F315289

General Info

Members Datasets Scaffolds Average Seq Length
206 167 177 165

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10012888|Ga0265327_100128883
Length 195
Sequence MGIILSQALFSLAREYMLPYWPSKNFIFTSIMEPMLRISIIAAIARNRVIGINNTLPWHLPEDLKRFRALTMGHHIVMGRKTYESLGRLLPGRTTVIVSRQKNYAVEGAKVAYSLQQAIALSAGDSEVFVIGGAELYKEALELADRLYLTEINPEFEGDAYFPEFERTAWAATESEQHVSADGLNYSYLTLDRRE

Samples

Sample ID Description Type Environment
1 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
4 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
5 2643221570 Acidovorax sp. Root568 Isolate Unclassified
6 2643221596 Acidovorax sp. Root70 Isolate Unclassified
7 2643221609 Acidovorax sp. Root217 Isolate Unclassified
8 2643221611 Acidovorax sp. Root219 Isolate Unclassified
9 2643221638 Duganella sp. Root336D2 Isolate Unclassified
10 2643221652 Acidovorax sp. Root402 Isolate Unclassified
11 2643221717 Acidovorax sp. Root267 Isolate Unclassified
12 2738543012 Acidovorax sp. CF301 Isolate Unclassified
13 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
14 2816332133 Acidovorax radicis 2721A Isolate Unclassified
15 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
16 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
17 2842747753 Variovorax sp. R-72060 Isolate Unclassified
18 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
19 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
20 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
21 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
22 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
23 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
24 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
25 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
26 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
27 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
28 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
29 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
30 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
31 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
32 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
33 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
34 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
35 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
103 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
160 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
161 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
162 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
163 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
164 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.92
Metatranscriptomes 0
Isolates 14.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.65
Nodule 0.49
Rhizoplane 0.97
Rhizosphere 76.21
Stem 0
Stem Tuber 0
Unclassified 10.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1004104 3300002739 Bacteria 2198
2 Ga0055538_1000019 3300003751 Bacteria 282365
3 Ga0055539_1000024 3300003752 Bacteria 282365
4 Ga0055533_1000032 3300003756 Bacteria 282365
5 Ga0055525_1000041 3300003759 Bacteria 282365
6 Ga0055541_1000018 3300003841 Bacteria 282365
7 Ga0070709_10000012 3300005434 Bacteria 163026
8 Ga0070713_100222850 3300005436 Bacteria 1711
9 Ga0070711_100000598 3300005439 Bacteria 18812
10 Ga0070707_101376488 3300005468 Bacteria 672
11 Ga0070695_100288810 3300005545 Bacteria 1208
12 Ga0070704_100841786 3300005549 Bacteria 822
13 Ga0068855_100117467 3300005563 Bacteria 3047
14 Ga0068857_100096326 3300005577 Bacteria 2652
15 Ga0068854_100006936 3300005578 Bacteria 7225
16 Ga0068862_101453601 3300005844 Bacteria 690
17 Ga0070716_100193389 3300006173 Bacteria 1346
18 Ga0070712_100161972 3300006175 Bacteria 1728
19 Ga0075366_10265443 3300006195 Bacteria 1048
20 Ga0075370_10218539 3300006353 Bacteria 1126
21 Ga0075370_10313611 3300006353 Bacteria 934
22 Ga0075433_10034521 3300006852 Bacteria 4345
23 Ga0075434_100227635 3300006871 Bacteria 1884
24 Ga0075436_100001954 3300006914 Bacteria 14208
25 Ga0075436_100120887 3300006914 Bacteria 1832
26 Ga0075435_100120583 3300007076 Bacteria 2188
27 Ga0075435_100637712 3300007076 Bacteria 925
28 Ga0105240_10119300 3300009093 Bacteria 3178
29 Ga0114129_10154409 3300009147 Bacteria 3140
30 Ga0114129_10326429 3300009147 Bacteria 2039
31 Ga0105242_11051467 3300009176 Bacteria 825
32 Ga0105237_10023147 3300009545 Bacteria 6369
33 Ga0105237_10293384 3300009545 Bacteria 1629
34 Ga0105238_10000311 3300009551 Bacteria 53054
35 Ga0157378_10526418 3300013297 Bacteria 1184
36 Ga0163163_10015406 3300014325 Bacteria 7068
37 Ga0182008_10000412 3300014497 Bacteria 33105
38 Ga0182008_10157973 3300014497 Bacteria 1140
39 Ga0182006_1003068 3300015261 Bacteria 8761
40 Ga0182006_1027429 3300015261 Bacteria 2324
41 Ga0182007_10011192 3300015262 Bacteria 3499
42 Ga0182005_1000682 3300015265 Bacteria 15884
43 Ga0163161_10546471 3300017792 Bacteria 949
44 Ga0213872_10033497 3300021361 Bacteria 2354
45 Ga0213872_10039786 3300021361 Bacteria 2145
46 Ga0213872_10040716 3300021361 Bacteria 2121
47 Ga0209784_100009 3300025224 Bacteria 688031
48 Ga0209566_100007 3300025225 Bacteria 688031
49 Ga0209674_100018 3300025226 Bacteria 688031
50 Ga0209563_100020 3300025230 Bacteria 688031
51 Ga0209677_100010 3300025253 Bacteria 688031
52 Ga0209050_1028002 3300025298 Bacteria 1840
53 Ga0207699_10000087 3300025906 Bacteria 69697
54 Ga0207695_10002692 3300025913 Bacteria 25915
55 Ga0207671_10011363 3300025914 Bacteria 7253
56 Ga0207671_10282809 3300025914 Bacteria 1308
57 Ga0207663_10000354 3300025916 Bacteria 19988
58 Ga0207694_10003981 3300025924 Bacteria 11647
59 Ga0207700_10208496 3300025928 Bacteria 1651
60 Ga0207665_10060942 3300025939 Bacteria 2556
61 Ga0207640_10009921 3300025981 Bacteria 5347
62 Ga0207674_10090606 3300026116 Bacteria 3049
63 Ga0209968_1018239 3300027526 Bacteria 1123
64 Ga0209974_10064950 3300027876 Bacteria 1239
65 Ga0265328_10000002 3300031239 Bacteria 275819
66 Ga0265328_10005204 3300031239 Bacteria 5590
67 Ga0265328_10014058 3300031239 Bacteria 3158
68 Ga0265328_10071394 3300031239 Bacteria 1276
69 Ga0265331_10000055 3300031250 Bacteria 177693
70 Ga0265331_10089439 3300031250 Bacteria 1424
71 Ga0265327_10000045 3300031251 Bacteria 282880
72 Ga0265327_10000793 3300031251 Bacteria 48611
73 Ga0265327_10010785 3300031251 Bacteria 6373
74 Ga0265327_10012888 3300031251 Bacteria 5599
75 Ga0265316_10249472 3300031344 Bacteria 1304
76 Ga0307408_100000246 3300031548 Bacteria 56179
77 Ga0307406_10006072 3300031901 Bacteria 6638
78 Ga0307412_10073051 3300031911 Bacteria 2346
79 Ga0307416_101561769 3300032002 Bacteria 765
80 Ga0307411_10080059 3300032005 Bacteria 2245
81 Ga0373936_0231251 3300035113 Bacteria 822
82 Ga0373927_0576423 3300035695 Bacteria 744
83 Ga0395899_0008511 3300037312 Bacteria 7902
84 Ga0395899_0030956 3300037312 Bacteria 4023
85 Ga0395900_0225994 3300037418 Bacteria 1884
86 Ga0395898_1170872 3300037466 Bacteria 700
87 Ga0395905_1255587 3300037471 Bacteria 644
88 Ga0436361_0083455 3300039447 Bacteria 15483
89 Ga0436361_0599588 3300039447 Bacteria 19015
90 Ga0436361_0905002 3300039447 Bacteria 2487
91 Ga0451797_1194083 3300041453 Bacteria 804
92 Ga0451853_3197648 3300041512 Unclassified 780
93 Ga0450900_070655 3300042136 Bacteria 554
94 Ga0439460_0332708 3300042461 Bacteria 534
95 Ga0451577_0001683 3300042876 Bacteria 28560
96 Ga0451577_0114829 3300042876 Bacteria 2410
97 Ga0453683_0048072 3300044673 Bacteria 2676
98 Ga0451576_0007983 3300045051 Bacteria 12517
99 Ga0495651_0049797 3300046462 Bacteria 3233
100 Ga0495653_0069333 3300046463 Bacteria 2642
101 Ga0495607_0066793 3300046501 Bacteria 2022
102 Ga0495608_0017648 3300046511 Bacteria 4935
103 Ga0495608_0042509 3300046511 Bacteria 3039
104 Ga0495618_0041089 3300046514 Bacteria 2911
105 Ga0495618_0290278 3300046514 Bacteria 1018
106 Ga0495628_0002411 3300046516 Bacteria 16861
107 Ga0495628_0007885 3300046516 Bacteria 9176
108 Ga0495652_0021987 3300046529 Bacteria 5666
109 Ga0495652_0038586 3300046529 Bacteria 4137
110 Ga0495645_0015769 3300046543 Bacteria 5379
111 Ga0495645_0258202 3300046543 Bacteria 1155
112 Ga0495635_0064510 3300046663 Bacteria 2514
113 Ga0495657_0322122 3300046675 Bacteria 918
114 Ga0495599_0015976 3300046678 Bacteria 4658
115 Ga0495623_0074627 3300046679 Bacteria 2107
116 Ga0495623_0100730 3300046679 Bacteria 1760
117 Ga0495646_0044344 3300046680 Bacteria 2719
118 Ga0495613_0438983 3300046689 Bacteria 886
119 Ga0495624_0030023 3300046690 Bacteria 3543
120 Ga0495624_0095067 3300046690 Bacteria 1837
121 Ga0495670_0033511 3300046691 Bacteria 2555
122 Ga0495600_0004654 3300046809 Bacteria 8223
123 Ga0495604_0135488 3300047317 Bacteria 1765
124 Ga0495672_0000137 3300047320 Bacteria 108480
125 Ga0495683_0000023 3300047323 Bacteria 162705
126 Ga0495602_0094899 3300048088 Bacteria 2464
127 Ga0495602_0133316 3300048088 Bacteria 1977
128 Ga0496102_0085218 3300048905 Bacteria 2917
129 Ga0496123_0342934 3300048926 Bacteria 697
130 Ga0495682_0000149 3300049460 Bacteria 59736
131 Ga0501034_0000468 3300049571 Bacteria 66573
132 Ga0501034_0067270 3300049571 Bacteria 3596
133 Ga0501037_0686014 3300049573 Bacteria 682
134 Ga0501039_0006191 3300049575 Bacteria 9084
135 Ga0501040_0043001 3300049576 Bacteria 3079
136 Ga0501041_0042963 3300049577 Bacteria 2747
137 Ga0501046_0025558 3300049580 Bacteria 4832
138 Ga0501067_0471612 3300049583 Bacteria 701
139 Ga0501068_0001345 3300049584 Bacteria 13042
140 Ga0501069_0351738 3300049585 Bacteria 868
141 Ga0501070_0012110 3300049586 Bacteria 7280
142 Ga0501072_0032582 3300049588 Bacteria 4081
143 Ga0501072_0262936 3300049588 Bacteria 1373
144 Ga0501074_0105808 3300049590 Bacteria 2014
145 Ga0501075_0009340 3300049591 Bacteria 6860
146 Ga0501076_0041504 3300049592 Bacteria 3620
147 Ga0501077_0155330 3300049593 Bacteria 1452
148 Ga0501249_092529 3300049679 Bacteria 718
149 Ga0501080_0000523 3300049742 Bacteria 30182
150 Ga0501080_0019373 3300049742 Bacteria 6305
151 Ga0501080_1182172 3300049742 Bacteria 658
152 Ga0501083_0068957 3300049744 Bacteria 2353
153 Ga0501083_0366277 3300049744 Bacteria 937
154 Ga0501035_0215327 3300049822 Bacteria 1642
155 Ga0501045_0008358 3300049824 Bacteria 7209
156 nmdc:mga0k408_148893_c2 3300050493 Bacteria 901
157 nmdc:mga0k408_458726_c1 3300050493 Bacteria 756
158 nmdc:mga07m45_201470_c1 3300050496 Bacteria 1158
159 nmdc:mga05p37_388449_c1 3300050507 Bacteria 1633
160 nmdc:mga05p37_63_c1 3300050507 Bacteria 93704
161 nmdc:mga0n895_98272_c1 3300050512 Bacteria 2934
162 nmdc:mga0rr50_217099_c1 3300050513 Bacteria 1578
163 nmdc:mga0rr50_542073_c1 3300050513 Bacteria 990
164 nmdc:mga08x19_166220_c1 3300050514 Bacteria 1500
165 nmdc:mga08x19_19_c1 3300050514 Bacteria 315774
166 nmdc:mga08x19_96214_c1 3300050514 Bacteria 1960
167 nmdc:mga0a205_175971_c1 3300050515 Bacteria 2035
168 Ga0495601_0032902 3300053077 Bacteria 3229
169 Ga0500556_0001502 3300053104 Bacteria 9630
170 Ga0500572_239448 3300053111 Bacteria 592
171 Ga0500618_071294 3300053125 Bacteria 779
172 Ga0500573_0326693 3300053140 Bacteria 755
173 Ga0500619_001757 3300053154 Bacteria 3956
174 Ga0500624_027775 3300053157 Bacteria 954
175 Ga0501084_0151709 3300054114 Bacteria 1953
176 Ga0501082_0006167 3300060353 Bacteria 10407
177 Ga0530510_0020271 3300061734 Bacteria 4728

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0069333 Ga0495653_0069333_965_1477 148
2 3300046514 Ga0495618_0041089 Ga0495618_0041089_1347_1859 148
3 3300046529 Ga0495652_0021987 Ga0495652_0021987_2661_3173 148
4 3300046543 Ga0495645_0015769 Ga0495645_0015769_681_1193 148
5 3300046663 Ga0495635_0064510 Ga0495635_0064510_1898_2410 148
6 3300046678 Ga0495599_0015976 Ga0495599_0015976_974_1486 148
7 3300046679 Ga0495623_0100730 Ga0495623_0100730_640_1152 148
8 3300046680 Ga0495646_0044344 Ga0495646_0044344_487_999 148
9 3300047317 Ga0495604_0135488 Ga0495604_0135488_656_1168 148
10 3300048088 Ga0495602_0133316 Ga0495602_0133316_631_1143 148
11 3300053077 Ga0495601_0032902 Ga0495601_0032902_1702_2214 148
12 3300053154 Ga0500619_001757 Ga0500619_001757_2186_2698 148
13 3300046511 Ga0495608_0042509 Ga0495608_0042509_872_1384 149
14 3300046516 Ga0495628_0007885 Ga0495628_0007885_978_1490 149
15 3300046690 Ga0495624_0030023 Ga0495624_0030023_232_744 149
16 3300046809 Ga0495600_0004654 Ga0495600_0004654_6752_7264 149
17 3300053111 Ga0500572_239448 Ga0500572_239448_54_566 149
18 3300005545 Ga0070695_100288810 Ga0070695_1002888102 150
19 3300005549 Ga0070704_100841786 Ga0070704_1008417861 151
20 3300042461 Ga0439460_0332708 Ga0439460_0332708_30_515 151
21 3300049573 Ga0501037_0686014 Ga0501037_0686014_188_652 151
22 3300049585 Ga0501069_0351738 Ga0501069_0351738_393_857 151
23 3300050512 nmdc:mga0n895_98272_c1 nmdc:mga0n895_98272_c1_337_810 151
24 3300050513 nmdc:mga0rr50_217099_c1 nmdc:mga0rr50_217099_c1_256_729 151
25 3300050514 nmdc:mga08x19_166220_c1 nmdc:mga08x19_166220_c1_97_570 151
26 3300050515 nmdc:mga0a205_175971_c1 nmdc:mga0a205_175971_c1_309_782 151
27 iso_pu_bacteria 2547132374 2548496866 154
28 iso_pu_bacteria 2643221570 2643865027 154
29 iso_pu_bacteria 2643221596 2643990313 154
30 iso_pu_bacteria 2643221609 2644062446 154
31 iso_pu_bacteria 2643221611 2644076523 154
32 iso_pu_bacteria 2643221652 2644295954 154
33 iso_pu_bacteria 2643221717 2644645630 154
34 iso_pu_bacteria 2738543012 2739247055 154
35 iso_pu_bacteria 2816332133 2816474840 154
36 iso_pu_bacteria 2842747753 2842749226 154
37 iso_pu_bacteria 2990710928 2990711835 154
38 3300047320 Ga0495672_0000137 Ga0495672_0000137_86933_87433 156
39 3300047323 Ga0495683_0000023 Ga0495683_0000023_84527_85027 156
40 3300049460 Ga0495682_0000149 Ga0495682_0000149_37282_37782 156
41 3300035113 Ga0373936_0231251 Ga0373936_0231251_162_647 157
42 3300035695 Ga0373927_0576423 Ga0373927_0576423_55_540 157
43 iso_pu_bacteria 2998344455 2998345967 157
44 3300006353 Ga0075370_10313611 Ga0075370_103136112 158
45 3300014325 Ga0163163_10015406 Ga0163163_100154065 158
46 3300014497 Ga0182008_10000412 Ga0182008_1000041231 158
47 3300031548 Ga0307408_100000246 Ga0307408_10000024639 158
48 3300031901 Ga0307406_10006072 Ga0307406_100060728 158
49 3300032005 Ga0307411_10080059 Ga0307411_100800593 158
50 3300037471 Ga0395905_1255587 Ga0395905_1255587_131_616 158
51 3300042136 Ga0450900_070655 Ga0450900_070655_54_542 158
52 3300042876 Ga0451577_0001683 Ga0451577_0001683_6613_7107 158
53 3300042876 Ga0451577_0114829 Ga0451577_0114829_1637_2131 158
54 3300044673 Ga0453683_0048072 Ga0453683_0048072_635_1129 158
55 3300045051 Ga0451576_0007983 Ga0451576_0007983_1649_2143 158
56 3300046691 Ga0495670_0033511 Ga0495670_0033511_1077_1559 158
57 3300049679 Ga0501249_092529 Ga0501249_092529_205_693 158
58 3300053104 Ga0500556_0001502 Ga0500556_0001502_6557_7066 158
59 3300053125 Ga0500618_071294 Ga0500618_071294_142_627 158
60 3300053157 Ga0500624_027775 Ga0500624_027775_116_607 158
61 iso_pu_bacteria 2846037992 2846040622 158
62 3300005434 Ga0070709_10000012 Ga0070709_1000001243 159
63 3300005436 Ga0070713_100222850 Ga0070713_1002228504 159
64 3300005439 Ga0070711_100000598 Ga0070711_10000059814 159
65 3300005468 Ga0070707_101376488 Ga0070707_1013764881 159
66 3300006173 Ga0070716_100193389 Ga0070716_1001933892 159
67 3300006175 Ga0070712_100161972 Ga0070712_1001619723 159
68 3300006852 Ga0075433_10034521 Ga0075433_100345212 159
69 3300006871 Ga0075434_100227635 Ga0075434_1002276353 159
70 3300006914 Ga0075436_100001954 Ga0075436_1000019549 159
71 3300006914 Ga0075436_100120887 Ga0075436_1001208874 159
72 3300007076 Ga0075435_100120583 Ga0075435_1001205832 159
73 3300007076 Ga0075435_100637712 Ga0075435_1006377122 159
74 3300009147 Ga0114129_10154409 Ga0114129_101544093 159
75 3300009147 Ga0114129_10326429 Ga0114129_103264292 159
76 3300017792 Ga0163161_10546471 Ga0163161_105464712 159
77 3300025906 Ga0207699_10000087 Ga0207699_1000008721 159
78 3300025916 Ga0207663_10000354 Ga0207663_100003545 159
79 3300025928 Ga0207700_10208496 Ga0207700_102084963 159
80 3300025939 Ga0207665_10060942 Ga0207665_100609421 159
81 3300037312 Ga0395899_0008511 Ga0395899_0008511_4108_4590 159
82 3300037312 Ga0395899_0030956 Ga0395899_0030956_2201_2683 159
83 3300037418 Ga0395900_0225994 Ga0395900_0225994_1304_1786 159
84 3300037466 Ga0395898_1170872 Ga0395898_1170872_120_602 159
85 3300041453 Ga0451797_1194083 Ga0451797_1194083_65_553 159
86 3300046501 Ga0495607_0066793 Ga0495607_0066793_398_886 159
87 3300050507 nmdc:mga05p37_388449_c1 nmdc:mga05p37_388449_c1_818_1315 159
88 3300050507 nmdc:mga05p37_63_c1 nmdc:mga05p37_63_c1_4802_5299 159
89 3300050513 nmdc:mga0rr50_542073_c1 nmdc:mga0rr50_542073_c1_232_729 159
90 3300050514 nmdc:mga08x19_19_c1 nmdc:mga08x19_19_c1_6076_6573 159
91 3300050514 nmdc:mga08x19_96214_c1 nmdc:mga08x19_96214_c1_1073_1570 159
92 3300053140 Ga0500573_0326693 Ga0500573_0326693_33_512 159
93 iso_pu_bacteria 2521172590 2521559402 159
94 iso_pu_bacteria 2551306416 2553007259 159
95 iso_pu_bacteria 2643221554 2643792333 159
96 iso_pu_bacteria 2643221638 2644212174 159
97 iso_pu_bacteria 2765235838 2765570658 159
98 iso_pu_bacteria 2818991449 2819615932 159
99 iso_pu_bacteria 2839094727 2839098206 159
100 iso_pu_bacteria 2904439833 2904443817 159
101 iso_pu_bacteria 2904530477 2904532715 159
102 iso_pu_bacteria 2904584206 2904585209 159
103 iso_pu_bacteria 2904589729 2904593558 159
104 iso_pu_bacteria 2904601388 2904605743 159
105 iso_pu_bacteria 2919046199 2919047981 159
106 iso_pu_bacteria 2919079590 2919081533 159
107 iso_pu_bacteria 2923510766 2923513078 159
108 3300005844 Ga0068862_101453601 Ga0068862_1014536012 160
109 3300006195 Ga0075366_10265443 Ga0075366_102654432 160
110 3300006353 Ga0075370_10218539 Ga0075370_102185392 160
111 3300014497 Ga0182008_10157973 Ga0182008_101579731 160
112 3300015261 Ga0182006_1027429 Ga0182006_10274292 160
113 3300015262 Ga0182007_10011192 Ga0182007_100111922 160
114 3300015265 Ga0182005_1000682 Ga0182005_10006826 160
115 3300025298 Ga0209050_1028002 Ga0209050_10280023 160
116 3300027876 Ga0209974_10064950 Ga0209974_100649501 160
117 3300031239 Ga0265328_10000002 Ga0265328_10000002254 160
118 3300031239 Ga0265328_10005204 Ga0265328_100052047 160
119 3300031250 Ga0265331_10089439 Ga0265331_100894392 160
120 3300031251 Ga0265327_10000793 Ga0265327_1000079339 160
121 3300031251 Ga0265327_10010785 Ga0265327_100107854 160
122 3300031344 Ga0265316_10249472 Ga0265316_102494722 160
123 3300031911 Ga0307412_10073051 Ga0307412_100730511 160
124 3300032002 Ga0307416_101561769 Ga0307416_1015617691 160
125 3300041512 Ga0451853_3197648 Ga0451853_3197648_221_706 160
126 3300046462 Ga0495651_0049797 Ga0495651_0049797_1617_2129 160
127 3300046511 Ga0495608_0017648 Ga0495608_0017648_906_1418 160
128 3300046514 Ga0495618_0290278 Ga0495618_0290278_318_830 160
129 3300046516 Ga0495628_0002411 Ga0495628_0002411_13730_14242 160
130 3300046529 Ga0495652_0038586 Ga0495652_0038586_1683_2195 160
131 3300046543 Ga0495645_0258202 Ga0495645_0258202_547_1059 160
132 3300046675 Ga0495657_0322122 Ga0495657_0322122_26_538 160
133 3300046679 Ga0495623_0074627 Ga0495623_0074627_784_1296 160
134 3300046689 Ga0495613_0438983 Ga0495613_0438983_351_863 160
135 3300046690 Ga0495624_0095067 Ga0495624_0095067_115_627 160
136 3300048088 Ga0495602_0094899 Ga0495602_0094899_1135_1647 160
137 3300050493 nmdc:mga0k408_148893_c2 nmdc:mga0k408_148893_c2_84_569 160
138 3300050493 nmdc:mga0k408_458726_c1 nmdc:mga0k408_458726_c1_74_565 160
139 3300050496 nmdc:mga07m45_201470_c1 nmdc:mga07m45_201470_c1_509_994 160
140 iso_pu_bacteria 2846033681 2846034945 160
141 3300009176 Ga0105242_11051467 Ga0105242_110514671 161
142 3300013297 Ga0157378_10526418 Ga0157378_105264181 161
143 3300048905 Ga0496102_0085218 Ga0496102_0085218_1595_2101 161
144 3300003751 Ga0055538_1000019 Ga0055538_1000019282 162
145 3300003752 Ga0055539_1000024 Ga0055539_10000248 162
146 3300003756 Ga0055533_1000032 Ga0055533_1000032282 162
147 3300003759 Ga0055525_1000041 Ga0055525_1000041282 162
148 3300003841 Ga0055541_1000018 Ga0055541_10000188 162
149 3300005563 Ga0068855_100117467 Ga0068855_1001174673 162
150 3300005577 Ga0068857_100096326 Ga0068857_1000963262 162
151 3300005578 Ga0068854_100006936 Ga0068854_1000069364 162
152 3300009093 Ga0105240_10119300 Ga0105240_101193001 162
153 3300009545 Ga0105237_10023147 Ga0105237_100231472 162
154 3300009545 Ga0105237_10293384 Ga0105237_102933841 162
155 3300009551 Ga0105238_10000311 Ga0105238_1000031124 162
156 3300015261 Ga0182006_1003068 Ga0182006_10030686 162
157 3300021361 Ga0213872_10033497 Ga0213872_100334972 162
158 3300021361 Ga0213872_10039786 Ga0213872_100397862 162
159 3300021361 Ga0213872_10040716 Ga0213872_100407162 162
160 3300025224 Ga0209784_100009 Ga0209784_10000985 162
161 3300025225 Ga0209566_100007 Ga0209566_10000785 162
162 3300025226 Ga0209674_100018 Ga0209674_10001885 162
163 3300025230 Ga0209563_100020 Ga0209563_10002085 162
164 3300025253 Ga0209677_100010 Ga0209677_10001085 162
165 3300025913 Ga0207695_10002692 Ga0207695_1000269215 162
166 3300025914 Ga0207671_10011363 Ga0207671_100113635 162
167 3300025914 Ga0207671_10282809 Ga0207671_102828091 162
168 3300025924 Ga0207694_10003981 Ga0207694_100039811 162
169 3300025981 Ga0207640_10009921 Ga0207640_100099212 162
170 3300026116 Ga0207674_10090606 Ga0207674_100906062 162
171 3300027526 Ga0209968_1018239 Ga0209968_10182392 162
172 3300039447 Ga0436361_0083455 Ga0436361_0083455_10698_11192 162
173 3300039447 Ga0436361_0599588 Ga0436361_0599588_8449_8943 162
174 3300039447 Ga0436361_0905002 Ga0436361_0905002_748_1242 162
175 3300049571 Ga0501034_0000468 Ga0501034_0000468_9723_10235 162
176 3300049588 Ga0501072_0032582 Ga0501072_0032582_1715_2227 162
177 3300049742 Ga0501080_1182172 Ga0501080_1182172_35_547 162
178 3300002739 JGI25158J39367_1004104 JGI25158J39367_10041042 163
179 3300031239 Ga0265328_10014058 Ga0265328_100140582 163
180 3300031239 Ga0265328_10071394 Ga0265328_100713941 163
181 3300031250 Ga0265331_10000055 Ga0265331_10000055120 163
182 3300031251 Ga0265327_10000045 Ga0265327_10000045222 163
183 3300031251 Ga0265327_10012888 Ga0265327_100128883 163
184 3300048926 Ga0496123_0342934 Ga0496123_0342934_142_651 163
185 3300049571 Ga0501034_0067270 Ga0501034_0067270_2813_3325 163
186 3300049575 Ga0501039_0006191 Ga0501039_0006191_342_908 163
187 3300049576 Ga0501040_0043001 Ga0501040_0043001_735_1301 163
188 3300049577 Ga0501041_0042963 Ga0501041_0042963_595_1161 163
189 3300049580 Ga0501046_0025558 Ga0501046_0025558_2299_2865 163
190 3300049583 Ga0501067_0471612 Ga0501067_0471612_166_687 163
191 3300049584 Ga0501068_0001345 Ga0501068_0001345_2128_2649 163
192 3300049586 Ga0501070_0012110 Ga0501070_0012110_1305_1826 163
193 3300049588 Ga0501072_0262936 Ga0501072_0262936_208_774 163
194 3300049590 Ga0501074_0105808 Ga0501074_0105808_1135_1656 163
195 3300049591 Ga0501075_0009340 Ga0501075_0009340_1970_2536 163
196 3300049592 Ga0501076_0041504 Ga0501076_0041504_1119_1685 163
197 3300049593 Ga0501077_0155330 Ga0501077_0155330_403_924 163
198 3300049742 Ga0501080_0000523 Ga0501080_0000523_28606_29127 163
199 3300049742 Ga0501080_0019373 Ga0501080_0019373_1858_2424 163
200 3300049744 Ga0501083_0068957 Ga0501083_0068957_422_943 163
201 3300049744 Ga0501083_0366277 Ga0501083_0366277_147_713 163
202 3300049822 Ga0501035_0215327 Ga0501035_0215327_457_1023 163
203 3300049824 Ga0501045_0008358 Ga0501045_0008358_5359_5925 163
204 3300054114 Ga0501084_0151709 Ga0501084_0151709_714_1280 163
205 3300060353 Ga0501082_0006167 Ga0501082_0006167_2180_2746 163
206 3300061734 Ga0530510_0020271 Ga0530510_0020271_2764_3330 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00186

DHFR_1

Dihydrofolate reductase

37

193

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tq8-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with trimethoprim 0.9834 5 163
3tqa-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with nadph 0.983 5 162
3tqa-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with nadph 0.9769 5 162
3jw3-assembly2.cif.gz_B crystal structure of bacillus anthracis (f96i) dihydrofolate reductase complexed with nadph and trimethoprim 0.9712 5 162
3jwc-assembly1.cif.gz_A crystal structure of bacillus anthracis (y102f) dihydrofolate reductase complexed with nadph and 2,4-diamino-5-(3-(3,4,5-trimethoxyphenyl)prop-1-ynyl)-6-ethylpyrimidine (ucp120a) 0.9689 4 162
ID Description Score Start End Superfamily
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.983 5 162 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9769 5 162 3.40.430.10
4or7A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9591 7 163 3.40.430.10
4fghA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9538 5 163 3.40.430.10
3fl9F00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9532 5 163 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A520DBD6-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9911 4 116 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A7T9EV24-F1-model_v4 deleted 0.9907 4 163
AF-A0A4Q5ZRL7-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9905 5 116 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A849GEY7-F1-model_v4 deleted 0.9904 5 125
AF-A0A139BSS4-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9875 4 163 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661

Feature Viewer

pLDDT pTM Quality
94.65 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map