F314972

General Info

Members Datasets Scaffolds Average Seq Length
206 139 412 241

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100113648|Ga0075431_1001136482
Length 270
Sequence MAYAVEVDHLTVKRGSRTVLDGISCGVAAGKVTGLLGPSGSGKTTLMRAIVGVQKVRSGRIDVLGLPAGSAPLRRRVGYVTQSPSIYRDLTVRENARYFAALYGTGYRAADQAVADVGLSDTAGQLVSTLSGGQLARASLACALLAHPDILILDEPTVGQDPVLRQELWQRFHELADSGTTLLVSSHVMDEANRCDRLLLLREGRLFADEIPQELLRLTETDNLEDAFLQLIISQRDHARSDAGPGEQAAAARSGSSVRPGAGSDLGGAA

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
104 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
105 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
106 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
107 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
108 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
131 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
132 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
133 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
135 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
136 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
137 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
138 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
139 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.15
Metatranscriptomes 2.43
Isolates 2.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 3.88
Rhizosphere 86.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100113648 3300006847 Bacteria 2795
2 Ga0070658_10056048 3300005327 Bacteria 3202
3 Ga0070683_100046817 3300005329 Bacteria 3996
4 Ga0070683_100118565 3300005329 Bacteria 2499
5 Ga0068869_100005316 3300005334 Bacteria 8093
6 Ga0068869_100611252 3300005334 Bacteria 922
7 Ga0068868_100253347 3300005338 Bacteria 1482
8 Ga0070668_100239027 3300005347 Bacteria 1504
9 Ga0070659_100020106 3300005366 Bacteria 5069
10 Ga0070667_100100276 3300005367 Bacteria 2501
11 Ga0070701_10019821 3300005438 Bacteria 3182
12 Ga0070700_100327515 3300005441 Bacteria 1128
13 Ga0070663_100005905 3300005455 Bacteria 7326
14 Ga0070678_100026449 3300005456 Bacteria 3923
15 Ga0070662_100000928 3300005457 Bacteria 17935
16 Ga0070679_100095929 3300005530 Bacteria 2953
17 Ga0070684_100018949 3300005535 Bacteria 5683
18 Ga0070684_100068973 3300005535 Bacteria 3109
19 Ga0070672_100212020 3300005543 Bacteria 1622
20 Ga0070664_100001072 3300005564 Bacteria 21527
21 Ga0070664_100050077 3300005564 Bacteria 3534
22 Ga0070664_100067322 3300005564 Bacteria 3061
23 Ga0068857_100013768 3300005577 Bacteria 7048
24 Ga0068857_100321501 3300005577 Bacteria 1429
25 Ga0068852_100221578 3300005616 Bacteria 1799
26 Ga0068852_100283421 3300005616 Bacteria 1598
27 Ga0068864_100055702 3300005618 Bacteria 3415
28 Ga0068863_100012638 3300005841 Bacteria 8145
29 Ga0068863_100025576 3300005841 Bacteria 5628
30 Ga0068863_100066240 3300005841 Bacteria 3417
31 Ga0068858_100132595 3300005842 Bacteria 2337
32 Ga0068858_100366232 3300005842 Bacteria 1382
33 Ga0068860_100165615 3300005843 Bacteria 2134
34 Ga0068862_100046752 3300005844 Bacteria 3692
35 Ga0081455_10000177 3300005937 Bacteria 79964
36 Ga0081455_10005181 3300005937 Bacteria 14348
37 Ga0081538_10000308 3300005981 Bacteria 56278
38 Ga0081539_10000406 3300005985 Bacteria 91786
39 Ga0070717_10237374 3300006028 Bacteria 1607
40 Ga0070712_100156665 3300006175 Bacteria 1755
41 Ga0068871_100588282 3300006358 Bacteria 1011
42 Ga0075428_100002061 3300006844 Bacteria 21674
43 Ga0075428_100004327 3300006844 Bacteria 15653
44 Ga0075430_100001865 3300006846 Bacteria 17238
45 Ga0075430_100011081 3300006846 Bacteria 7641
46 Ga0075430_100018990 3300006846 Bacteria 5849
47 Ga0075431_100002872 3300006847 Bacteria 16666
48 Ga0075431_100031133 3300006847 Bacteria 5495
49 Ga0075431_100059105 3300006847 Bacteria 3957
50 Ga0075431_100365241 3300006847 Bacteria 1449
51 Ga0075429_100002005 3300006880 Bacteria 16916
52 Ga0075429_100017493 3300006880 Bacteria 6198
53 Ga0075429_100029536 3300006880 Bacteria 4761
54 Ga0097620_100021825 3300006931 Bacteria 6421
55 Ga0111539_10038729 3300009094 Bacteria 5752
56 Ga0111539_10039963 3300009094 Bacteria 5649
57 Ga0105245_10017129 3300009098 Bacteria 6323
58 Ga0105245_10363581 3300009098 Bacteria 1437
59 Ga0105247_10078457 3300009101 Bacteria 2077
60 Ga0114129_10000059 3300009147 Bacteria 98984
61 Ga0114129_10011827 3300009147 Bacteria 12413
62 Ga0114129_10026671 3300009147 Bacteria 8183
63 Ga0114129_10160048 3300009147 Bacteria 3076
64 Ga0114129_10675046 3300009147 Bacteria 1331
65 Ga0105241_10515776 3300009174 Bacteria 1068
66 Ga0105248_10176618 3300009177 Bacteria 2407
67 Ga0105028_103755 3300009993 Bacteria 1586
68 Ga0157369_10121434 3300013105 Bacteria 2772
69 Ga0157378_10502165 3300013297 Bacteria 1212
70 Ga0157375_10413940 3300013308 Bacteria 1514
71 Ga0163163_10155683 3300014325 Bacteria 2330
72 Ga0182008_10148490 3300014497 Bacteria 1175
73 Ga0157377_10003037 3300014745 Bacteria 7524
74 Ga0157379_10024616 3300014968 Bacteria 5344
75 Ga0157379_10285036 3300014968 Bacteria 1503
76 Ga0157376_10227972 3300014969 Bacteria 1729
77 Ga0206356_10399468 3300020070 Bacteria 2502
78 Ga0206350_11260411 3300020080 Bacteria 2607
79 Ga0206353_11505419 3300020082 Bacteria 1045
80 Ga0213876_10001032 3300021384 Bacteria 17972
81 Ga0224712_10000347 3300022467 Bacteria 8882
82 Ga0224712_10045432 3300022467 Bacteria 1680
83 Ga0207710_10163795 3300025900 Bacteria 1084
84 Ga0207688_10221770 3300025901 Bacteria 1139
85 Ga0207705_10105516 3300025909 Bacteria 2077
86 Ga0207654_10314701 3300025911 Bacteria 1068
87 Ga0207707_10640841 3300025912 Bacteria 896
88 Ga0207693_10180385 3300025915 Bacteria 1661
89 Ga0207660_10386759 3300025917 Bacteria 1125
90 Ga0207657_10070607 3300025919 Bacteria 2960
91 Ga0207649_10483319 3300025920 Bacteria 939
92 Ga0207652_10176072 3300025921 Bacteria 1921
93 Ga0207659_10017505 3300025926 Bacteria 4682
94 Ga0207687_10089872 3300025927 Bacteria 2237
95 Ga0207700_10090440 3300025928 Bacteria 2416
96 Ga0207706_10007391 3300025933 Bacteria 10156
97 Ga0207669_10632890 3300025937 Bacteria 873
98 Ga0207691_10195667 3300025940 Bacteria 1762
99 Ga0207711_10114035 3300025941 Bacteria 2407
100 Ga0207711_10265077 3300025941 Bacteria 1580
101 Ga0207689_10006999 3300025942 Bacteria 9916
102 Ga0207689_10563889 3300025942 Bacteria 957
103 Ga0207661_10017551 3300025944 Bacteria 5299
104 Ga0207661_10019920 3300025944 Bacteria 5007
105 Ga0207661_10056721 3300025944 Bacteria 3145
106 Ga0207661_10710962 3300025944 Bacteria 924
107 Ga0207679_10025195 3300025945 Bacteria 4088
108 Ga0207679_10039664 3300025945 Bacteria 3365
109 Ga0207668_10126266 3300025972 Bacteria 1946
110 Ga0207668_10128187 3300025972 Bacteria 1933
111 Ga0207677_10064570 3300026023 Bacteria 2550
112 Ga0207703_11049140 3300026035 Bacteria 782
113 Ga0207678_10004580 3300026067 Bacteria 12434
114 Ga0207708_10041977 3300026075 Bacteria 3487
115 Ga0207641_10044096 3300026088 Bacteria 3749
116 Ga0207641_10281290 3300026088 Bacteria 1565
117 Ga0207641_10431380 3300026088 Bacteria 1271
118 Ga0207641_10632129 3300026088 Bacteria 1050
119 Ga0207676_10195833 3300026095 Bacteria 1782
120 Ga0207676_10793889 3300026095 Bacteria 923
121 Ga0207674_10006060 3300026116 Bacteria 14302
122 Ga0207674_10020493 3300026116 Bacteria 7142
123 Ga0207674_10289383 3300026116 Bacteria 1587
124 Ga0207683_10199578 3300026121 Bacteria 1818
125 Ga0207428_10025445 3300027907 Bacteria 4954
126 Ga0207428_10073014 3300027907 Bacteria 2693
127 Ga0268266_10036141 3300028379 Bacteria 4203
128 Ga0268265_10069034 3300028380 Bacteria 2743
129 Ga0268264_10144854 3300028381 Bacteria 2123
130 Ga0268264_10345085 3300028381 Bacteria 1415
131 Ga0307515_10103034 3300028794 Bacteria 3426
132 Ga0307513_10015065 3300031456 Bacteria 9384
133 Ga0307513_10073619 3300031456 Bacteria 3556
134 Ga0307508_10304953 3300031616 Bacteria 1185
135 Ga0307516_10025467 3300031730 Bacteria 6023
136 Ga0307516_10365718 3300031730 Bacteria 1106
137 Ga0307416_100287346 3300032002 Bacteria 1626
138 Ga0307416_100530855 3300032002 Bacteria 1247
139 Ga0307411_10599207 3300032005 Bacteria 947
140 Ga0307415_100039632 3300032126 Bacteria 3116
141 Ga0307415_100202381 3300032126 Bacteria 1577
142 Ga0307415_100230642 3300032126 Bacteria 1491
143 Ga0373951_0000257 3300035091 Bacteria 17381
144 Ga0395899_0040288 3300037312 Bacteria 3494
145 Ga0395899_0578891 3300037312 Bacteria 718
146 Ga0395900_0086653 3300037418 Bacteria 3218
147 Ga0395900_0572134 3300037418 Bacteria 1072
148 Ga0395898_0601285 3300037466 Bacteria 1042
149 Ga0395905_0093224 3300037471 Bacteria 2824
150 Ga0395905_0130487 3300037471 Bacteria 2364
151 Ga0395901_0143107 3300038443 Bacteria 2513
152 Ga0395901_0194769 3300038443 Bacteria 2125
153 Ga0436365_1807826 3300039437 Bacteria 19343
154 Ga0451791_0049799 3300041451 Bacteria 4892
155 Ga0451793_0260907 3300041452 Bacteria 7437
156 Ga0451797_0673777 3300041453 Bacteria 5386
157 Ga0451795_0177699 3300041456 Bacteria 1491
158 Ga0451802_2112384 3300041460 Bacteria 1286
159 Ga0451833_0783891 3300041491 Bacteria 1142
160 Ga0451849_0244407 3300041505 Bacteria 1644
161 Ga0451853_3130316 3300041512 Bacteria 1034
162 Ga0466957_0293641 3300044842 Bacteria 1091
163 Ga0466967_0005701 3300045976 Bacteria 8684
164 Ga0466967_0054776 3300045976 Bacteria 3512
165 Ga0495629_0224854 3300046459 Bacteria 1294
166 Ga0495581_0370509 3300047315 Bacteria 836
167 Ga0496108_0096847 3300048911 Bacteria 2514
168 Ga0496112_0028961 3300048915 Bacteria 5352
169 Ga0496112_0156092 3300048915 Bacteria 2249
170 Ga0501040_0116095 3300049576 Bacteria 1875
171 Ga0501041_0192584 3300049577 Bacteria 1277
172 Ga0501046_0199299 3300049580 Bacteria 1490
173 Ga0501047_0075914 3300049581 Bacteria 3234
174 Ga0501075_0179415 3300049591 Bacteria 1616
175 Ga0501044_0048231 3300049823 Bacteria 4401
176 nmdc:mga05p37_1070_c1 3300050507 Bacteria 31338
177 nmdc:mga05p37_187820_c1 3300050507 Bacteria 2511
178 nmdc:mga05p37_209620_c1 3300050507 Bacteria 2356
179 nmdc:mga05p37_699160_c1 3300050507 Bacteria 1127
180 nmdc:mga05p37_947_c1 3300050507 Bacteria 32746
181 nmdc:mga09592_1062_c1 3300050508 Bacteria 21798
182 nmdc:mga09592_57442_c1 3300050508 Bacteria 3289
183 nmdc:mga0qj67_153045_c1 3300050509 Bacteria 1871
184 nmdc:mga0qj67_31_c1 3300050509 Bacteria 21553
185 nmdc:mga0qj67_400571_c1 3300050509 Bacteria 1107
186 nmdc:mga0qj67_4958_c1 3300050509 Bacteria 9675
187 nmdc:mga0qj67_63196_c1 3300050509 Bacteria 2944
188 nmdc:mga06r32_10271_c1 3300050510 Bacteria 8447
189 nmdc:mga06r32_144468_c1 3300050510 Bacteria 2356
190 nmdc:mga06r32_19_c1 3300050510 Bacteria 98901
191 nmdc:mga06r32_56_c1 3300050510 Bacteria 71167
192 nmdc:mga08y16_10639_c1 3300050511 Bacteria 9655
193 nmdc:mga08y16_10771_c1 3300050511 Bacteria 9597
194 nmdc:mga0n895_799191_c1 3300050512 Bacteria 934
195 nmdc:mga0a205_41678_c2 3300050515 Bacteria 3210
196 Ga0495619_0047246 3300053085 Bacteria 2834
197 Ga0500646_0000174 3300053090 Bacteria 19152
198 Ga0500583_0012149 3300053092 Bacteria 3274
199 Ga0500579_190255 3300053143 Bacteria 784
200 Ga0500588_0000435 3300053146 Bacteria 6556
201 Ga0530510_0377556 3300061734 Bacteria 1067
202 2644525073 2643221694 Bacteria 4392972
203 2644669161 2643221722 Bacteria 4247614
204 2676483609 2675903059 Bacteria 8644972
205 2861520965 2861520306 Bacteria 8348283
206 2868089523 2868088558 Bacteria 7609351
207 Ga0075431_100113648
208 Ga0070658_10056048
209 Ga0070683_100046817
210 Ga0070683_100118565
211 Ga0068869_100005316
212 Ga0068869_100611252
213 Ga0068868_100253347
214 Ga0070668_100239027
215 Ga0070659_100020106
216 Ga0070667_100100276
217 Ga0070701_10019821
218 Ga0070700_100327515
219 Ga0070663_100005905
220 Ga0070678_100026449
221 Ga0070662_100000928
222 Ga0070679_100095929
223 Ga0070684_100018949
224 Ga0070684_100068973
225 Ga0070672_100212020
226 Ga0070664_100001072
227 Ga0070664_100050077
228 Ga0070664_100067322
229 Ga0068857_100013768
230 Ga0068857_100321501
231 Ga0068852_100221578
232 Ga0068852_100283421
233 Ga0068864_100055702
234 Ga0068863_100012638
235 Ga0068863_100025576
236 Ga0068863_100066240
237 Ga0068858_100132595
238 Ga0068858_100366232
239 Ga0068860_100165615
240 Ga0068862_100046752
241 Ga0081455_10000177
242 Ga0081455_10005181
243 Ga0081538_10000308
244 Ga0081539_10000406
245 Ga0070717_10237374
246 Ga0070712_100156665
247 Ga0068871_100588282
248 Ga0075428_100002061
249 Ga0075428_100004327
250 Ga0075430_100001865
251 Ga0075430_100011081
252 Ga0075430_100018990
253 Ga0075431_100002872
254 Ga0075431_100031133
255 Ga0075431_100059105
256 Ga0075431_100365241
257 Ga0075429_100002005
258 Ga0075429_100017493
259 Ga0075429_100029536
260 Ga0097620_100021825
261 Ga0111539_10038729
262 Ga0111539_10039963
263 Ga0105245_10017129
264 Ga0105245_10363581
265 Ga0105247_10078457
266 Ga0114129_10000059
267 Ga0114129_10011827
268 Ga0114129_10026671
269 Ga0114129_10160048
270 Ga0114129_10675046
271 Ga0105241_10515776
272 Ga0105248_10176618
273 Ga0105028_103755
274 Ga0157369_10121434
275 Ga0157378_10502165
276 Ga0157375_10413940
277 Ga0163163_10155683
278 Ga0182008_10148490
279 Ga0157377_10003037
280 Ga0157379_10024616
281 Ga0157379_10285036
282 Ga0157376_10227972
283 Ga0206356_10399468
284 Ga0206350_11260411
285 Ga0206353_11505419
286 Ga0213876_10001032
287 Ga0224712_10000347
288 Ga0224712_10045432
289 Ga0207710_10163795
290 Ga0207688_10221770
291 Ga0207705_10105516
292 Ga0207654_10314701
293 Ga0207707_10640841
294 Ga0207693_10180385
295 Ga0207660_10386759
296 Ga0207657_10070607
297 Ga0207649_10483319
298 Ga0207652_10176072
299 Ga0207659_10017505
300 Ga0207687_10089872
301 Ga0207700_10090440
302 Ga0207706_10007391
303 Ga0207669_10632890
304 Ga0207691_10195667
305 Ga0207711_10114035
306 Ga0207711_10265077
307 Ga0207689_10006999
308 Ga0207689_10563889
309 Ga0207661_10017551
310 Ga0207661_10019920
311 Ga0207661_10056721
312 Ga0207661_10710962
313 Ga0207679_10025195
314 Ga0207679_10039664
315 Ga0207668_10126266
316 Ga0207668_10128187
317 Ga0207677_10064570
318 Ga0207703_11049140
319 Ga0207678_10004580
320 Ga0207708_10041977
321 Ga0207641_10044096
322 Ga0207641_10281290
323 Ga0207641_10431380
324 Ga0207641_10632129
325 Ga0207676_10195833
326 Ga0207676_10793889
327 Ga0207674_10006060
328 Ga0207674_10020493
329 Ga0207674_10289383
330 Ga0207683_10199578
331 Ga0207428_10025445
332 Ga0207428_10073014
333 Ga0268266_10036141
334 Ga0268265_10069034
335 Ga0268264_10144854
336 Ga0268264_10345085
337 Ga0307515_10103034
338 Ga0307513_10015065
339 Ga0307513_10073619
340 Ga0307508_10304953
341 Ga0307516_10025467
342 Ga0307516_10365718
343 Ga0307416_100287346
344 Ga0307416_100530855
345 Ga0307411_10599207
346 Ga0307415_100039632
347 Ga0307415_100202381
348 Ga0307415_100230642
349 Ga0373951_0000257
350 Ga0395899_0040288
351 Ga0395899_0578891
352 Ga0395900_0086653
353 Ga0395900_0572134
354 Ga0395898_0601285
355 Ga0395905_0093224
356 Ga0395905_0130487
357 Ga0395901_0143107
358 Ga0395901_0194769
359 Ga0436365_1807826
360 Ga0451791_0049799
361 Ga0451793_0260907
362 Ga0451797_0673777
363 Ga0451795_0177699
364 Ga0451802_2112384
365 Ga0451833_0783891
366 Ga0451849_0244407
367 Ga0451853_3130316
368 Ga0466957_0293641
369 Ga0466967_0005701
370 Ga0466967_0054776
371 Ga0495629_0224854
372 Ga0495581_0370509
373 Ga0496108_0096847
374 Ga0496112_0028961
375 Ga0496112_0156092
376 Ga0501040_0116095
377 Ga0501041_0192584
378 Ga0501046_0199299
379 Ga0501047_0075914
380 Ga0501075_0179415
381 Ga0501044_0048231
382 nmdc:mga05p37_1070_c1
383 nmdc:mga05p37_187820_c1
384 nmdc:mga05p37_209620_c1
385 nmdc:mga05p37_699160_c1
386 nmdc:mga05p37_947_c1
387 nmdc:mga09592_1062_c1
388 nmdc:mga09592_57442_c1
389 nmdc:mga0qj67_153045_c1
390 nmdc:mga0qj67_31_c1
391 nmdc:mga0qj67_400571_c1
392 nmdc:mga0qj67_4958_c1
393 nmdc:mga0qj67_63196_c1
394 nmdc:mga06r32_10271_c1
395 nmdc:mga06r32_144468_c1
396 nmdc:mga06r32_19_c1
397 nmdc:mga06r32_56_c1
398 nmdc:mga08y16_10639_c1
399 nmdc:mga08y16_10771_c1
400 nmdc:mga0n895_799191_c1
401 nmdc:mga0a205_41678_c2
402 Ga0495619_0047246
403 Ga0500646_0000174
404 Ga0500583_0012149
405 Ga0500579_190255
406 Ga0500588_0000435
407 Ga0530510_0377556
408 2644525073
409 2644669161
410 2676483609
411 2861520965
412 2868089523

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

20

158

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9437 1 219
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9412 1 220
6xgz-assembly3.cif.gz_E crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.9408 1 217
7lkz-assembly1.cif.gz_A structure of atp-bound human abca4 0.9388 3 219
6xgz-assembly4.cif.gz_G crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.9366 1 221
ID Description Score Start End Superfamily
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9838 2 238 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9636 2 238 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9471 3 225 3.40.50.300
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.946 2 237 3.40.50.300
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9454 2 219 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7C6ZR21-F1-model_v4 ABC transporter ATP-binding protein 0.9603 1 221 GO:0005524
GO:0016887
AF-A0A075HQM6-F1-model_v4 ABC transporter-like protein (ABC-2.AB.A) 0.9537 3 220 GO:0005524
GO:0016887
AF-A0A4Y8LB39-F1-model_v4 ABC transporter ATP-binding protein 0.9498 1 220 GO:0005524
GO:0016887
AF-Q80VS6-F1-model_v4 Abca4 protein 0.9494 70 217 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A6G2VCI4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9483 3 219 GO:0005524
GO:0016887

Map