F315217

General Info

Members Datasets Scaffolds Average Seq Length
206 153 206 326

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10285263|Ga0207700_102852631
Length 351
Sequence MLSRVAEAVYWAGRYIERAENTARFIDVNLAMTLDAPSSFGEQWAPLVAITGDRASFDERFQVATRENVIEFLSSDPANPSCILACLQKARENARSVREVISSEMWEQINRFYLTVSNGAARRRPILDSYQFFSEVKLHSHQVAGVADNTMSHNEAWHFFQLGRLLERADNTSRLLDVKYFLLLPTPEDVGGAIDEMQWAIVLRSASAFEMYRKRHGRIEPEDVIDFLLVETDFPRAILYCLTAAEQSLGAISGSQGGRFRNSAEQELGRLKAELAYEQASDIIAKGLHQFLDGFQTKLNAVGVAIAETFFHPPAGSAKSNGGTSRRDVLFGNQSQRRSGGNRRHTRDLGQ

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
73 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
89 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
93 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
94 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
95 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
110 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
111 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 3.4
Rhizosphere 94.66
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10041997 3300005327 Unclassified 3690
2 Ga0070676_10004395 3300005328 Bacteria 7414
3 Ga0070690_100068216 3300005330 Bacteria 2306
4 Ga0068869_100077866 3300005334 Bacteria 2468
5 Ga0070666_10001408 3300005335 Bacteria 14541
6 Ga0068868_100065379 3300005338 Unclassified 2889
7 Ga0070660_100201286 3300005339 Bacteria 1615
8 Ga0070661_100104336 3300005344 Bacteria 2112
9 Ga0070669_100026813 3300005353 Unclassified 4146
10 Ga0070675_100008166 3300005354 Bacteria 8112
11 Ga0070671_100018401 3300005355 Bacteria 5674
12 Ga0070674_100002541 3300005356 Bacteria 10106
13 Ga0070673_100000695 3300005364 Bacteria 18555
14 Ga0070688_100059021 3300005365 Bacteria 2418
15 Ga0070659_100074490 3300005366 Unclassified 2704
16 Ga0070667_100029077 3300005367 Unclassified 4603
17 Ga0070700_100108785 3300005441 Bacteria 1839
18 Ga0070678_100006473 3300005456 Bacteria 6878
19 Ga0070662_100056197 3300005457 Bacteria 2857
20 Ga0070698_100133187 3300005471 Bacteria 2440
21 Ga0070699_100071336 3300005518 Bacteria 3021
22 Ga0070699_100484397 3300005518 Bacteria 1123
23 Ga0070697_100140524 3300005536 Unclassified 2031
24 Ga0068853_100266729 3300005539 Unclassified 1576
25 Ga0070672_100000268 3300005543 Bacteria 29528
26 Ga0070695_100081178 3300005545 Bacteria 2145
27 Ga0070665_100024623 3300005548 Bacteria 6066
28 Ga0068854_100324989 3300005578 Unclassified 1251
29 Ga0068854_100470711 3300005578 Bacteria 1053
30 Ga0068870_10246124 3300005840 Bacteria 1106
31 Ga0068858_100012950 3300005842 Bacteria 7865
32 Ga0081538_10014741 3300005981 Bacteria 6098
33 Ga0075364_10019410 3300006051 Bacteria 4267
34 Ga0097621_100009169 3300006237 Bacteria 7173
35 Ga0075428_100008570 3300006844 Bacteria 11343
36 Ga0075430_100001273 3300006846 Bacteria 20306
37 Ga0075431_100006048 3300006847 Bacteria 11999
38 Ga0075433_10000123 3300006852 Bacteria 39196
39 Ga0075433_10051018 3300006852 Bacteria 3602
40 Ga0075434_100015648 3300006871 Bacteria 7280
41 Ga0068865_100160524 3300006881 Bacteria 1714
42 Ga0111539_10012562 3300009094 Bacteria 10611
43 Ga0114129_10371429 3300009147 Bacteria 1890
44 Ga0105242_10097143 3300009176 Bacteria 2490
45 Ga0105248_10120582 3300009177 Bacteria 2959
46 Ga0105238_10113073 3300009551 Bacteria 2695
47 Ga0157374_10019521 3300013296 Bacteria 6000
48 Ga0157374_10048443 3300013296 Bacteria 3943
49 Ga0157378_10002293 3300013297 Bacteria 17000
50 Ga0163162_10043519 3300013306 Unclassified 4497
51 Ga0157375_10005212 3300013308 Bacteria 11280
52 Ga0157375_10428034 3300013308 Bacteria 1489
53 Ga0157379_10046628 3300014968 Bacteria 3866
54 Ga0157379_10092712 3300014968 Bacteria 2710
55 Ga0157376_10002808 3300014969 Bacteria 11898
56 Ga0157376_10078848 3300014969 Unclassified 2822
57 Ga0207697_10006851 3300025315 Bacteria 5116
58 Ga0207656_10086186 3300025321 Bacteria 1419
59 Ga0207688_10100083 3300025901 Bacteria 1673
60 Ga0207680_10021035 3300025903 Bacteria 3524
61 Ga0207645_10007120 3300025907 Bacteria 7941
62 Ga0207657_10362933 3300025919 Bacteria 1142
63 Ga0207681_10023485 3300025923 Unclassified 3945
64 Ga0207659_10377680 3300025926 Bacteria 1181
65 Ga0207700_10285263 3300025928 Bacteria 1422
66 Ga0207706_10012839 3300025933 Bacteria 7625
67 Ga0207704_10135585 3300025938 Bacteria 1713
68 Ga0207691_10000376 3300025940 Bacteria 44931
69 Ga0207712_10081040 3300025961 Bacteria 2362
70 Ga0207712_10296098 3300025961 Bacteria 1326
71 Ga0207640_10295131 3300025981 Unclassified 1280
72 Ga0207658_10331377 3300025986 Bacteria 1320
73 Ga0207677_10020519 3300026023 Unclassified 4013
74 Ga0207703_10018421 3300026035 Bacteria 5453
75 Ga0207708_10144562 3300026075 Bacteria 1868
76 Ga0207708_10172758 3300026075 Bacteria 1713
77 Ga0207648_10093696 3300026089 Bacteria 2626
78 Ga0207683_10007338 3300026121 Bacteria 9448
79 Ga0207428_10080444 3300027907 Unclassified 2546
80 Ga0268264_10169402 3300028381 Bacteria 1974
81 Ga0265337_1005431 3300028556 Bacteria 5061
82 Ga0265319_1000048 3300028563 Bacteria 99817
83 Ga0265318_10000173 3300028577 Bacteria 57246
84 Ga0265318_10000635 3300028577 Bacteria 24167
85 Ga0265338_10003098 3300028800 Bacteria 23843
86 Ga0265338_10142343 3300028800 Bacteria 1877
87 Ga0265330_10000272 3300031235 Bacteria 38115
88 Ga0265332_10000195 3300031238 Bacteria 49241
89 Ga0265328_10003382 3300031239 Bacteria 7050
90 Ga0265328_10050830 3300031239 Bacteria 1522
91 Ga0265320_10000384 3300031240 Bacteria 35831
92 Ga0265320_10022203 3300031240 Bacteria 3398
93 Ga0265325_10000142 3300031241 Bacteria 50282
94 Ga0265325_10008183 3300031241 Bacteria 6195
95 Ga0265325_10026031 3300031241 Bacteria 3173
96 Ga0265329_10000036 3300031242 Bacteria 55211
97 Ga0265340_10002392 3300031247 Bacteria 10671
98 Ga0265340_10004153 3300031247 Bacteria 8129
99 Ga0265339_10001108 3300031249 Bacteria 20427
100 Ga0265339_10004719 3300031249 Bacteria 9236
101 Ga0265331_10001529 3300031250 Bacteria 17044
102 Ga0265316_10000971 3300031344 Bacteria 31246
103 Ga0265316_10008912 3300031344 Bacteria 9263
104 Ga0265313_10000201 3300031595 Bacteria 64235
105 Ga0265313_10001063 3300031595 Bacteria 26632
106 Ga0307508_10002165 3300031616 Bacteria 21043
107 Ga0316575_10000307 3300031665 Bacteria 13718
108 Ga0316579_10018171 3300031691 Bacteria 3092
109 Ga0265314_10000159 3300031711 Bacteria 102733
110 Ga0265314_10117092 3300031711 Bacteria 1684
111 Ga0265314_10156937 3300031711 Bacteria 1389
112 Ga0265342_10000099 3300031712 Bacteria 95861
113 Ga0316576_10004745 3300031727 Bacteria 8204
114 Ga0316576_10016158 3300031727 Bacteria 5032
115 Ga0316576_10037184 3300031727 Bacteria 3484
116 Ga0316576_10055338 3300031727 Bacteria 2895
117 Ga0316576_10088605 3300031727 Unclassified 2304
118 Ga0316576_10096613 3300031727 Bacteria 2205
119 Ga0316576_10102974 3300031727 Bacteria 2135
120 Ga0316576_10132444 3300031727 Bacteria 1876
121 Ga0316578_10034539 3300031728 Bacteria 2904
122 Ga0316578_10043931 3300031728 Bacteria 2597
123 Ga0316578_10055212 3300031728 Bacteria 2331
124 Ga0316578_10104178 3300031728 Bacteria 1702
125 Ga0316577_10004950 3300031733 Bacteria 6945
126 Ga0316577_10014428 3300031733 Bacteria 4337
127 Ga0316583_10029156 3300032133 Bacteria 1968
128 Ga0373955_0035878 3300035172 Bacteria 2629
129 Ga0316574_0043106 3300035398 Bacteria 2787
130 Ga0373937_0030538 3300036401 Bacteria 4880
131 Ga0316584_0005853 3300036712 Bacteria 8303
132 Ga0316584_0028695 3300036712 Bacteria 4106
133 Ga0316584_0041829 3300036712 Bacteria 3416
134 Ga0316584_0293875 3300036712 Bacteria 1178
135 Ga0316584_0359562 3300036712 Bacteria 1044
136 Ga0436365_0857732 3300039437 Bacteria 4259
137 Ga0451577_0001027 3300042876 Bacteria 40480
138 Ga0451577_0026848 3300042876 Bacteria 5213
139 Ga0451577_0191864 3300042876 Bacteria 1843
140 Ga0451577_0302947 3300042876 Bacteria 1448
141 Ga0453683_0046735 3300044673 Bacteria 2713
142 Ga0453684_0005470 3300044712 Bacteria 25144
143 Ga0453684_0021266 3300044712 Bacteria 9707
144 Ga0453684_0082426 3300044712 Bacteria 4007
145 Ga0466970_0002368 3300044765 Bacteria 9104
146 Ga0451576_0004456 3300045051 Bacteria 18159
147 Ga0451576_0013177 3300045051 Bacteria 9253
148 Ga0451576_0048550 3300045051 Bacteria 4458
149 Ga0451576_0068483 3300045051 Bacteria 3693
150 Ga0451576_0253029 3300045051 Bacteria 1841
151 Ga0451576_0514707 3300045051 Bacteria 1257
152 Ga0495651_0001171 3300046462 Bacteria 20273
153 Ga0495586_0003613 3300046535 Bacteria 8287
154 Ga0495667_0007187 3300046559 Bacteria 7554
155 Ga0495657_0001491 3300046675 Bacteria 20181
156 Ga0495623_0031075 3300046679 Bacteria 3435
157 Ga0495647_0052768 3300046681 Bacteria 1584
158 Ga0495674_0267929 3300047319 Bacteria 1402
159 Ga0495680_0017242 3300047322 Bacteria 6174
160 Ga0495675_0013955 3300047444 Bacteria 5081
161 Ga0495602_0129218 3300048088 Bacteria 2018
162 Ga0496102_0263188 3300048905 Bacteria 1626
163 Ga0496104_0026469 3300048907 Bacteria 5357
164 Ga0496104_0088816 3300048907 Unclassified 2953
165 Ga0496105_0275132 3300048908 Bacteria 1359
166 Ga0496109_0054384 3300048912 Bacteria 3652
167 Ga0496112_0222656 3300048915 Bacteria 1842
168 Ga0496114_0007152 3300048917 Bacteria 8805
169 Ga0501032_0175673 3300049569 Bacteria 1403
170 Ga0501033_0192712 3300049570 Bacteria 1458
171 Ga0501036_0057817 3300049572 Bacteria 3285
172 Ga0501037_0111240 3300049573 Bacteria 1973
173 Ga0501041_0033717 3300049577 Bacteria 3098
174 Ga0501042_0020061 3300049578 Bacteria 4650
175 Ga0501042_0055068 3300049578 Bacteria 2837
176 Ga0501046_0000048 3300049580 Bacteria 135131
177 Ga0501046_0044074 3300049580 Bacteria 3549
178 Ga0501048_0065575 3300049582 Bacteria 2567
179 Ga0501068_0013356 3300049584 Bacteria 4671
180 Ga0501069_0053331 3300049585 Bacteria 2252
181 Ga0501071_0101195 3300049587 Bacteria 2124
182 Ga0501072_0198291 3300049588 Bacteria 1600
183 Ga0501073_0112679 3300049589 Bacteria 1887
184 Ga0501076_0042132 3300049592 Bacteria 3594
185 Ga0501077_0015764 3300049593 Bacteria 4760
186 Ga0501079_0235812 3300049741 Bacteria 1429
187 Ga0501081_0019587 3300049743 Bacteria 4506
188 Ga0501083_0118386 3300049744 Bacteria 1738
189 Ga0501044_0417719 3300049823 Bacteria 1252
190 nmdc:mga00v17_2147_c1 3300050491 Bacteria 10134
191 nmdc:mga05p37_360973_c1 3300050507 Bacteria 1708
192 nmdc:mga05p37_457598_c1 3300050507 Bacteria 1475
193 nmdc:mga05p37_46286_c1 3300050507 Bacteria 5350
194 nmdc:mga05p37_481789_c1 3300050507 Unclassified 1429
195 nmdc:mga09592_331777_c1 3300050508 Bacteria 1317
196 nmdc:mga0qj67_33197_c1 3300050509 Bacteria 4027
197 nmdc:mga06r32_85052_c1 3300050510 Bacteria 3084
198 nmdc:mga08y16_15717_c1 3300050511 Bacteria 7961
199 nmdc:mga0n895_12300_c1 3300050512 Bacteria 7671
200 nmdc:mga0a205_179_c1 3300050515 Bacteria 37805
201 nmdc:mga0a205_7282_c1 3300050515 Bacteria 10010
202 Ga0495595_0002224 3300053084 Bacteria 7547
203 Ga0495619_0013976 3300053085 Bacteria 5066
204 Ga0501084_0021408 3300054114 Bacteria 5388
205 Ga0501082_0056410 3300060353 Bacteria 3384
206 Ga0530510_0258637 3300061734 Bacteria 1298

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0359562 Ga0316584_0359562_193_1023 275
2 3300028556 Ga0265337_1005431 Ga0265337_10054312 277
3 3300005518 Ga0070699_100071336 Ga0070699_1000713362 290
4 3300025901 Ga0207688_10100083 Ga0207688_101000831 291
5 3300050507 nmdc:mga05p37_481789_c1 nmdc:mga05p37_481789_c1_14_901 291
6 3300031616 Ga0307508_10002165 Ga0307508_1000216512 307
7 3300031665 Ga0316575_10000307 Ga0316575_100003073 308
8 3300028800 Ga0265338_10003098 Ga0265338_100030986 309
9 3300031241 Ga0265325_10008183 Ga0265325_100081835 309
10 3300031249 Ga0265339_10001108 Ga0265339_100011082 309
11 3300031711 Ga0265314_10117092 Ga0265314_101170922 309
12 3300045051 Ga0451576_0048550 Ga0451576_0048550_599_1552 309
13 3300049570 Ga0501033_0192712 Ga0501033_0192712_23_970 311
14 3300049572 Ga0501036_0057817 Ga0501036_0057817_2316_3263 311
15 3300049587 Ga0501071_0101195 Ga0501071_0101195_29_976 311
16 3300050508 nmdc:mga09592_331777_c1 nmdc:mga09592_331777_c1_17_964 311
17 3300049580 Ga0501046_0000048 Ga0501046_0000048_129185_130138 312
18 3300009094 Ga0111539_10012562 Ga0111539_100125628 315
19 3300013296 Ga0157374_10019521 Ga0157374_100195215 315
20 3300013297 Ga0157378_10002293 Ga0157378_100022939 315
21 3300013306 Ga0163162_10043519 Ga0163162_100435195 315
22 3300013308 Ga0157375_10005212 Ga0157375_100052125 315
23 3300014969 Ga0157376_10002808 Ga0157376_1000280810 315
24 3300048905 Ga0496102_0263188 Ga0496102_0263188_274_1221 315
25 3300048907 Ga0496104_0088816 Ga0496104_0088816_1718_2665 315
26 3300048908 Ga0496105_0275132 Ga0496105_0275132_331_1278 315
27 3300048912 Ga0496109_0054384 Ga0496109_0054384_2106_3053 315
28 3300048917 Ga0496114_0007152 Ga0496114_0007152_4873_5820 315
29 3300050511 nmdc:mga08y16_15717_c1 nmdc:mga08y16_15717_c1_2126_3073 315
30 3300044712 Ga0453684_0005470 Ga0453684_0005470_4735_5688 316
31 3300049585 Ga0501069_0053331 Ga0501069_0053331_829_1812 316
32 3300049589 Ga0501073_0112679 Ga0501073_0112679_638_1621 316
33 3300005842 Ga0068858_100012950 Ga0068858_1000129502 317
34 3300006051 Ga0075364_10019410 Ga0075364_100194104 317
35 3300009551 Ga0105238_10113073 Ga0105238_101130732 317
36 3300014968 Ga0157379_10046628 Ga0157379_100466282 317
37 3300026035 Ga0207703_10018421 Ga0207703_100184213 317
38 3300028381 Ga0268264_10169402 Ga0268264_101694022 317
39 3300028577 Ga0265318_10000635 Ga0265318_100006354 317
40 3300031239 Ga0265328_10050830 Ga0265328_100508302 317
41 3300031240 Ga0265320_10022203 Ga0265320_100222032 317
42 3300031241 Ga0265325_10000142 Ga0265325_1000014210 317
43 3300031247 Ga0265340_10002392 Ga0265340_100023923 317
44 3300031344 Ga0265316_10000971 Ga0265316_1000097118 317
45 3300031595 Ga0265313_10001063 Ga0265313_100010632 317
46 3300048907 Ga0496104_0026469 Ga0496104_0026469_3607_4608 317
47 3300048915 Ga0496112_0222656 Ga0496112_0222656_636_1637 317
48 3300050491 nmdc:mga00v17_2147_c1 nmdc:mga00v17_2147_c1_4824_5954 317
49 3300039437 Ga0436365_0857732 Ga0436365_0857732_1643_2623 318
50 3300005334 Ga0068869_100077866 Ga0068869_1000778662 319
51 3300005471 Ga0070698_100133187 Ga0070698_1001331872 319
52 3300005545 Ga0070695_100081178 Ga0070695_1000811782 319
53 3300005578 Ga0068854_100470711 Ga0068854_1004707111 319
54 3300005840 Ga0068870_10246124 Ga0068870_102461241 319
55 3300006852 Ga0075433_10000123 Ga0075433_1000012326 319
56 3300006871 Ga0075434_100015648 Ga0075434_1000156482 319
57 3300009147 Ga0114129_10371429 Ga0114129_103714292 319
58 3300009176 Ga0105242_10097143 Ga0105242_100971432 319
59 3300031727 Ga0316576_10088605 Ga0316576_100886052 319
60 3300035172 Ga0373955_0035878 Ga0373955_0035878_267_1268 319
61 3300036401 Ga0373937_0030538 Ga0373937_0030538_2110_3111 319
62 3300042876 Ga0451577_0191864 Ga0451577_0191864_532_1521 319
63 3300042876 Ga0451577_0302947 Ga0451577_0302947_214_1197 319
64 3300046462 Ga0495651_0001171 Ga0495651_0001171_9668_10669 319
65 3300046559 Ga0495667_0007187 Ga0495667_0007187_5303_6304 319
66 3300046675 Ga0495657_0001491 Ga0495657_0001491_13982_14983 319
67 3300046679 Ga0495623_0031075 Ga0495623_0031075_1144_2145 319
68 3300047319 Ga0495674_0267929 Ga0495674_0267929_212_1213 319
69 3300047322 Ga0495680_0017242 Ga0495680_0017242_4011_5012 319
70 3300047444 Ga0495675_0013955 Ga0495675_0013955_3596_4597 319
71 3300048088 Ga0495602_0129218 Ga0495602_0129218_213_1214 319
72 3300050507 nmdc:mga05p37_360973_c1 nmdc:mga05p37_360973_c1_196_1188 319
73 3300050512 nmdc:mga0n895_12300_c1 nmdc:mga0n895_12300_c1_487_1479 319
74 3300050515 nmdc:mga0a205_179_c1 nmdc:mga0a205_179_c1_1209_2201 319
75 3300053084 Ga0495595_0002224 Ga0495595_0002224_2191_3192 319
76 3300053085 Ga0495619_0013976 Ga0495619_0013976_3117_4118 319
77 3300005365 Ga0070688_100059021 Ga0070688_1000590213 320
78 3300005518 Ga0070699_100484397 Ga0070699_1004843971 320
79 3300013296 Ga0157374_10048443 Ga0157374_100484432 320
80 3300014968 Ga0157379_10092712 Ga0157379_100927122 320
81 3300014969 Ga0157376_10078848 Ga0157376_100788482 320
82 3300025961 Ga0207712_10081040 Ga0207712_100810402 320
83 3300028800 Ga0265338_10142343 Ga0265338_101423432 320
84 3300042876 Ga0451577_0001027 Ga0451577_0001027_14848_15834 320
85 3300042876 Ga0451577_0026848 Ga0451577_0026848_2685_3662 320
86 3300044673 Ga0453683_0046735 Ga0453683_0046735_523_1512 320
87 3300044712 Ga0453684_0021266 Ga0453684_0021266_8354_9340 320
88 3300045051 Ga0451576_0013177 Ga0451576_0013177_2612_3601 320
89 3300045051 Ga0451576_0514707 Ga0451576_0514707_191_1222 320
90 3300046535 Ga0495586_0003613 Ga0495586_0003613_4366_5352 320
91 3300046681 Ga0495647_0052768 Ga0495647_0052768_444_1430 320
92 3300009177 Ga0105248_10120582 Ga0105248_101205822 321
93 3300025961 Ga0207712_10296098 Ga0207712_102960982 321
94 3300026075 Ga0207708_10172758 Ga0207708_101727581 321
95 3300026089 Ga0207648_10093696 Ga0207648_100936962 321
96 3300045051 Ga0451576_0253029 Ga0451576_0253029_17_994 321
97 3300005441 Ga0070700_100108785 Ga0070700_1001087851 322
98 3300005536 Ga0070697_100140524 Ga0070697_1001405241 322
99 3300006844 Ga0075428_100008570 Ga0075428_10000857013 322
100 3300006846 Ga0075430_100001273 Ga0075430_1000012737 322
101 3300006847 Ga0075431_100006048 Ga0075431_1000060483 322
102 3300006852 Ga0075433_10051018 Ga0075433_100510183 322
103 3300013308 Ga0157375_10428034 Ga0157375_104280341 322
104 3300026075 Ga0207708_10144562 Ga0207708_101445622 322
105 3300031727 Ga0316576_10004745 Ga0316576_100047455 322
106 3300031728 Ga0316578_10043931 Ga0316578_100439312 322
107 3300031733 Ga0316577_10004950 Ga0316577_100049502 322
108 3300035398 Ga0316574_0043106 Ga0316574_0043106_1583_2587 322
109 3300036712 Ga0316584_0041829 Ga0316584_0041829_1488_2492 322
110 3300044712 Ga0453684_0082426 Ga0453684_0082426_1207_2181 322
111 3300044765 Ga0466970_0002368 Ga0466970_0002368_6561_7538 322
112 3300049569 Ga0501032_0175673 Ga0501032_0175673_76_1056 322
113 3300049573 Ga0501037_0111240 Ga0501037_0111240_877_1857 322
114 3300049577 Ga0501041_0033717 Ga0501041_0033717_981_1961 322
115 3300049578 Ga0501042_0020061 Ga0501042_0020061_2248_3228 322
116 3300049578 Ga0501042_0055068 Ga0501042_0055068_349_1329 322
117 3300049580 Ga0501046_0044074 Ga0501046_0044074_1589_2569 322
118 3300049582 Ga0501048_0065575 Ga0501048_0065575_636_1616 322
119 3300049584 Ga0501068_0013356 Ga0501068_0013356_1869_2849 322
120 3300049588 Ga0501072_0198291 Ga0501072_0198291_112_1092 322
121 3300049592 Ga0501076_0042132 Ga0501076_0042132_84_1064 322
122 3300049593 Ga0501077_0015764 Ga0501077_0015764_1642_2622 322
123 3300049741 Ga0501079_0235812 Ga0501079_0235812_112_1092 322
124 3300049743 Ga0501081_0019587 Ga0501081_0019587_1632_2612 322
125 3300049744 Ga0501083_0118386 Ga0501083_0118386_370_1350 322
126 3300049823 Ga0501044_0417719 Ga0501044_0417719_153_1133 322
127 3300050507 nmdc:mga05p37_457598_c1 nmdc:mga05p37_457598_c1_255_1235 322
128 3300050507 nmdc:mga05p37_46286_c1 nmdc:mga05p37_46286_c1_3272_4252 322
129 3300050509 nmdc:mga0qj67_33197_c1 nmdc:mga0qj67_33197_c1_2378_3358 322
130 3300050510 nmdc:mga06r32_85052_c1 nmdc:mga06r32_85052_c1_1370_2350 322
131 3300050515 nmdc:mga0a205_7282_c1 nmdc:mga0a205_7282_c1_8199_9179 322
132 3300054114 Ga0501084_0021408 Ga0501084_0021408_4123_5103 322
133 3300060353 Ga0501082_0056410 Ga0501082_0056410_1593_2573 322
134 3300061734 Ga0530510_0258637 Ga0530510_0258637_289_1257 322
135 3300005981 Ga0081538_10014741 Ga0081538_100147414 323
136 3300028563 Ga0265319_1000048 Ga0265319_100004827 323
137 3300028577 Ga0265318_10000173 Ga0265318_1000017331 323
138 3300031235 Ga0265330_10000272 Ga0265330_1000027212 323
139 3300031238 Ga0265332_10000195 Ga0265332_1000019512 323
140 3300031239 Ga0265328_10003382 Ga0265328_100033825 323
141 3300031240 Ga0265320_10000384 Ga0265320_100003845 323
142 3300031241 Ga0265325_10026031 Ga0265325_100260312 323
143 3300031242 Ga0265329_10000036 Ga0265329_1000003619 323
144 3300031247 Ga0265340_10004153 Ga0265340_100041534 323
145 3300031249 Ga0265339_10004719 Ga0265339_100047193 323
146 3300031250 Ga0265331_10001529 Ga0265331_1000152911 323
147 3300031344 Ga0265316_10008912 Ga0265316_100089125 323
148 3300031595 Ga0265313_10000201 Ga0265313_1000020135 323
149 3300031691 Ga0316579_10018171 Ga0316579_100181712 323
150 3300031711 Ga0265314_10000159 Ga0265314_1000015920 323
151 3300031711 Ga0265314_10156937 Ga0265314_101569371 323
152 3300031712 Ga0265342_10000099 Ga0265342_1000009935 323
153 3300031727 Ga0316576_10016158 Ga0316576_100161582 323
154 3300031727 Ga0316576_10037184 Ga0316576_100371843 323
155 3300031727 Ga0316576_10055338 Ga0316576_100553382 323
156 3300031727 Ga0316576_10096613 Ga0316576_100966131 323
157 3300031727 Ga0316576_10102974 Ga0316576_101029742 323
158 3300031727 Ga0316576_10132444 Ga0316576_101324441 323
159 3300031728 Ga0316578_10034539 Ga0316578_100345392 323
160 3300031728 Ga0316578_10055212 Ga0316578_100552122 323
161 3300031728 Ga0316578_10104178 Ga0316578_101041782 323
162 3300031733 Ga0316577_10014428 Ga0316577_100144282 323
163 3300032133 Ga0316583_10029156 Ga0316583_100291562 323
164 3300036712 Ga0316584_0005853 Ga0316584_0005853_4472_5446 323
165 3300036712 Ga0316584_0028695 Ga0316584_0028695_1348_2322 323
166 3300036712 Ga0316584_0293875 Ga0316584_0293875_119_1093 323
167 3300045051 Ga0451576_0004456 Ga0451576_0004456_1436_2416 323
168 3300045051 Ga0451576_0068483 Ga0451576_0068483_977_1957 323
169 3300025928 Ga0207700_10285263 Ga0207700_102852631 324
170 3300005327 Ga0070658_10041997 Ga0070658_100419972 326
171 3300005328 Ga0070676_10004395 Ga0070676_100043958 326
172 3300005330 Ga0070690_100068216 Ga0070690_1000682162 326
173 3300005335 Ga0070666_10001408 Ga0070666_100014087 326
174 3300005338 Ga0068868_100065379 Ga0068868_1000653793 326
175 3300005339 Ga0070660_100201286 Ga0070660_1002012862 326
176 3300005344 Ga0070661_100104336 Ga0070661_1001043362 326
177 3300005353 Ga0070669_100026813 Ga0070669_1000268134 326
178 3300005354 Ga0070675_100008166 Ga0070675_1000081668 326
179 3300005355 Ga0070671_100018401 Ga0070671_1000184012 326
180 3300005356 Ga0070674_100002541 Ga0070674_1000025419 326
181 3300005364 Ga0070673_100000695 Ga0070673_10000069519 326
182 3300005366 Ga0070659_100074490 Ga0070659_1000744902 326
183 3300005367 Ga0070667_100029077 Ga0070667_1000290771 326
184 3300005456 Ga0070678_100006473 Ga0070678_1000064734 326
185 3300005457 Ga0070662_100056197 Ga0070662_1000561972 326
186 3300005539 Ga0068853_100266729 Ga0068853_1002667291 326
187 3300005543 Ga0070672_100000268 Ga0070672_10000026823 326
188 3300005548 Ga0070665_100024623 Ga0070665_1000246236 326
189 3300005578 Ga0068854_100324989 Ga0068854_1003249891 326
190 3300006237 Ga0097621_100009169 Ga0097621_1000091693 326
191 3300006881 Ga0068865_100160524 Ga0068865_1001605241 326
192 3300025315 Ga0207697_10006851 Ga0207697_100068512 326
193 3300025321 Ga0207656_10086186 Ga0207656_100861861 326
194 3300025903 Ga0207680_10021035 Ga0207680_100210352 326
195 3300025907 Ga0207645_10007120 Ga0207645_100071206 326
196 3300025919 Ga0207657_10362933 Ga0207657_103629331 326
197 3300025923 Ga0207681_10023485 Ga0207681_100234853 326
198 3300025926 Ga0207659_10377680 Ga0207659_103776801 326
199 3300025933 Ga0207706_10012839 Ga0207706_100128393 326
200 3300025938 Ga0207704_10135585 Ga0207704_101355852 326
201 3300025940 Ga0207691_10000376 Ga0207691_1000037638 326
202 3300025981 Ga0207640_10295131 Ga0207640_102951311 326
203 3300025986 Ga0207658_10331377 Ga0207658_103313772 326
204 3300026023 Ga0207677_10020519 Ga0207677_100205192 326
205 3300026121 Ga0207683_10007338 Ga0207683_1000733810 326
206 3300027907 Ga0207428_10080444 Ga0207428_100804442 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04168

Alpha-E

A predicted alpha-helical domain with a conserved ER motif.

1

311

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.3872 14 311
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.3745 14 311
7oqz-assembly1.cif.gz_A cryo-em structure of human tmem45a 0.3591 6 216
7oqz-assembly1.cif.gz_A cryo-em structure of human tmem45a 0.3026 6 216
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.2937 3 310
ID Description Score Start End Superfamily
af_O60664_251_410_1.20.120.340 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Flagellar protein FliS 0.488 4 148 1.20.120.340
af_O60664_251_410_1.20.120.340 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Flagellar protein FliS 0.4529 4 148 1.20.120.340
af_Q5A5P7_5_125_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.339 14 144 1.10.3730.20
af_Q5A5P7_5_125_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.3272 14 144 1.10.3730.20
af_Q4DNI2_58_423_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.2941 17 310 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A2N7BDI3-F1-model_v4 DUF403 domain-containing protein 0.9816 1 316
AF-A0A4Q3AFI8-F1-model_v4 deleted 0.9814 1 262
AF-A0A1G5YKE1-F1-model_v4 Uncharacterized conserved protein, Alpha-E superfamily 0.9789 1 321
AF-A0A7Y4U5K8-F1-model_v4 Alpha-E domain-containing protein 0.9775 1 183
AF-A0A6P0ZPU4-F1-model_v4 deleted 0.9769 195 313

Feature Viewer

pLDDT pTM Quality
89.17 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map