20.120.1760
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8881 16 195 1.20.120.1760
af_P9WPG5_6_192_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8762 14 198 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A2R7RB60-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9856 24 206 GO:0005886
GO:0008444
GO:0046474
AF-A0A542EFI0-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9745 15 202 GO:0005886
GO:0008444
GO:0046474
AF-A0A372JBJ6-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9709 15 202 GO:0005886
GO:0008444
GO:0046474
AF-A0A3Q9UQ29-F1-model_v4 deleted 0.9703 15 206
AF-A0A2R7RB60-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9699 24 206 GO:0005886
GO:0008444
GO:0046474

Map