F315295

General Info

Members Datasets Scaffolds Average Seq Length
206 149 205 99

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10635610|Ga0307513_106356101
Length 117
Sequence MHQYIINASIQIVPIVLDKHPYEWVDEAIAIIQNSGIKYEVTPFATILEGTYDQVMKVIHEVNEFLYEKGCAEWITNCQIQIRSAGDITGSEKTAKFSXFRIIQKAFRDEKSQFFII

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
90 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
91 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
92 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
93 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
94 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
95 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
96 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
99 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
100 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
101 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
102 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
113 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
114 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
121 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
122 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
123 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
124 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
125 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
126 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
127 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
128 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
129 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
130 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
131 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
132 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
133 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
134 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
135 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
136 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
137 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
138 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
139 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
143 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
144 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
145 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
146 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
149 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.74
Nodule 0
Rhizoplane 3.4
Rhizosphere 79.13
Stem 0
Stem Tuber 0
Unclassified 8.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10042987 3300003322 Bacteria 1166
2 rootH1_10306535 3300003323 Bacteria 1609
3 Ga0065714_10424170 3300005288 Bacteria 555
4 Ga0065712_10087652 3300005290 Bacteria 2564
5 Ga0070676_10386349 3300005328 Bacteria 970
6 Ga0070690_101190373 3300005330 Bacteria 607
7 Ga0070670_100236010 3300005331 Bacteria 1592
8 Ga0068869_100999518 3300005334 Bacteria 728
9 Ga0070689_101114791 3300005340 Bacteria 706
10 Ga0070669_100298985 3300005353 Unclassified 1294
11 Ga0070675_100052099 3300005354 Bacteria 3364
12 Ga0070674_100189208 3300005356 Bacteria 1582
13 Ga0070673_100694023 3300005364 Unclassified 934
14 Ga0070688_101084957 3300005365 Bacteria 639
15 Ga0070667_100022502 3300005367 Bacteria 5227
16 Ga0070667_100455860 3300005367 Bacteria 1169
17 Ga0070667_101178061 3300005367 Bacteria 717
18 Ga0068867_100449049 3300005459 Bacteria 1098
19 Ga0070685_10494543 3300005466 Bacteria 864
20 Ga0070707_100471766 3300005468 Bacteria 1216
21 Ga0070698_100189102 3300005471 Bacteria 1997
22 Ga0068853_101505871 3300005539 Unclassified 651
23 Ga0068853_102345374 3300005539 Bacteria 517
24 Ga0070672_100220941 3300005543 Bacteria 1589
25 Ga0070672_100888659 3300005543 Bacteria 787
26 Ga0070693_101569303 3300005547 Bacteria 516
27 Ga0070665_101760431 3300005548 Unclassified 626
28 Ga0070664_100449851 3300005564 Bacteria 1182
29 Ga0068857_100223798 3300005577 Unclassified 1719
30 Ga0068857_100415133 3300005577 Bacteria 1254
31 Ga0068854_100246613 3300005578 Unclassified 1424
32 Ga0068854_101660422 3300005578 Unclassified 583
33 Ga0068854_101956360 3300005578 Bacteria 540
34 Ga0068856_100010959 3300005614 Bacteria 8800
35 Ga0068852_100424271 3300005616 Bacteria 1312
36 Ga0068859_100019949 3300005617 Bacteria 6730
37 Ga0068859_100506113 3300005617 Unclassified 1303
38 Ga0068860_100010759 3300005843 Bacteria 9031
39 Ga0068860_100120231 3300005843 Unclassified 2515
40 Ga0068860_101626221 3300005843 Unclassified 668
41 Ga0070716_100246028 3300006173 Bacteria 1215
42 Ga0075366_10146546 3300006195 Unclassified 1429
43 Ga0075366_10588489 3300006195 Bacteria 690
44 Ga0097621_100032215 3300006237 Unclassified 4166
45 Ga0097621_100628111 3300006237 Bacteria 984
46 Ga0097621_101212263 3300006237 Bacteria 711
47 Ga0075370_10832194 3300006353 Unclassified 563
48 Ga0068871_100008885 3300006358 Bacteria 7246
49 Ga0068865_101385647 3300006881 Bacteria 627
50 Ga0068865_101871596 3300006881 Bacteria 543
51 Ga0097620_100019949 3300006931 Bacteria 6730
52 Ga0097620_100506139 3300006931 Unclassified 1303
53 Ga0105240_10120187 3300009093 Bacteria 3164
54 Ga0111539_10384880 3300009094 Unclassified 1633
55 Ga0105241_10025036 3300009174 Bacteria 4434
56 Ga0105242_10597967 3300009176 Bacteria 1065
57 Ga0105239_10006841 3300010375 Bacteria 13158
58 Ga0105239_10126269 3300010375 Bacteria 2843
59 Ga0157370_10523158 3300013104 Bacteria 1088
60 Ga0157374_10069785 3300013296 Unclassified 3310
61 Ga0157374_10089190 3300013296 Bacteria 2938
62 Ga0157378_10015409 3300013297 Bacteria 6695
63 Ga0163162_10000524 3300013306 Bacteria 35554
64 Ga0163162_10078338 3300013306 Bacteria 3370
65 Ga0163162_10297845 3300013306 Bacteria 1745
66 Ga0163162_12121843 3300013306 Bacteria 645
67 Ga0157372_10210163 3300013307 Bacteria 2255
68 Ga0157372_11000343 3300013307 Unclassified 968
69 Ga0157372_12612034 3300013307 Unclassified 580
70 Ga0157375_10818515 3300013308 Bacteria 1079
71 Ga0157375_11593689 3300013308 Bacteria 772
72 Ga0157380_10000556 3300014326 Bacteria 22954
73 Ga0157376_12858231 3300014969 Unclassified 523
74 Ga0163161_10685921 3300017792 Bacteria 852
75 Ga0213876_10245761 3300021384 Bacteria 951
76 Ga0207654_10107696 3300025911 Bacteria 1728
77 Ga0207695_10180595 3300025913 Bacteria 2031
78 Ga0207671_10254563 3300025914 Bacteria 1381
79 Ga0207646_11087204 3300025922 Bacteria 704
80 Ga0207681_10155979 3300025923 Unclassified 1716
81 Ga0207650_10268679 3300025925 Bacteria 1385
82 Ga0207659_10010206 3300025926 Bacteria 5889
83 Ga0207706_11013202 3300025933 Bacteria 697
84 Ga0207669_11792766 3300025937 Bacteria 524
85 Ga0207704_10504246 3300025938 Bacteria 976
86 Ga0207704_10599186 3300025938 Unclassified 902
87 Ga0207704_11400600 3300025938 Bacteria 599
88 Ga0207691_10127113 3300025940 Bacteria 2254
89 Ga0207691_10358776 3300025940 Bacteria 1246
90 Ga0207689_10131706 3300025942 Bacteria 2058
91 Ga0207689_10273361 3300025942 Bacteria 1399
92 Ga0207689_10482050 3300025942 Bacteria 1038
93 Ga0207661_10306822 3300025944 Unclassified 1424
94 Ga0207667_10375543 3300025949 Unclassified 1449
95 Ga0207658_10067413 3300025986 Bacteria 2695
96 Ga0207658_10592836 3300025986 Bacteria 995
97 Ga0207639_10199286 3300026041 Bacteria 1716
98 Ga0207702_10009327 3300026078 Bacteria 8244
99 Ga0207648_10183751 3300026089 Bacteria 1851
100 Ga0207676_10398165 3300026095 Unclassified 1286
101 Ga0207674_10067907 3300026116 Unclassified 3588
102 Ga0207698_10263419 3300026142 Bacteria 1585
103 Ga0207698_10479774 3300026142 Unclassified 1206
104 Ga0207698_11567532 3300026142 Bacteria 674
105 Ga0268266_11586418 3300028379 Unclassified 630
106 Ga0268265_11426156 3300028380 Unclassified 695
107 Ga0268264_10007560 3300028381 Bacteria 9064
108 Ga0268264_10222536 3300028381 Bacteria 1738
109 Ga0265336_10121863 3300028666 Unclassified 777
110 Ga0307515_10000072 3300028794 Bacteria 237798
111 Ga0265327_10043250 3300031251 Bacteria 2412
112 Ga0307513_10247040 3300031456 Bacteria 1584
113 Ga0307513_10400602 3300031456 Bacteria 1107
114 Ga0307513_10635610 3300031456 Bacteria 775
115 Ga0307513_10895247 3300031456 Bacteria 595
116 Ga0307509_10221547 3300031507 Bacteria 1704
117 Ga0307509_10355380 3300031507 Bacteria 1187
118 Ga0307414_10251683 3300032004 Bacteria 1469
119 Ga0307414_11716090 3300032004 Bacteria 586
120 Ga0307415_100857326 3300032126 Bacteria 834
121 Ga0307507_10333430 3300033179 Bacteria 904
122 Ga0373925_0315446 3300037068 Bacteria 1264
123 Ga0395900_0847342 3300037418 Unclassified 840
124 Ga0436365_0646455 3300039437 Bacteria 14028
125 Ga0436365_1369837 3300039437 Unclassified 3619
126 Ga0451787_000584 3300041441 Bacteria 519
127 Ga0451787_146895 3300041441 Unclassified 661
128 Ga0451791_0495241 3300041451 Bacteria 1219
129 Ga0451797_1411477 3300041453 Bacteria 515
130 Ga0451798_0035837 3300041458 Bacteria 642
131 Ga0451802_0766957 3300041460 Bacteria 794
132 Ga0451807_0086764 3300041486 Bacteria 834
133 Ga0451841_0856909 3300041498 Bacteria 535
134 Ga0451849_0246406 3300041505 Bacteria 662
135 Ga0451853_3637801 3300041512 Bacteria 578
136 Ga0451853_3763572 3300041512 Unclassified 622
137 Ga0439431_0018215 3300041997 Bacteria 1660
138 Ga0439448_0369896 3300042005 Unclassified 512
139 Ga0439449_0006826 3300042007 Unclassified 4352
140 Ga0439449_0070541 3300042007 Bacteria 1288
141 Ga0439455_0107928 3300042012 Bacteria 773
142 Ga0439457_000560 3300042014 Bacteria 10851
143 Ga0466969_0000912 3300044656 Bacteria 15928
144 Ga0466972_0000013 3300044658 Bacteria 229345
145 Ga0466972_0029736 3300044658 Bacteria 2690
146 Ga0466966_0000045 3300044684 Bacteria 92504
147 Ga0466961_0310851 3300044693 Bacteria 962
148 Ga0466961_0488122 3300044693 Bacteria 744
149 Ga0466964_0243414 3300044706 Bacteria 883
150 Ga0466968_0031026 3300044735 Bacteria 2216
151 Ga0466968_0559402 3300044735 Bacteria 574
152 Ga0466959_0000023 3300045049 Bacteria 124545
153 Ga0466967_1210051 3300045976 Bacteria 753
154 Ga0495672_0147471 3300047320 Bacteria 1223
155 Ga0501292_032585 3300049515 Bacteria 880
156 Ga0501298_026390 3300049521 Bacteria 1117
157 Ga0501300_005796 3300049523 Bacteria 1818
158 Ga0501033_0452130 3300049570 Bacteria 892
159 Ga0501034_0106122 3300049571 Bacteria 2802
160 Ga0501047_0072360 3300049581 Bacteria 3318
161 Ga0501047_0290481 3300049581 Bacteria 1479
162 Ga0501048_0226785 3300049582 Bacteria 1326
163 Ga0501073_0626113 3300049589 Unclassified 743
164 Ga0501198_000379 3300049649 Bacteria 5574
165 Ga0501201_000625 3300049651 Bacteria 3289
166 Ga0501202_000127 3300049652 Bacteria 8866
167 Ga0501207_000034 3300049654 Bacteria 9772
168 Ga0501217_000184 3300049661 Bacteria 9229
169 Ga0501217_006840 3300049661 Bacteria 2433
170 Ga0501222_072420 3300049662 Unclassified 538
171 Ga0501233_004068 3300049668 Unclassified 2660
172 Ga0501243_000278 3300049675 Bacteria 6583
173 Ga0501249_073979 3300049679 Bacteria 797
174 Ga0501251_002541 3300049681 Bacteria 1775
175 Ga0501256_036295 3300049685 Bacteria 572
176 Ga0501257_051138 3300049686 Bacteria 1031
177 Ga0501257_137830 3300049686 Unclassified 664
178 Ga0501259_122990 3300049688 Bacteria 619
179 Ga0501260_014241 3300049689 Bacteria 823
180 Ga0501225_0000367 3300049705 Bacteria 14177
181 Ga0501225_0000846 3300049705 Bacteria 9521
182 Ga0501225_0029495 3300049705 Bacteria 1507
183 Ga0501225_0260934 3300049705 Bacteria 573
184 Ga0501234_010703 3300049707 Bacteria 1430
185 Ga0501245_001333 3300049708 Bacteria 3173
186 Ga0501268_103247 3300049765 Unclassified 613
187 Ga0501279_006045 3300049775 Bacteria 1596
188 Ga0501281_03438 3300049777 Unclassified 1134
189 Ga0501035_0128288 3300049822 Bacteria 2213
190 Ga0501044_0003348 3300049823 Bacteria 18071
191 nmdc:mga0k408_308015_c1 3300050493 Bacteria 945
192 nmdc:mga0k408_443507_c1 3300050493 Bacteria 771
193 nmdc:mga0k408_706132_c1 3300050493 Bacteria 591
194 nmdc:mga0k408_830524_c1 3300050493 Bacteria 538
195 Ga0500578_0001147 3300053086 Bacteria 28253
196 Ga0500578_0149450 3300053086 Bacteria 1456
197 Ga0500583_0000108 3300053092 Bacteria 41760
198 Ga0500583_0054047 3300053092 Bacteria 1874
199 Ga0500642_0283269 3300053130 Bacteria 752
200 Ga0500642_0300115 3300053130 Unclassified 725
201 Ga0500652_147799 3300053131 Bacteria 976
202 Ga0500622_0066889 3300053156 Unclassified 1823
203 Ga0500622_0083846 3300053156 Bacteria 1592
204 Ga0500636_0164335 3300053177 Bacteria 1207
205 Ga0500587_014473 3300053739 Bacteria 1000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2738541278 2738726367 94
2 3300013306 Ga0163162_12121843 Ga0163162_121218432 97
3 3300025942 Ga0207689_10482050 Ga0207689_104820502 97
4 3300003322 rootL2_10042987 rootL2_100429873 98
5 3300003323 rootH1_10306535 rootH1_103065353 98
6 3300005288 Ga0065714_10424170 Ga0065714_104241702 98
7 3300005290 Ga0065712_10087652 Ga0065712_100876523 98
8 3300005328 Ga0070676_10386349 Ga0070676_103863492 98
9 3300005330 Ga0070690_101190373 Ga0070690_1011903732 98
10 3300005331 Ga0070670_100236010 Ga0070670_1002360102 98
11 3300005334 Ga0068869_100999518 Ga0068869_1009995182 98
12 3300005340 Ga0070689_101114791 Ga0070689_1011147911 98
13 3300005353 Ga0070669_100298985 Ga0070669_1002989852 98
14 3300005354 Ga0070675_100052099 Ga0070675_1000520993 98
15 3300005356 Ga0070674_100189208 Ga0070674_1001892082 98
16 3300005364 Ga0070673_100694023 Ga0070673_1006940232 98
17 3300005365 Ga0070688_101084957 Ga0070688_1010849571 98
18 3300005367 Ga0070667_100022502 Ga0070667_1000225024 98
19 3300005367 Ga0070667_100455860 Ga0070667_1004558601 98
20 3300005367 Ga0070667_101178061 Ga0070667_1011780612 98
21 3300005459 Ga0068867_100449049 Ga0068867_1004490492 98
22 3300005466 Ga0070685_10494543 Ga0070685_104945432 98
23 3300005468 Ga0070707_100471766 Ga0070707_1004717662 98
24 3300005471 Ga0070698_100189102 Ga0070698_1001891023 98
25 3300005539 Ga0068853_101505871 Ga0068853_1015058712 98
26 3300005539 Ga0068853_102345374 Ga0068853_1023453741 98
27 3300005543 Ga0070672_100220941 Ga0070672_1002209412 98
28 3300005543 Ga0070672_100888659 Ga0070672_1008886591 98
29 3300005547 Ga0070693_101569303 Ga0070693_1015693031 98
30 3300005548 Ga0070665_101760431 Ga0070665_1017604311 98
31 3300005564 Ga0070664_100449851 Ga0070664_1004498512 98
32 3300005577 Ga0068857_100223798 Ga0068857_1002237982 98
33 3300005577 Ga0068857_100415133 Ga0068857_1004151332 98
34 3300005578 Ga0068854_100246613 Ga0068854_1002466133 98
35 3300005578 Ga0068854_101660422 Ga0068854_1016604222 98
36 3300005578 Ga0068854_101956360 Ga0068854_1019563602 98
37 3300005614 Ga0068856_100010959 Ga0068856_1000109592 98
38 3300005616 Ga0068852_100424271 Ga0068852_1004242712 98
39 3300005617 Ga0068859_100019949 Ga0068859_1000199493 98
40 3300005617 Ga0068859_100506113 Ga0068859_1005061132 98
41 3300005843 Ga0068860_100010759 Ga0068860_1000107594 98
42 3300005843 Ga0068860_100120231 Ga0068860_1001202313 98
43 3300005843 Ga0068860_101626221 Ga0068860_1016262212 98
44 3300006173 Ga0070716_100246028 Ga0070716_1002460283 98
45 3300006195 Ga0075366_10146546 Ga0075366_101465462 98
46 3300006195 Ga0075366_10588489 Ga0075366_105884891 98
47 3300006237 Ga0097621_100032215 Ga0097621_1000322156 98
48 3300006237 Ga0097621_100628111 Ga0097621_1006281111 98
49 3300006237 Ga0097621_101212263 Ga0097621_1012122632 98
50 3300006353 Ga0075370_10832194 Ga0075370_108321942 98
51 3300006358 Ga0068871_100008885 Ga0068871_1000088854 98
52 3300006881 Ga0068865_101385647 Ga0068865_1013856472 98
53 3300006881 Ga0068865_101871596 Ga0068865_1018715962 98
54 3300006931 Ga0097620_100019949 Ga0097620_1000199493 98
55 3300006931 Ga0097620_100506139 Ga0097620_1005061392 98
56 3300009093 Ga0105240_10120187 Ga0105240_101201871 98
57 3300009094 Ga0111539_10384880 Ga0111539_103848802 98
58 3300009174 Ga0105241_10025036 Ga0105241_100250364 98
59 3300009176 Ga0105242_10597967 Ga0105242_105979671 98
60 3300010375 Ga0105239_10006841 Ga0105239_100068419 98
61 3300010375 Ga0105239_10126269 Ga0105239_101262693 98
62 3300013104 Ga0157370_10523158 Ga0157370_105231581 98
63 3300013296 Ga0157374_10069785 Ga0157374_100697854 98
64 3300013296 Ga0157374_10089190 Ga0157374_100891903 98
65 3300013297 Ga0157378_10015409 Ga0157378_100154093 98
66 3300013306 Ga0163162_10000524 Ga0163162_100005246 98
67 3300013306 Ga0163162_10078338 Ga0163162_100783383 98
68 3300013306 Ga0163162_10297845 Ga0163162_102978452 98
69 3300013307 Ga0157372_10210163 Ga0157372_102101632 98
70 3300013307 Ga0157372_11000343 Ga0157372_110003432 98
71 3300013307 Ga0157372_12612034 Ga0157372_126120341 98
72 3300013308 Ga0157375_10818515 Ga0157375_108185152 98
73 3300013308 Ga0157375_11593689 Ga0157375_115936892 98
74 3300014326 Ga0157380_10000556 Ga0157380_1000055619 98
75 3300014969 Ga0157376_12858231 Ga0157376_128582312 98
76 3300017792 Ga0163161_10685921 Ga0163161_106859212 98
77 3300021384 Ga0213876_10245761 Ga0213876_102457611 98
78 3300025911 Ga0207654_10107696 Ga0207654_101076963 98
79 3300025913 Ga0207695_10180595 Ga0207695_101805953 98
80 3300025914 Ga0207671_10254563 Ga0207671_102545632 98
81 3300025922 Ga0207646_11087204 Ga0207646_110872042 98
82 3300025923 Ga0207681_10155979 Ga0207681_101559792 98
83 3300025925 Ga0207650_10268679 Ga0207650_102686792 98
84 3300025926 Ga0207659_10010206 Ga0207659_100102063 98
85 3300025933 Ga0207706_11013202 Ga0207706_110132021 98
86 3300025937 Ga0207669_11792766 Ga0207669_117927661 98
87 3300025938 Ga0207704_10504246 Ga0207704_105042462 98
88 3300025938 Ga0207704_10599186 Ga0207704_105991861 98
89 3300025938 Ga0207704_11400600 Ga0207704_114006001 98
90 3300025940 Ga0207691_10127113 Ga0207691_101271133 98
91 3300025940 Ga0207691_10358776 Ga0207691_103587761 98
92 3300025942 Ga0207689_10131706 Ga0207689_101317062 98
93 3300025942 Ga0207689_10273361 Ga0207689_102733613 98
94 3300025944 Ga0207661_10306822 Ga0207661_103068222 98
95 3300025949 Ga0207667_10375543 Ga0207667_103755432 98
96 3300025986 Ga0207658_10067413 Ga0207658_100674133 98
97 3300025986 Ga0207658_10592836 Ga0207658_105928361 98
98 3300026041 Ga0207639_10199286 Ga0207639_101992861 98
99 3300026078 Ga0207702_10009327 Ga0207702_100093277 98
100 3300026089 Ga0207648_10183751 Ga0207648_101837513 98
101 3300026095 Ga0207676_10398165 Ga0207676_103981652 98
102 3300026116 Ga0207674_10067907 Ga0207674_100679073 98
103 3300026142 Ga0207698_10263419 Ga0207698_102634192 98
104 3300026142 Ga0207698_10479774 Ga0207698_104797742 98
105 3300026142 Ga0207698_11567532 Ga0207698_115675322 98
106 3300028379 Ga0268266_11586418 Ga0268266_115864182 98
107 3300028380 Ga0268265_11426156 Ga0268265_114261562 98
108 3300028381 Ga0268264_10007560 Ga0268264_100075608 98
109 3300028381 Ga0268264_10222536 Ga0268264_102225363 98
110 3300028666 Ga0265336_10121863 Ga0265336_101218632 98
111 3300028794 Ga0307515_10000072 Ga0307515_1000007273 98
112 3300031251 Ga0265327_10043250 Ga0265327_100432503 98
113 3300031456 Ga0307513_10247040 Ga0307513_102470402 98
114 3300031456 Ga0307513_10400602 Ga0307513_104006023 98
115 3300031456 Ga0307513_10635610 Ga0307513_106356101 98
116 3300031456 Ga0307513_10895247 Ga0307513_108952471 98
117 3300031507 Ga0307509_10221547 Ga0307509_102215472 98
118 3300031507 Ga0307509_10355380 Ga0307509_103553802 98
119 3300032004 Ga0307414_10251683 Ga0307414_102516832 98
120 3300032004 Ga0307414_11716090 Ga0307414_117160901 98
121 3300032126 Ga0307415_100857326 Ga0307415_1008573262 98
122 3300033179 Ga0307507_10333430 Ga0307507_103334302 98
123 3300037068 Ga0373925_0315446 Ga0373925_0315446_843_1139 98
124 3300037418 Ga0395900_0847342 Ga0395900_0847342_227_523 98
125 3300039437 Ga0436365_0646455 Ga0436365_0646455_10101_10400 98
126 3300039437 Ga0436365_1369837 Ga0436365_1369837_2153_2449 98
127 3300041441 Ga0451787_000584 Ga0451787_000584_104_400 98
128 3300041441 Ga0451787_146895 Ga0451787_146895_226_522 98
129 3300041451 Ga0451791_0495241 Ga0451791_0495241_315_632 98
130 3300041453 Ga0451797_1411477 Ga0451797_1411477_28_327 98
131 3300041458 Ga0451798_0035837 Ga0451798_0035837_313_609 98
132 3300041460 Ga0451802_0766957 Ga0451802_0766957_10_312 98
133 3300041486 Ga0451807_0086764 Ga0451807_0086764_229_525 98
134 3300041498 Ga0451841_0856909 Ga0451841_0856909_10_306 98
135 3300041505 Ga0451849_0246406 Ga0451849_0246406_353_649 98
136 3300041512 Ga0451853_3637801 Ga0451853_3637801_258_554 98
137 3300041512 Ga0451853_3763572 Ga0451853_3763572_220_516 98
138 3300041997 Ga0439431_0018215 Ga0439431_0018215_53_349 98
139 3300042005 Ga0439448_0369896 Ga0439448_0369896_37_333 98
140 3300042007 Ga0439449_0006826 Ga0439449_0006826_2137_2433 98
141 3300042007 Ga0439449_0070541 Ga0439449_0070541_904_1200 98
142 3300042012 Ga0439455_0107928 Ga0439455_0107928_94_390 98
143 3300042014 Ga0439457_000560 Ga0439457_000560_9958_10254 98
144 3300044656 Ga0466969_0000912 Ga0466969_0000912_13675_13974 98
145 3300044658 Ga0466972_0000013 Ga0466972_0000013_78752_79048 98
146 3300044658 Ga0466972_0029736 Ga0466972_0029736_2230_2541 98
147 3300044684 Ga0466966_0000045 Ga0466966_0000045_81351_81650 98
148 3300044693 Ga0466961_0310851 Ga0466961_0310851_164_460 98
149 3300044693 Ga0466961_0488122 Ga0466961_0488122_129_428 98
150 3300044706 Ga0466964_0243414 Ga0466964_0243414_458_763 98
151 3300044735 Ga0466968_0031026 Ga0466968_0031026_128_433 98
152 3300044735 Ga0466968_0559402 Ga0466968_0559402_103_399 98
153 3300045049 Ga0466959_0000023 Ga0466959_0000023_87534_87833 98
154 3300045976 Ga0466967_1210051 Ga0466967_1210051_396_692 98
155 3300047320 Ga0495672_0147471 Ga0495672_0147471_312_608 98
156 3300049515 Ga0501292_032585 Ga0501292_032585_345_644 98
157 3300049521 Ga0501298_026390 Ga0501298_026390_104_403 98
158 3300049523 Ga0501300_005796 Ga0501300_005796_280_579 98
159 3300049570 Ga0501033_0452130 Ga0501033_0452130_182_490 98
160 3300049571 Ga0501034_0106122 Ga0501034_0106122_569_877 98
161 3300049581 Ga0501047_0072360 Ga0501047_0072360_1013_1321 98
162 3300049581 Ga0501047_0290481 Ga0501047_0290481_618_917 98
163 3300049582 Ga0501048_0226785 Ga0501048_0226785_319_627 98
164 3300049589 Ga0501073_0626113 Ga0501073_0626113_422_730 98
165 3300049649 Ga0501198_000379 Ga0501198_000379_1321_1620 98
166 3300049651 Ga0501201_000625 Ga0501201_000625_1357_1656 98
167 3300049652 Ga0501202_000127 Ga0501202_000127_1942_2241 98
168 3300049654 Ga0501207_000034 Ga0501207_000034_464_763 98
169 3300049661 Ga0501217_000184 Ga0501217_000184_1525_1824 98
170 3300049661 Ga0501217_006840 Ga0501217_006840_1924_2220 98
171 3300049662 Ga0501222_072420 Ga0501222_072420_50_346 98
172 3300049668 Ga0501233_004068 Ga0501233_004068_1425_1724 98
173 3300049675 Ga0501243_000278 Ga0501243_000278_4724_5023 98
174 3300049679 Ga0501249_073979 Ga0501249_073979_406_705 98
175 3300049681 Ga0501251_002541 Ga0501251_002541_1179_1478 98
176 3300049685 Ga0501256_036295 Ga0501256_036295_87_386 98
177 3300049686 Ga0501257_051138 Ga0501257_051138_442_741 98
178 3300049686 Ga0501257_137830 Ga0501257_137830_106_402 98
179 3300049688 Ga0501259_122990 Ga0501259_122990_292_588 98
180 3300049689 Ga0501260_014241 Ga0501260_014241_482_781 98
181 3300049705 Ga0501225_0000367 Ga0501225_0000367_4944_5240 98
182 3300049705 Ga0501225_0000846 Ga0501225_0000846_1454_1753 98
183 3300049705 Ga0501225_0029495 Ga0501225_0029495_777_1073 98
184 3300049705 Ga0501225_0260934 Ga0501225_0260934_257_553 98
185 3300049707 Ga0501234_010703 Ga0501234_010703_393_692 98
186 3300049708 Ga0501245_001333 Ga0501245_001333_1540_1839 98
187 3300049765 Ga0501268_103247 Ga0501268_103247_35_334 98
188 3300049775 Ga0501279_006045 Ga0501279_006045_917_1216 98
189 3300049777 Ga0501281_03438 Ga0501281_03438_101_400 98
190 3300049822 Ga0501035_0128288 Ga0501035_0128288_462_770 98
191 3300049823 Ga0501044_0003348 Ga0501044_0003348_1541_1849 98
192 3300050493 nmdc:mga0k408_308015_c1 nmdc:mga0k408_308015_c1_271_567 98
193 3300050493 nmdc:mga0k408_443507_c1 nmdc:mga0k408_443507_c1_265_561 98
194 3300050493 nmdc:mga0k408_706132_c1 nmdc:mga0k408_706132_c1_106_402 98
195 3300050493 nmdc:mga0k408_830524_c1 nmdc:mga0k408_830524_c1_192_494 98
196 3300053086 Ga0500578_0001147 Ga0500578_0001147_27822_28121 98
197 3300053086 Ga0500578_0149450 Ga0500578_0149450_342_638 98
198 3300053092 Ga0500583_0000108 Ga0500583_0000108_19107_19403 98
199 3300053092 Ga0500583_0054047 Ga0500583_0054047_179_475 98
200 3300053130 Ga0500642_0283269 Ga0500642_0283269_419_721 98
201 3300053130 Ga0500642_0300115 Ga0500642_0300115_72_368 98
202 3300053131 Ga0500652_147799 Ga0500652_147799_516_812 98
203 3300053156 Ga0500622_0066889 Ga0500622_0066889_32_328 98
204 3300053156 Ga0500622_0083846 Ga0500622_0083846_54_350 98
205 3300053177 Ga0500636_0164335 Ga0500636_0164335_649_945 98
206 3300053739 Ga0500587_014473 Ga0500587_014473_621_917 98

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01910

Thiamine_BP

Thiamine-binding protein

8

98

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yqh-assembly1.cif.gz_A structure of domain of unknown function duf77 from bacillus cereus 0.9214 4 98
1vk8-assembly1.cif.gz_D crystal structure of a putative thiamine biosynthesis/salvage protein (tm0486) from thermotoga maritima at 1.80 a resolution 0.9063 5 98
1vk8-assembly1.cif.gz_D crystal structure of a putative thiamine biosynthesis/salvage protein (tm0486) from thermotoga maritima at 1.80 a resolution 0.8882 5 98
1yqh-assembly1.cif.gz_A structure of domain of unknown function duf77 from bacillus cereus 0.8864 4 98
2epi-assembly1.cif.gz_C crystal structure pf hypothetical protein mj1052 from methanocaldococcus jannascii (form 2) 0.8854 1 97
ID Description Score Start End Superfamily
1yqhB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9092 6 98 3.30.70.930
af_Q2FZ03_3_97_3.30.70.930 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9006 6 98 3.30.70.930
af_Q2FY28_1_104_3.30.70.930 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8959 6 97 3.30.70.930
2ekyH00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8859 1 97 3.30.70.930
2iboA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8853 6 95 3.30.70.930
ID Description Score Start End GO Terms
AF-A0A317GX60-F1-model_v4 Thiamine-binding protein domain-containing protein 0.9766 1 84 GO:0005829
AF-A0A4V2WN77-F1-model_v4 Thiamine-binding protein 0.971 1 98 GO:0005829
AF-A0A847L429-F1-model_v4 Thiamine-binding protein domain-containing protein 0.9685 3 64 GO:0005829
AF-A0A654DVM9-F1-model_v4 Thiamine-binding protein domain-containing protein 0.9531 1 93 GO:0005829
AF-A0A258U8X7-F1-model_v4 Thiamine-binding protein domain-containing protein 0.9506 3 90 GO:0005829

Feature Viewer

pLDDT pTM Quality
91.04 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map