F315060

General Info

Members Datasets Scaffolds Average Seq Length
206 132 412 166

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10463806|Ga0114129_104638061
Length 198
Sequence MHRRPNADPILEMGSSLSGHGGVAFRAVYPGGFVPIPLRLNVNNSPRQHDVEPRLLLVHYLREHLGLTGTHVGCETGICGACTVLIDGKAVKSCTMFAVQADGSSVTTIEGIAANGNLHPVQQGFWDCHGLQCGFCTPGMIIASIQLLQDHPSPSREEIAHGLHGNLCRCTGYSHIIDAVAQAALRQAQGERNEVARG

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
81 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
94 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
95 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.66
Metatranscriptomes 5.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.4
Rhizosphere 95.63
Stem 0
Stem Tuber 0
Unclassified 7.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10463806 3300009147 Bacteria 1660
2 JGI25404J52841_10033483 3300003659 Bacteria 1095
3 Ga0058861_11664140 3300004800 Bacteria 4604
4 Ga0058862_12863882 3300004803 Bacteria 4820
5 Ga0065704_10206312 3300005289 Bacteria 1126
6 Ga0065715_10686748 3300005293 Unclassified 660
7 Ga0065707_10005281 3300005295 Bacteria 3843
8 Ga0065707_10313266 3300005295 Bacteria 958
9 Ga0070680_100676262 3300005336 Bacteria 888
10 Ga0070691_10029184 3300005341 Bacteria 2580
11 Ga0070661_100001566 3300005344 Bacteria 15900
12 Ga0070667_101194718 3300005367 Bacteria 712
13 Ga0070709_10584671 3300005434 Bacteria 858
14 Ga0070713_100407194 3300005436 Bacteria 1271
15 Ga0070711_100517248 3300005439 Bacteria 986
16 Ga0070700_100705444 3300005441 Bacteria 803
17 Ga0070700_101227345 3300005441 Bacteria 627
18 Ga0070694_100126128 3300005444 Bacteria 1843
19 Ga0070708_100331718 3300005445 Bacteria 1433
20 Ga0070708_100965080 3300005445 Bacteria 800
21 Ga0070708_101870777 3300005445 Bacteria 557
22 Ga0070681_11308610 3300005458 Bacteria 648
23 Ga0070706_100281254 3300005467 Bacteria 1553
24 Ga0070707_100380441 3300005468 Bacteria 1371
25 Ga0070707_100752056 3300005468 Bacteria 938
26 Ga0070698_100186538 3300005471 Bacteria 2012
27 Ga0070698_101418585 3300005471 Bacteria 645
28 Ga0070699_100005807 3300005518 Bacteria 10796
29 Ga0070699_100535074 3300005518 Bacteria 1066
30 Ga0070679_100006961 3300005530 Bacteria 10552
31 Ga0070679_100656097 3300005530 Bacteria 992
32 Ga0070679_101236412 3300005530 Bacteria 692
33 Ga0070697_100167494 3300005536 Bacteria 1858
34 Ga0070696_100200341 3300005546 Bacteria 1490
35 Ga0070704_100314843 3300005549 Bacteria 1309
36 Ga0070664_100013096 3300005564 Bacteria 6749
37 Ga0068857_100012689 3300005577 Bacteria 7343
38 Ga0068857_100018239 3300005577 Bacteria 6155
39 Ga0068859_100081325 3300005617 Bacteria 3282
40 Ga0068866_10699496 3300005718 Unclassified 695
41 Ga0068861_100228289 3300005719 Bacteria 1577
42 Ga0081540_1000110 3300005983 Bacteria 88536
43 Ga0070716_100612087 3300006173 Bacteria 821
44 Ga0075428_100038163 3300006844 Bacteria 5286
45 Ga0075428_100161717 3300006844 Bacteria 2430
46 Ga0075428_100414657 3300006844 Bacteria 1443
47 Ga0075430_100275685 3300006846 Bacteria 1392
48 Ga0075430_100838317 3300006846 Bacteria 758
49 Ga0075430_101035482 3300006846 Bacteria 676
50 Ga0075431_100007965 3300006847 Bacteria 10567
51 Ga0075433_10060912 3300006852 Bacteria 3306
52 Ga0075433_10576744 3300006852 Bacteria 988
53 Ga0075433_10810299 3300006852 Bacteria 818
54 Ga0075434_100003265 3300006871 Bacteria 14496
55 Ga0075434_100008723 3300006871 Bacteria 9434
56 Ga0075434_100214236 3300006871 Bacteria 1946
57 Ga0075434_100230878 3300006871 Bacteria 1870
58 Ga0075434_100524681 3300006871 Bacteria 1205
59 Ga0075436_100000657 3300006914 Bacteria 22779
60 Ga0075436_100041399 3300006914 Bacteria 3179
61 Ga0075436_100132631 3300006914 Bacteria 1747
62 Ga0075436_100180412 3300006914 Bacteria 1492
63 Ga0075436_100595003 3300006914 Bacteria 814
64 Ga0097620_100081324 3300006931 Bacteria 3282
65 Ga0075435_100000483 3300007076 Bacteria 24195
66 Ga0075435_100001799 3300007076 Bacteria 13941
67 Ga0075435_100031577 3300007076 Bacteria 4174
68 Ga0075435_100059143 3300007076 Bacteria 3106
69 Ga0075435_100180730 3300007076 Bacteria 1783
70 Ga0075435_100465222 3300007076 Unclassified 1091
71 Ga0075435_100525245 3300007076 Bacteria 1024
72 Ga0105240_10000819 3300009093 Bacteria 56527
73 Ga0111539_10115917 3300009094 Bacteria 3141
74 Ga0111539_10193138 3300009094 Bacteria 2375
75 Ga0111539_10395207 3300009094 Bacteria 1610
76 Ga0111539_10799812 3300009094 Bacteria 1097
77 Ga0114129_10000150 3300009147 Bacteria 73834
78 Ga0114129_10007300 3300009147 Bacteria 15735
79 Ga0114129_10087574 3300009147 Bacteria 4318
80 Ga0114129_10239620 3300009147 Bacteria 2439
81 Ga0114129_10327301 3300009147 Bacteria 2036
82 Ga0105242_12044738 3300009176 Bacteria 616
83 Ga0105248_10006344 3300009177 Bacteria 12969
84 Ga0105248_11066199 3300009177 Bacteria 913
85 Ga0105238_10001241 3300009551 Bacteria 25677
86 Ga0105028_100459 3300009993 Bacteria 4363
87 Ga0105239_10004077 3300010375 Bacteria 17598
88 Ga0157373_10430498 3300013100 Bacteria 948
89 Ga0157370_10007829 3300013104 Bacteria 11578
90 Ga0157374_10092362 3300013296 Bacteria 2888
91 Ga0157374_10212760 3300013296 Bacteria 1896
92 Ga0157378_10595817 3300013297 Bacteria 1116
93 Ga0163162_10090885 3300013306 Bacteria 3135
94 Ga0163162_10179038 3300013306 Bacteria 2246
95 Ga0157372_10054649 3300013307 Bacteria 4456
96 Ga0157375_12021730 3300013308 Bacteria 685
97 Ga0197907_11229785 3300020069 Bacteria 3919
98 Ga0206356_10292553 3300020070 Bacteria 3966
99 Ga0206349_1624127 3300020075 Bacteria 1141
100 Ga0206351_10010260 3300020077 Bacteria 3878
101 Ga0206352_10272802 3300020078 Bacteria 4383
102 Ga0206350_11282481 3300020080 Bacteria 4630
103 Ga0206354_10326247 3300020081 Bacteria 4463
104 Ga0206353_10689472 3300020082 Bacteria 3857
105 Ga0224712_10003792 3300022467 Bacteria 3985
106 Ga0209759_1020296 3300025256 Bacteria 1546
107 Ga0207645_10875652 3300025907 Bacteria 610
108 Ga0207643_10586559 3300025908 Bacteria 717
109 Ga0207695_10000727 3300025913 Bacteria 63968
110 Ga0207660_10258419 3300025917 Unclassified 1377
111 Ga0207649_10006149 3300025920 Bacteria 6517
112 Ga0207652_10050165 3300025921 Bacteria 3575
113 Ga0207652_10844085 3300025921 Bacteria 811
114 Ga0207646_10007737 3300025922 Bacteria 10876
115 Ga0207646_10265645 3300025922 Bacteria 1551
116 Ga0207711_10003629 3300025941 Bacteria 13347
117 Ga0207661_10117972 3300025944 Bacteria 2255
118 Ga0207679_10000928 3300025945 Bacteria 18723
119 Ga0207708_10132124 3300026075 Bacteria 1952
120 Ga0207708_10336709 3300026075 Bacteria 1235
121 Ga0207674_10010826 3300026116 Bacteria 10283
122 Ga0207674_10021096 3300026116 Bacteria 7024
123 Ga0207428_10042029 3300027907 Bacteria 3698
124 Ga0268266_10176456 3300028379 Bacteria 1943
125 Ga0373941_0034165 3300035115 Bacteria 1532
126 Ga0373931_0059433 3300035691 Bacteria 2056
127 Ga0436362_0299240 3300039453 Bacteria 1187
128 Ga0439458_0067524 3300042157 Bacteria 899
129 Ga0453683_0074304 3300044673 Bacteria 2128
130 Ga0451576_0151368 3300045051 Bacteria 2420
131 Ga0466967_0223421 3300045976 Bacteria 1791
132 Ga0495580_0035916 3300046472 Bacteria 3562
133 Ga0495586_0002840 3300046535 Bacteria 9353
134 Ga0495659_0015141 3300046664 Bacteria 2533
135 Ga0496102_0092735 3300048905 Bacteria 2797
136 Ga0496102_1709493 3300048905 Bacteria 547
137 Ga0496103_0021001 3300048906 Bacteria 3927
138 Ga0496112_0032276 3300048915 Bacteria 5084
139 Ga0496112_0060779 3300048915 Bacteria 3724
140 Ga0496112_0077118 3300048915 Bacteria 3296
141 Ga0496113_1330858 3300048916 Unclassified 558
142 Ga0496121_0088072 3300048924 Bacteria 2435
143 Ga0501031_0012742 3300049568 Bacteria 5493
144 Ga0501032_0217521 3300049569 Archaea 1244
145 Ga0501033_0056941 3300049570 Unclassified 2889
146 Ga0501036_0215876 3300049572 Unclassified 1611
147 Ga0501038_0112656 3300049574 Archaea 2252
148 Ga0501039_0021826 3300049575 Bacteria 4912
149 Ga0501040_0055980 3300049576 Unclassified 2705
150 Ga0501041_0021268 3300049577 Bacteria 3887
151 Ga0501042_0018493 3300049578 Bacteria 4825
152 Ga0501043_0448084 3300049579 Archaea 970
153 Ga0501046_0034723 3300049580 Bacteria 4067
154 Ga0501048_0990926 3300049582 Archaea 604
155 Ga0501070_0808371 3300049586 Bacteria 736
156 Ga0501071_0017461 3300049587 Bacteria 4948
157 Ga0501071_0158212 3300049587 Bacteria 1692
158 Ga0501072_0025649 3300049588 Bacteria 4592
159 Ga0501073_0594240 3300049589 Bacteria 765
160 Ga0501074_0010305 3300049590 Bacteria 6784
161 Ga0501075_0073389 3300049591 Unclassified 2587
162 Ga0501075_0234144 3300049591 Bacteria 1400
163 Ga0501076_0011560 3300049592 Bacteria 6582
164 Ga0501077_0044632 3300049593 Unclassified 2815
165 Ga0501079_0118142 3300049741 Unclassified 2061
166 Ga0501080_0288891 3300049742 Unclassified 1489
167 Ga0501081_0257942 3300049743 Unclassified 1273
168 Ga0501081_0432153 3300049743 Bacteria 977
169 Ga0501083_0167364 3300049744 Bacteria 1437
170 Ga0501035_0616794 3300049822 Archaea 882
171 Ga0501045_0028518 3300049824 Bacteria 4027
172 nmdc:mga05p37_337329_c1 3300050507 Bacteria 1778
173 nmdc:mga05p37_39713_c1 3300050507 Bacteria 5778
174 nmdc:mga05p37_4590_c1 3300050507 Bacteria 16152
175 nmdc:mga09592_763007_c1 3300050508 Bacteria 820
176 nmdc:mga0qj67_1157923_c1 3300050509 Bacteria 603
177 nmdc:mga0qj67_253352_c1 3300050509 Bacteria 1428
178 nmdc:mga06r32_650054_c1 3300050510 Bacteria 1023
179 nmdc:mga08y16_213255_c1 3300050511 Bacteria 1999
180 nmdc:mga08y16_611599_c1 3300050511 Bacteria 1097
181 nmdc:mga0n895_218057_c1 3300050512 Bacteria 1937
182 nmdc:mga0n895_300862_c1 3300050512 Bacteria 1626
183 nmdc:mga0n895_555_c1 3300050512 Bacteria 25552
184 nmdc:mga0n895_8521_c1 3300050512 Bacteria 8884
185 nmdc:mga0n895_989932_c1 3300050512 Bacteria 822
186 nmdc:mga0n895_9936_c1 3300050512 Bacteria 8372
187 nmdc:mga0rr50_12471_c1 3300050513 Bacteria 5497
188 nmdc:mga0rr50_13_c1 3300050513 Bacteria 213605
189 nmdc:mga0rr50_184208_c1 3300050513 Bacteria 1708
190 nmdc:mga0rr50_197851_c1 3300050513 Unclassified 1650
191 nmdc:mga0rr50_404335_c1 3300050513 Bacteria 1154
192 nmdc:mga0rr50_472755_c1 3300050513 Bacteria 1064
193 nmdc:mga0rr50_672823_c1 3300050513 Bacteria 883
194 nmdc:mga08x19_10896_c1 3300050514 Bacteria 5468
195 nmdc:mga08x19_166336_c1 3300050514 Bacteria 1500
196 nmdc:mga08x19_182854_c1 3300050514 Bacteria 1432
197 nmdc:mga08x19_677301_c1 3300050514 Bacteria 732
198 nmdc:mga08x19_76626_c1 3300050514 Bacteria 2189
199 nmdc:mga08x19_97_c1 3300050514 Bacteria 77512
200 nmdc:mga0a205_12038_c1 3300050515 Bacteria 7990
201 nmdc:mga0a205_649613_c1 3300050515 Bacteria 906
202 nmdc:mga0a205_926950_c1 3300050515 Bacteria 718
203 Ga0501084_0011416 3300054114 Bacteria 7356
204 Ga0501082_0085022 3300060353 Unclassified 2728
205 Ga0501082_0215846 3300060353 Bacteria 1669
206 Ga0530510_0025116 3300061734 Bacteria 4259
207 Ga0114129_10463806
208 JGI25404J52841_10033483
209 Ga0058861_11664140
210 Ga0058862_12863882
211 Ga0065704_10206312
212 Ga0065715_10686748
213 Ga0065707_10005281
214 Ga0065707_10313266
215 Ga0070680_100676262
216 Ga0070691_10029184
217 Ga0070661_100001566
218 Ga0070667_101194718
219 Ga0070709_10584671
220 Ga0070713_100407194
221 Ga0070711_100517248
222 Ga0070700_100705444
223 Ga0070700_101227345
224 Ga0070694_100126128
225 Ga0070708_100331718
226 Ga0070708_100965080
227 Ga0070708_101870777
228 Ga0070681_11308610
229 Ga0070706_100281254
230 Ga0070707_100380441
231 Ga0070707_100752056
232 Ga0070698_100186538
233 Ga0070698_101418585
234 Ga0070699_100005807
235 Ga0070699_100535074
236 Ga0070679_100006961
237 Ga0070679_100656097
238 Ga0070679_101236412
239 Ga0070697_100167494
240 Ga0070696_100200341
241 Ga0070704_100314843
242 Ga0070664_100013096
243 Ga0068857_100012689
244 Ga0068857_100018239
245 Ga0068859_100081325
246 Ga0068866_10699496
247 Ga0068861_100228289
248 Ga0081540_1000110
249 Ga0070716_100612087
250 Ga0075428_100038163
251 Ga0075428_100161717
252 Ga0075428_100414657
253 Ga0075430_100275685
254 Ga0075430_100838317
255 Ga0075430_101035482
256 Ga0075431_100007965
257 Ga0075433_10060912
258 Ga0075433_10576744
259 Ga0075433_10810299
260 Ga0075434_100003265
261 Ga0075434_100008723
262 Ga0075434_100214236
263 Ga0075434_100230878
264 Ga0075434_100524681
265 Ga0075436_100000657
266 Ga0075436_100041399
267 Ga0075436_100132631
268 Ga0075436_100180412
269 Ga0075436_100595003
270 Ga0097620_100081324
271 Ga0075435_100000483
272 Ga0075435_100001799
273 Ga0075435_100031577
274 Ga0075435_100059143
275 Ga0075435_100180730
276 Ga0075435_100465222
277 Ga0075435_100525245
278 Ga0105240_10000819
279 Ga0111539_10115917
280 Ga0111539_10193138
281 Ga0111539_10395207
282 Ga0111539_10799812
283 Ga0114129_10000150
284 Ga0114129_10007300
285 Ga0114129_10087574
286 Ga0114129_10239620
287 Ga0114129_10327301
288 Ga0105242_12044738
289 Ga0105248_10006344
290 Ga0105248_11066199
291 Ga0105238_10001241
292 Ga0105028_100459
293 Ga0105239_10004077
294 Ga0157373_10430498
295 Ga0157370_10007829
296 Ga0157374_10092362
297 Ga0157374_10212760
298 Ga0157378_10595817
299 Ga0163162_10090885
300 Ga0163162_10179038
301 Ga0157372_10054649
302 Ga0157375_12021730
303 Ga0197907_11229785
304 Ga0206356_10292553
305 Ga0206349_1624127
306 Ga0206351_10010260
307 Ga0206352_10272802
308 Ga0206350_11282481
309 Ga0206354_10326247
310 Ga0206353_10689472
311 Ga0224712_10003792
312 Ga0209759_1020296
313 Ga0207645_10875652
314 Ga0207643_10586559
315 Ga0207695_10000727
316 Ga0207660_10258419
317 Ga0207649_10006149
318 Ga0207652_10050165
319 Ga0207652_10844085
320 Ga0207646_10007737
321 Ga0207646_10265645
322 Ga0207711_10003629
323 Ga0207661_10117972
324 Ga0207679_10000928
325 Ga0207708_10132124
326 Ga0207708_10336709
327 Ga0207674_10010826
328 Ga0207674_10021096
329 Ga0207428_10042029
330 Ga0268266_10176456
331 Ga0373941_0034165
332 Ga0373931_0059433
333 Ga0436362_0299240
334 Ga0439458_0067524
335 Ga0453683_0074304
336 Ga0451576_0151368
337 Ga0466967_0223421
338 Ga0495580_0035916
339 Ga0495586_0002840
340 Ga0495659_0015141
341 Ga0496102_0092735
342 Ga0496102_1709493
343 Ga0496103_0021001
344 Ga0496112_0032276
345 Ga0496112_0060779
346 Ga0496112_0077118
347 Ga0496113_1330858
348 Ga0496121_0088072
349 Ga0501031_0012742
350 Ga0501032_0217521
351 Ga0501033_0056941
352 Ga0501036_0215876
353 Ga0501038_0112656
354 Ga0501039_0021826
355 Ga0501040_0055980
356 Ga0501041_0021268
357 Ga0501042_0018493
358 Ga0501043_0448084
359 Ga0501046_0034723
360 Ga0501048_0990926
361 Ga0501070_0808371
362 Ga0501071_0017461
363 Ga0501071_0158212
364 Ga0501072_0025649
365 Ga0501073_0594240
366 Ga0501074_0010305
367 Ga0501075_0073389
368 Ga0501075_0234144
369 Ga0501076_0011560
370 Ga0501077_0044632
371 Ga0501079_0118142
372 Ga0501080_0288891
373 Ga0501081_0257942
374 Ga0501081_0432153
375 Ga0501083_0167364
376 Ga0501035_0616794
377 Ga0501045_0028518
378 nmdc:mga05p37_337329_c1
379 nmdc:mga05p37_39713_c1
380 nmdc:mga05p37_4590_c1
381 nmdc:mga09592_763007_c1
382 nmdc:mga0qj67_1157923_c1
383 nmdc:mga0qj67_253352_c1
384 nmdc:mga06r32_650054_c1
385 nmdc:mga08y16_213255_c1
386 nmdc:mga08y16_611599_c1
387 nmdc:mga0n895_218057_c1
388 nmdc:mga0n895_300862_c1
389 nmdc:mga0n895_555_c1
390 nmdc:mga0n895_8521_c1
391 nmdc:mga0n895_989932_c1
392 nmdc:mga0n895_9936_c1
393 nmdc:mga0rr50_12471_c1
394 nmdc:mga0rr50_13_c1
395 nmdc:mga0rr50_184208_c1
396 nmdc:mga0rr50_197851_c1
397 nmdc:mga0rr50_404335_c1
398 nmdc:mga0rr50_472755_c1
399 nmdc:mga0rr50_672823_c1
400 nmdc:mga08x19_10896_c1
401 nmdc:mga08x19_166336_c1
402 nmdc:mga08x19_182854_c1
403 nmdc:mga08x19_677301_c1
404 nmdc:mga08x19_76626_c1
405 nmdc:mga08x19_97_c1
406 nmdc:mga0a205_12038_c1
407 nmdc:mga0a205_649613_c1
408 nmdc:mga0a205_926950_c1
409 Ga0501084_0011416
410 Ga0501082_0085022
411 Ga0501082_0215846
412 Ga0530510_0025116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

108

181

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

40

114

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9853 1 155
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9847 1 157
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.979 1 155
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9789 3 153
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9763 2 155
ID Description Score Start End Superfamily
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9971 1 76 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9867 2 76 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.981 2 76 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.98 2 74 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9716 1 76 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A1I2ADT5-F1-model_v4 Carbon-monoxide dehydrogenase small subunit 0.991 2 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A1E3RY14-F1-model_v4 Carbon monoxide dehydrogenase 0.9909 2 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A1I3KG13-F1-model_v4 Carbon-monoxide dehydrogenase small subunit 0.9904 2 156 GO:0016491
GO:0046872
GO:0051537
AF-A0A538QY28-F1-model_v4 (2Fe-2S)-binding protein 0.9903 2 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A1Q7FST2-F1-model_v4 Carbon monoxide dehydrogenase 0.9902 2 154 GO:0016491
GO:0046872
GO:0051537

Map