F315331
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 206 | 146 | 412 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300032126|Ga0307415_100177281|Ga0307415_1001772813 |
| Length | 216 |
| Sequence | MTGAKPVPLLNAANVLTVVRMVLVPVFVVFVVAGRMTDTGWQLAAGITFVVASATDYVDGWIARTYNLVTSFGKVVDPIADKALTGTALVLLSLYDRLPWWVTVLILVREWGVTALRFWVLRHGVIPASRGGKVKTALQILAIGWYLTPLPDGLAAVGPWLMAGALIVTVVTGLDYVLRAYRVRRDSLRRRAGRDAARMSSQDSMLSAPTADEPVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 15 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 16 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 17 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 18 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 19 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 20 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 21 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 22 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 23 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 24 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 25 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 26 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 27 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 37 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 38 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 39 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 54 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 55 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 56 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 57 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 58 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 59 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 60 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 61 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 62 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 63 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 64 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 65 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 66 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 67 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 68 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 69 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 70 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 71 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 72 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 73 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 74 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 75 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 76 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 77 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 78 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 79 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 80 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 81 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 82 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 83 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 84 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 85 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 86 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 87 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 88 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 89 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 90 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 91 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 92 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 93 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 94 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 95 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 96 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 97 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 98 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 99 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 100 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 101 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 111 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 112 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 113 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 114 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 115 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 117 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 118 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 119 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 120 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 121 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 123 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 124 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 126 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 127 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 128 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 129 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 130 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 131 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 132 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 133 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 134 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 135 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 136 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 137 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 138 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 139 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 140 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 141 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 142 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 143 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 144 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 145 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 146 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.35 |
| Metatranscriptomes | 1.46 |
| Isolates | 10.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.94 |
| Nodule | 0 |
| Rhizoplane | 4.85 |
| Rhizosphere | 83.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307415_100177281 | 3300032126 | Bacteria | 1669 |
| 2 | LJQas_1003029 | 3300000549 | Bacteria | 2278 |
| 3 | LJQas_1003749 | 3300000549 | Bacteria | 2016 |
| 4 | JGI24740J21852_10091637 | 3300001979 | Bacteria | 783 |
| 5 | JGI25152J39213_1000655 | 3300002773 | Bacteria | 18121 |
| 6 | JGI25406J46586_10008268 | 3300003203 | Bacteria | 4723 |
| 7 | JGI25406J46586_10025536 | 3300003203 | Bacteria | 2292 |
| 8 | JGI25406J46586_10049297 | 3300003203 | Bacteria | 1422 |
| 9 | Ga0006562J51391_1005672 | 3300003578 | Bacteria | 4790 |
| 10 | Ga0070683_100245713 | 3300005329 | Bacteria | 1702 |
| 11 | Ga0070668_100250929 | 3300005347 | Bacteria | 1469 |
| 12 | Ga0070694_100416253 | 3300005444 | Bacteria | 1055 |
| 13 | Ga0070678_100475018 | 3300005456 | Bacteria | 1099 |
| 14 | Ga0070679_100036055 | 3300005530 | Bacteria | 4907 |
| 15 | Ga0070679_100406129 | 3300005530 | Bacteria | 1308 |
| 16 | Ga0070665_100004987 | 3300005548 | Bacteria | 13770 |
| 17 | Ga0070665_100067641 | 3300005548 | Bacteria | 3582 |
| 18 | Ga0070664_100371912 | 3300005564 | Bacteria | 1303 |
| 19 | Ga0070664_100746021 | 3300005564 | Bacteria | 914 |
| 20 | Ga0068857_100032828 | 3300005577 | Bacteria | 4588 |
| 21 | Ga0068857_100451972 | 3300005577 | Bacteria | 1201 |
| 22 | Ga0068857_100720113 | 3300005577 | Bacteria | 949 |
| 23 | Ga0068852_101006388 | 3300005616 | Bacteria | 852 |
| 24 | Ga0068861_100410760 | 3300005719 | Bacteria | 1204 |
| 25 | Ga0068863_100011022 | 3300005841 | Bacteria | 8768 |
| 26 | Ga0068858_100059095 | 3300005842 | Bacteria | 3544 |
| 27 | Ga0068860_100096523 | 3300005843 | Bacteria | 2817 |
| 28 | Ga0081540_1020008 | 3300005983 | Bacteria | 4043 |
| 29 | Ga0081539_10000357 | 3300005985 | Bacteria | 100714 |
| 30 | Ga0081539_10000465 | 3300005985 | Bacteria | 85809 |
| 31 | Ga0081539_10000536 | 3300005985 | Bacteria | 78807 |
| 32 | Ga0075428_100000251 | 3300006844 | Bacteria | 52691 |
| 33 | Ga0075428_100387676 | 3300006844 | Bacteria | 1498 |
| 34 | Ga0075430_100000441 | 3300006846 | Bacteria | 30890 |
| 35 | Ga0075430_100000968 | 3300006846 | Bacteria | 22624 |
| 36 | Ga0075430_100440834 | 3300006846 | Bacteria | 1075 |
| 37 | Ga0075430_100467466 | 3300006846 | Bacteria | 1041 |
| 38 | Ga0075431_100000579 | 3300006847 | Bacteria | 30982 |
| 39 | Ga0075431_100035822 | 3300006847 | Bacteria | 5110 |
| 40 | Ga0075431_101019446 | 3300006847 | Bacteria | 794 |
| 41 | Ga0075434_100958582 | 3300006871 | Bacteria | 870 |
| 42 | Ga0075429_100000942 | 3300006880 | Bacteria | 23044 |
| 43 | Ga0075429_100022094 | 3300006880 | Bacteria | 5517 |
| 44 | Ga0075429_100243556 | 3300006880 | Bacteria | 1575 |
| 45 | Ga0075429_100288455 | 3300006880 | Bacteria | 1437 |
| 46 | Ga0075429_100314195 | 3300006880 | Bacteria | 1371 |
| 47 | Ga0105244_10002059 | 3300009036 | Bacteria | 15489 |
| 48 | Ga0105247_10248114 | 3300009101 | Bacteria | 1216 |
| 49 | Ga0105247_10305267 | 3300009101 | Bacteria | 1105 |
| 50 | Ga0114129_10000024 | 3300009147 | Bacteria | 116794 |
| 51 | Ga0114129_10009311 | 3300009147 | Bacteria | 14011 |
| 52 | Ga0114129_10015115 | 3300009147 | Bacteria | 10985 |
| 53 | Ga0114129_10205131 | 3300009147 | Bacteria | 2668 |
| 54 | Ga0114129_10313242 | 3300009147 | Bacteria | 2088 |
| 55 | Ga0114129_10635372 | 3300009147 | Bacteria | 1379 |
| 56 | Ga0114129_10730591 | 3300009147 | Bacteria | 1269 |
| 57 | Ga0105249_11259415 | 3300009553 | Bacteria | 811 |
| 58 | Ga0105246_10074431 | 3300011119 | Bacteria | 2401 |
| 59 | Ga0163162_10306976 | 3300013306 | Bacteria | 1719 |
| 60 | Ga0157372_10362448 | 3300013307 | Bacteria | 1689 |
| 61 | Ga0157375_10265788 | 3300013308 | Bacteria | 1877 |
| 62 | Ga0163163_10038260 | 3300014325 | Bacteria | 4674 |
| 63 | Ga0163163_10364770 | 3300014325 | Bacteria | 1501 |
| 64 | Ga0206356_10244172 | 3300020070 | Bacteria | 1050 |
| 65 | Ga0206353_10168740 | 3300020082 | Bacteria | 2123 |
| 66 | Ga0209051_1015037 | 3300025303 | Bacteria | 3581 |
| 67 | Ga0207652_10271284 | 3300025921 | Bacteria | 1530 |
| 68 | Ga0207650_10136731 | 3300025925 | Bacteria | 1923 |
| 69 | Ga0207661_10205880 | 3300025944 | Bacteria | 1732 |
| 70 | Ga0207679_10439022 | 3300025945 | Bacteria | 1155 |
| 71 | Ga0207668_10015484 | 3300025972 | Bacteria | 4739 |
| 72 | Ga0207658_10373429 | 3300025986 | Bacteria | 1247 |
| 73 | Ga0207677_10485558 | 3300026023 | Bacteria | 1065 |
| 74 | Ga0207703_10227814 | 3300026035 | Bacteria | 1669 |
| 75 | Ga0207702_10495208 | 3300026078 | Bacteria | 1191 |
| 76 | Ga0207641_10879884 | 3300026088 | Bacteria | 889 |
| 77 | Ga0207674_10040769 | 3300026116 | Bacteria | 4807 |
| 78 | Ga0207698_10503990 | 3300026142 | Bacteria | 1178 |
| 79 | Ga0268266_10057428 | 3300028379 | Bacteria | 3349 |
| 80 | Ga0268266_10439291 | 3300028379 | Bacteria | 1239 |
| 81 | Ga0268264_10096103 | 3300028381 | Bacteria | 2565 |
| 82 | Ga0307515_10016444 | 3300028794 | Bacteria | 13540 |
| 83 | Ga0307515_10120011 | 3300028794 | Bacteria | 2986 |
| 84 | Ga0307512_10133320 | 3300030522 | Bacteria | 1549 |
| 85 | Ga0307513_10017253 | 3300031456 | Bacteria | 8663 |
| 86 | Ga0307513_10623078 | 3300031456 | Bacteria | 787 |
| 87 | Ga0307405_10096569 | 3300031731 | Bacteria | 1971 |
| 88 | Ga0307410_10108310 | 3300031852 | Bacteria | 2006 |
| 89 | Ga0307410_10123450 | 3300031852 | Bacteria | 1892 |
| 90 | Ga0307406_10111269 | 3300031901 | Bacteria | 1886 |
| 91 | Ga0307406_10349442 | 3300031901 | Bacteria | 1155 |
| 92 | Ga0307407_10576235 | 3300031903 | Bacteria | 835 |
| 93 | Ga0307412_10004200 | 3300031911 | Bacteria | 8035 |
| 94 | Ga0307409_100008362 | 3300031995 | Bacteria | 6275 |
| 95 | Ga0307416_100527552 | 3300032002 | Bacteria | 1250 |
| 96 | Ga0307415_100049308 | 3300032126 | Bacteria | 2846 |
| 97 | Ga0307415_100302244 | 3300032126 | Bacteria | 1326 |
| 98 | Ga0373950_0019380 | 3300034818 | Bacteria | 1187 |
| 99 | Ga0373941_0182691 | 3300035115 | Bacteria | 788 |
| 100 | Ga0373942_0000094 | 3300035207 | Bacteria | 19686 |
| 101 | Ga0373942_0021564 | 3300035207 | Bacteria | 1626 |
| 102 | Ga0373962_0000690 | 3300035242 | Bacteria | 7632 |
| 103 | Ga0373962_0169265 | 3300035242 | Bacteria | 725 |
| 104 | Ga0395900_0114023 | 3300037418 | Bacteria | 2774 |
| 105 | Ga0395898_0022855 | 3300037466 | Bacteria | 6325 |
| 106 | Ga0395905_0780560 | 3300037471 | Bacteria | 858 |
| 107 | Ga0395901_0076674 | 3300038443 | Bacteria | 3488 |
| 108 | Ga0395901_0764068 | 3300038443 | Bacteria | 958 |
| 109 | Ga0439436_0049060 | 3300041404 | Bacteria | 1196 |
| 110 | Ga0439438_002552 | 3300041405 | Bacteria | 7723 |
| 111 | Ga0439439_0000073 | 3300041406 | Bacteria | 12878 |
| 112 | Ga0439447_048566 | 3300041407 | Bacteria | 1018 |
| 113 | Ga0439461_0001111 | 3300041410 | Bacteria | 4070 |
| 114 | Ga0439466_0003826 | 3300041411 | Bacteria | 5811 |
| 115 | Ga0451802_1470320 | 3300041460 | Bacteria | 1260 |
| 116 | Ga0451833_0655731 | 3300041491 | Bacteria | 603 |
| 117 | Ga0451853_0940374 | 3300041512 | Bacteria | 4767 |
| 118 | Ga0439431_0037497 | 3300041997 | Bacteria | 1224 |
| 119 | Ga0439433_0000428 | 3300041999 | Bacteria | 7696 |
| 120 | Ga0439442_002190 | 3300042002 | Bacteria | 3850 |
| 121 | Ga0439432_037813 | 3300042006 | Bacteria | 1538 |
| 122 | Ga0439449_0001670 | 3300042007 | Bacteria | 8722 |
| 123 | Ga0439449_0048355 | 3300042007 | Bacteria | 1574 |
| 124 | Ga0439449_0137522 | 3300042007 | Bacteria | 909 |
| 125 | Ga0439452_022808 | 3300042010 | Bacteria | 1616 |
| 126 | Ga0439457_014183 | 3300042014 | Bacteria | 1785 |
| 127 | Ga0439462_0008716 | 3300042015 | Bacteria | 2562 |
| 128 | Ga0450911_004163 | 3300042115 | Bacteria | 2410 |
| 129 | Ga0450919_000773 | 3300042121 | Bacteria | 4091 |
| 130 | Ga0450920_033002 | 3300042122 | Bacteria | 1022 |
| 131 | Ga0450922_008203 | 3300042124 | Bacteria | 983 |
| 132 | Ga0450906_027977 | 3300042145 | Bacteria | 999 |
| 133 | Ga0450910_030833 | 3300042147 | Bacteria | 842 |
| 134 | Ga0439446_0006556 | 3300042156 | Bacteria | 3041 |
| 135 | Ga0450908_006812 | 3300042184 | Bacteria | 2162 |
| 136 | Ga0450909_000315 | 3300042185 | Bacteria | 6014 |
| 137 | Ga0439434_0000627 | 3300042435 | Bacteria | 10180 |
| 138 | Ga0450918_001127 | 3300042531 | Bacteria | 5481 |
| 139 | Ga0466957_0229945 | 3300044842 | Bacteria | 1227 |
| 140 | Ga0466967_0171086 | 3300045976 | Bacteria | 2044 |
| 141 | Ga0495629_0354310 | 3300046459 | Bacteria | 1001 |
| 142 | Ga0495651_0276547 | 3300046462 | Bacteria | 1136 |
| 143 | Ga0495594_0010399 | 3300046499 | Bacteria | 4826 |
| 144 | Ga0495594_0111300 | 3300046499 | Bacteria | 1544 |
| 145 | Ga0495632_0024534 | 3300046519 | Bacteria | 3201 |
| 146 | Ga0495668_0000103 | 3300046616 | Bacteria | 135853 |
| 147 | Ga0495625_0000643 | 3300046660 | Bacteria | 50299 |
| 148 | Ga0495658_0010943 | 3300046683 | Bacteria | 4549 |
| 149 | Ga0495676_0060748 | 3300047321 | Bacteria | 2960 |
| 150 | Ga0495626_0000197 | 3300048091 | Bacteria | 73484 |
| 151 | Ga0496104_0048474 | 3300048907 | Bacteria | 4005 |
| 152 | Ga0496104_0355197 | 3300048907 | Bacteria | 1378 |
| 153 | Ga0496108_0526951 | 3300048911 | Bacteria | 1031 |
| 154 | Ga0496108_0583225 | 3300048911 | Bacteria | 975 |
| 155 | Ga0496109_0165083 | 3300048912 | Bacteria | 2076 |
| 156 | Ga0496112_0035307 | 3300048915 | Bacteria | 4869 |
| 157 | Ga0496112_0069440 | 3300048915 | Bacteria | 3480 |
| 158 | Ga0496112_1089124 | 3300048915 | Bacteria | 717 |
| 159 | Ga0496113_0306989 | 3300048916 | Bacteria | 1271 |
| 160 | Ga0501048_0176826 | 3300049582 | Bacteria | 1513 |
| 161 | nmdc:mga05p37_1365024_c1 | 3300050507 | Bacteria | 717 |
| 162 | nmdc:mga05p37_151090_c1 | 3300050507 | Bacteria | 2840 |
| 163 | nmdc:mga05p37_189_c1 | 3300050507 | Bacteria | 61137 |
| 164 | nmdc:mga09592_115533_c1 | 3300050508 | Bacteria | 2303 |
| 165 | nmdc:mga09592_123892_c1 | 3300050508 | Bacteria | 2221 |
| 166 | nmdc:mga09592_164532_c1 | 3300050508 | Bacteria | 1917 |
| 167 | nmdc:mga09592_2_c1 | 3300050508 | Bacteria | 168133 |
| 168 | nmdc:mga09592_493652_c1 | 3300050508 | Bacteria | 1054 |
| 169 | nmdc:mga09592_501846_c1 | 3300050508 | Bacteria | 1045 |
| 170 | nmdc:mga0qj67_10_c2 | 3300050509 | Bacteria | 57980 |
| 171 | nmdc:mga0qj67_278839_c1 | 3300050509 | Bacteria | 1355 |
| 172 | nmdc:mga0qj67_279_c1 | 3300050509 | Bacteria | 35505 |
| 173 | nmdc:mga0qj67_335208_c1 | 3300050509 | Bacteria | 1224 |
| 174 | nmdc:mga0qj67_507030_c1 | 3300050509 | Bacteria | 970 |
| 175 | nmdc:mga06r32_1015622_c1 | 3300050510 | Bacteria | 781 |
| 176 | nmdc:mga06r32_3340_c1 | 3300050510 | Bacteria | 14363 |
| 177 | nmdc:mga06r32_39_c1 | 3300050510 | Bacteria | 54656 |
| 178 | nmdc:mga06r32_471068_c1 | 3300050510 | Bacteria | 1234 |
| 179 | nmdc:mga06r32_929608_c1 | 3300050510 | Bacteria | 825 |
| 180 | nmdc:mga0a205_845646_c1 | 3300050515 | Bacteria | 762 |
| 181 | Ga0495619_0441151 | 3300053085 | Bacteria | 898 |
| 182 | Ga0500644_0028737 | 3300053088 | Bacteria | 1742 |
| 183 | Ga0500646_0027782 | 3300053090 | Bacteria | 1541 |
| 184 | Ga0501082_0610952 | 3300060353 | Bacteria | 954 |
| 185 | Ga0530510_0018802 | 3300061734 | Bacteria | 4900 |
| 186 | 2501944774 | 2501939600 | Bacteria | 6907073 |
| 187 | 2643853380 | 2643221567 | Bacteria | 4163945 |
| 188 | 2644137340 | 2643221624 | Bacteria | 4384879 |
| 189 | 2848551882 | 2848551377 | Bacteria | 3720646 |
| 190 | 2856861168 | 2856858025 | Bacteria | 7255264 |
| 191 | 2857743753 | 2857740372 | Bacteria | 4782044 |
| 192 | 2858903877 | 2858902515 | Bacteria | 7086037 |
| 193 | 2867324484 | 2867319477 | Bacteria | 7069771 |
| 194 | 2868091114 | 2868088558 | Bacteria | 7609351 |
| 195 | 2887481919 | 2887478801 | Bacteria | 8972725 |
| 196 | 2904499655 | 2904497146 | Bacteria | 4731781 |
| 197 | 2904780311 | 2904776348 | Bacteria | 4658726 |
| 198 | 2910814757 | 2910809715 | Bacteria | 4982797 |
| 199 | 2919036106 | 2919034639 | Bacteria | 4763403 |
| 200 | 2919447144 | 2919446982 | Bacteria | 3994487 |
| 201 | 2919538679 | 2919538618 | Bacteria | 4677069 |
| 202 | 2932431054 | 2932426870 | Bacteria | 4547726 |
| 203 | 2933419135 | 2933418574 | Bacteria | 4476724 |
| 204 | 2939678501 | 2939674588 | Bacteria | 4844420 |
| 205 | 2996226629 | 2996221748 | Bacteria | 6799777 |
| 206 | 649811927 | 649633069 | Bacteria | 6962533 |
| 207 | Ga0307415_100177281 | |||
| 208 | LJQas_1003029 | |||
| 209 | LJQas_1003749 | |||
| 210 | JGI24740J21852_10091637 | |||
| 211 | JGI25152J39213_1000655 | |||
| 212 | JGI25406J46586_10008268 | |||
| 213 | JGI25406J46586_10025536 | |||
| 214 | JGI25406J46586_10049297 | |||
| 215 | Ga0006562J51391_1005672 | |||
| 216 | Ga0070683_100245713 | |||
| 217 | Ga0070668_100250929 | |||
| 218 | Ga0070694_100416253 | |||
| 219 | Ga0070678_100475018 | |||
| 220 | Ga0070679_100036055 | |||
| 221 | Ga0070679_100406129 | |||
| 222 | Ga0070665_100004987 | |||
| 223 | Ga0070665_100067641 | |||
| 224 | Ga0070664_100371912 | |||
| 225 | Ga0070664_100746021 | |||
| 226 | Ga0068857_100032828 | |||
| 227 | Ga0068857_100451972 | |||
| 228 | Ga0068857_100720113 | |||
| 229 | Ga0068852_101006388 | |||
| 230 | Ga0068861_100410760 | |||
| 231 | Ga0068863_100011022 | |||
| 232 | Ga0068858_100059095 | |||
| 233 | Ga0068860_100096523 | |||
| 234 | Ga0081540_1020008 | |||
| 235 | Ga0081539_10000357 | |||
| 236 | Ga0081539_10000465 | |||
| 237 | Ga0081539_10000536 | |||
| 238 | Ga0075428_100000251 | |||
| 239 | Ga0075428_100387676 | |||
| 240 | Ga0075430_100000441 | |||
| 241 | Ga0075430_100000968 | |||
| 242 | Ga0075430_100440834 | |||
| 243 | Ga0075430_100467466 | |||
| 244 | Ga0075431_100000579 | |||
| 245 | Ga0075431_100035822 | |||
| 246 | Ga0075431_101019446 | |||
| 247 | Ga0075434_100958582 | |||
| 248 | Ga0075429_100000942 | |||
| 249 | Ga0075429_100022094 | |||
| 250 | Ga0075429_100243556 | |||
| 251 | Ga0075429_100288455 | |||
| 252 | Ga0075429_100314195 | |||
| 253 | Ga0105244_10002059 | |||
| 254 | Ga0105247_10248114 | |||
| 255 | Ga0105247_10305267 | |||
| 256 | Ga0114129_10000024 | |||
| 257 | Ga0114129_10009311 | |||
| 258 | Ga0114129_10015115 | |||
| 259 | Ga0114129_10205131 | |||
| 260 | Ga0114129_10313242 | |||
| 261 | Ga0114129_10635372 | |||
| 262 | Ga0114129_10730591 | |||
| 263 | Ga0105249_11259415 | |||
| 264 | Ga0105246_10074431 | |||
| 265 | Ga0163162_10306976 | |||
| 266 | Ga0157372_10362448 | |||
| 267 | Ga0157375_10265788 | |||
| 268 | Ga0163163_10038260 | |||
| 269 | Ga0163163_10364770 | |||
| 270 | Ga0206356_10244172 | |||
| 271 | Ga0206353_10168740 | |||
| 272 | Ga0209051_1015037 | |||
| 273 | Ga0207652_10271284 | |||
| 274 | Ga0207650_10136731 | |||
| 275 | Ga0207661_10205880 | |||
| 276 | Ga0207679_10439022 | |||
| 277 | Ga0207668_10015484 | |||
| 278 | Ga0207658_10373429 | |||
| 279 | Ga0207677_10485558 | |||
| 280 | Ga0207703_10227814 | |||
| 281 | Ga0207702_10495208 | |||
| 282 | Ga0207641_10879884 | |||
| 283 | Ga0207674_10040769 | |||
| 284 | Ga0207698_10503990 | |||
| 285 | Ga0268266_10057428 | |||
| 286 | Ga0268266_10439291 | |||
| 287 | Ga0268264_10096103 | |||
| 288 | Ga0307515_10016444 | |||
| 289 | Ga0307515_10120011 | |||
| 290 | Ga0307512_10133320 | |||
| 291 | Ga0307513_10017253 | |||
| 292 | Ga0307513_10623078 | |||
| 293 | Ga0307405_10096569 | |||
| 294 | Ga0307410_10108310 | |||
| 295 | Ga0307410_10123450 | |||
| 296 | Ga0307406_10111269 | |||
| 297 | Ga0307406_10349442 | |||
| 298 | Ga0307407_10576235 | |||
| 299 | Ga0307412_10004200 | |||
| 300 | Ga0307409_100008362 | |||
| 301 | Ga0307416_100527552 | |||
| 302 | Ga0307415_100049308 | |||
| 303 | Ga0307415_100302244 | |||
| 304 | Ga0373950_0019380 | |||
| 305 | Ga0373941_0182691 | |||
| 306 | Ga0373942_0000094 | |||
| 307 | Ga0373942_0021564 | |||
| 308 | Ga0373962_0000690 | |||
| 309 | Ga0373962_0169265 | |||
| 310 | Ga0395900_0114023 | |||
| 311 | Ga0395898_0022855 | |||
| 312 | Ga0395905_0780560 | |||
| 313 | Ga0395901_0076674 | |||
| 314 | Ga0395901_0764068 | |||
| 315 | Ga0439436_0049060 | |||
| 316 | Ga0439438_002552 | |||
| 317 | Ga0439439_0000073 | |||
| 318 | Ga0439447_048566 | |||
| 319 | Ga0439461_0001111 | |||
| 320 | Ga0439466_0003826 | |||
| 321 | Ga0451802_1470320 | |||
| 322 | Ga0451833_0655731 | |||
| 323 | Ga0451853_0940374 | |||
| 324 | Ga0439431_0037497 | |||
| 325 | Ga0439433_0000428 | |||
| 326 | Ga0439442_002190 | |||
| 327 | Ga0439432_037813 | |||
| 328 | Ga0439449_0001670 | |||
| 329 | Ga0439449_0048355 | |||
| 330 | Ga0439449_0137522 | |||
| 331 | Ga0439452_022808 | |||
| 332 | Ga0439457_014183 | |||
| 333 | Ga0439462_0008716 | |||
| 334 | Ga0450911_004163 | |||
| 335 | Ga0450919_000773 | |||
| 336 | Ga0450920_033002 | |||
| 337 | Ga0450922_008203 | |||
| 338 | Ga0450906_027977 | |||
| 339 | Ga0450910_030833 | |||
| 340 | Ga0439446_0006556 | |||
| 341 | Ga0450908_006812 | |||
| 342 | Ga0450909_000315 | |||
| 343 | Ga0439434_0000627 | |||
| 344 | Ga0450918_001127 | |||
| 345 | Ga0466957_0229945 | |||
| 346 | Ga0466967_0171086 | |||
| 347 | Ga0495629_0354310 | |||
| 348 | Ga0495651_0276547 | |||
| 349 | Ga0495594_0010399 | |||
| 350 | Ga0495594_0111300 | |||
| 351 | Ga0495632_0024534 | |||
| 352 | Ga0495668_0000103 | |||
| 353 | Ga0495625_0000643 | |||
| 354 | Ga0495658_0010943 | |||
| 355 | Ga0495676_0060748 | |||
| 356 | Ga0495626_0000197 | |||
| 357 | Ga0496104_0048474 | |||
| 358 | Ga0496104_0355197 | |||
| 359 | Ga0496108_0526951 | |||
| 360 | Ga0496108_0583225 | |||
| 361 | Ga0496109_0165083 | |||
| 362 | Ga0496112_0035307 | |||
| 363 | Ga0496112_0069440 | |||
| 364 | Ga0496112_1089124 | |||
| 365 | Ga0496113_0306989 | |||
| 366 | Ga0501048_0176826 | |||
| 367 | nmdc:mga05p37_1365024_c1 | |||
| 368 | nmdc:mga05p37_151090_c1 | |||
| 369 | nmdc:mga05p37_189_c1 | |||
| 370 | nmdc:mga09592_115533_c1 | |||
| 371 | nmdc:mga09592_123892_c1 | |||
| 372 | nmdc:mga09592_164532_c1 | |||
| 373 | nmdc:mga09592_2_c1 | |||
| 374 | nmdc:mga09592_493652_c1 | |||
| 375 | nmdc:mga09592_501846_c1 | |||
| 376 | nmdc:mga0qj67_10_c2 | |||
| 377 | nmdc:mga0qj67_278839_c1 | |||
| 378 | nmdc:mga0qj67_279_c1 | |||
| 379 | nmdc:mga0qj67_335208_c1 | |||
| 380 | nmdc:mga0qj67_507030_c1 | |||
| 381 | nmdc:mga06r32_1015622_c1 | |||
| 382 | nmdc:mga06r32_3340_c1 | |||
| 383 | nmdc:mga06r32_39_c1 | |||
| 384 | nmdc:mga06r32_471068_c1 | |||
| 385 | nmdc:mga06r32_929608_c1 | |||
| 386 | nmdc:mga0a205_845646_c1 | |||
| 387 | Ga0495619_0441151 | |||
| 388 | Ga0500644_0028737 | |||
| 389 | Ga0500646_0027782 | |||
| 390 | Ga0501082_0610952 | |||
| 391 | Ga0530510_0018802 | |||
| 392 | 2501944774 | |||
| 393 | 2643853380 | |||
| 394 | 2644137340 | |||
| 395 | 2848551882 | |||
| 396 | 2856861168 | |||
| 397 | 2857743753 | |||
| 398 | 2858903877 | |||
| 399 | 2867324484 | |||
| 400 | 2868091114 | |||
| 401 | 2887481919 | |||
| 402 | 2904499655 | |||
| 403 | 2904780311 | |||
| 404 | 2910814757 | |||
| 405 | 2919036106 | |||
| 406 | 2919447144 | |||
| 407 | 2919538679 | |||
| 408 | 2932431054 | |||
| 409 | 2933419135 | |||
| 410 | 2939678501 | |||
| 411 | 2996226629 | |||
| 412 | 649811927 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7drk-assembly1.cif.gz_B | crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol | 0.8342 | 17 | 192 |
| 7drk-assembly1.cif.gz_B | crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol | 0.7926 | 17 | 192 |
| 8ero-assembly1.cif.gz_A | structure of xenopus cholinephosphotransferase1 in complex with cdp | 0.6467 | 15 | 193 |
| 6wm5-assembly1.cif.gz_A | structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii | 0.6375 | 9 | 192 |
| 6wmv-assembly1.cif.gz_A | structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding | 0.634 | 9 | 194 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WPG3_21_202_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9246 | 11 | 196 | 1.20.120.1760 |
| af_P9WPG3_21_202_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9051 | 11 | 196 | 1.20.120.1760 |
| af_P0ABF8_3_179_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9028 | 16 | 195 | 1.20.120.1760 |
| af_P0ABF8_3_179_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8881 | 16 | 195 | 1.20.120.1760 |
| af_P9WPG5_6_192_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8762 | 14 | 198 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7RB60-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9856 | 24 | 206 |
GO:0005886
GO:0008444 GO:0046474 |
| AF-A0A542EFI0-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9745 | 15 | 202 |
GO:0005886
GO:0008444 GO:0046474 |
| AF-A0A372JBJ6-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9709 | 15 | 202 |
GO:0005886
GO:0008444 GO:0046474 |
| AF-A0A3Q9UQ29-F1-model_v4 | deleted | 0.9703 | 15 | 206 |
|
| AF-A0A2R7RB60-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9699 | 24 | 206 |
GO:0005886
GO:0008444 GO:0046474 |