F314933

General Info

Members Datasets Scaffolds Average Seq Length
206 150 206 472

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10005759|Ga0075365_100057592
Length 496
Sequence MSDVLELTAAQALERISAGEISADEYFDAYAARAAADDLGAYLWRAEAGSPNGAGDGPLSRAPIAVKDIFCTEGIETTAGSRILEGYRPPYTATAVRRLSEAGARILGKTNMDEFAMGSSNENSGYGPVRNPWDPERVPGGSSGXXAAAVAGRLAPWAIGTDTGGSIRQPASLCGVVGLKPTYGAISRYGMIAFASSLDQCGPLTRDVTDAAILMRAMEGRDRCDSTSVGIDGGVSLPSRTDLKGLRFGVPRELTADAQGIEAGVTEVFERAVDRIRDLGAEVDECELPHSSHGISAYYVLAPAEASANLARYDGVRYGMRSAAAADAEGGLGDGIAPAEADLVSMYERTRAAGFGPEVKRRIMLGTYALSSGYYEAYYGRAQRVRTKIAQDFAAAFERFDYLVTPTSPTVAFKLGARAENPLAMYMSDYCTVPMSLAGVPAISIPGGLAAPDDGGPELPVGLQIVAPAFGESGLLDAAHAIEGAIGFDSAPGSRS

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
73 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
86 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
91 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
107 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.25
Nodule 0
Rhizoplane 11.65
Rhizosphere 79.13
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000510 3300001977 Bacteria 5825
2 Ga0070658_10007843 3300005327 Bacteria 8600
3 Ga0070683_100046280 3300005329 Bacteria 4019
4 Ga0070670_100007053 3300005331 Bacteria 9526
5 Ga0070682_100025786 3300005337 Bacteria 3512
6 Ga0068868_100024807 3300005338 Bacteria 4552
7 Ga0070660_100014786 3300005339 Bacteria 5631
8 Ga0070689_100033735 3300005340 Bacteria 3902
9 Ga0070675_100016563 3300005354 Bacteria 5852
10 Ga0070674_100000012 3300005356 Bacteria 130773
11 Ga0070674_100011717 3300005356 Bacteria 5348
12 Ga0070674_100037568 3300005356 Bacteria 3258
13 Ga0070674_100091516 3300005356 Bacteria 2197
14 Ga0070673_100164511 3300005364 Bacteria 1889
15 Ga0070659_100130031 3300005366 Bacteria 2044
16 Ga0070667_100006662 3300005367 Bacteria 9601
17 Ga0070711_100011956 3300005439 Bacteria 5406
18 Ga0070700_100006066 3300005441 Bacteria 6434
19 Ga0070679_100000225 3300005530 Bacteria 46317
20 Ga0070684_100021470 3300005535 Bacteria 5373
21 Ga0068853_100011898 3300005539 Bacteria 7077
22 Ga0070686_100011276 3300005544 Bacteria 5065
23 Ga0070665_100008226 3300005548 Bacteria 10559
24 Ga0070704_100003568 3300005549 Bacteria 8942
25 Ga0070664_100038455 3300005564 Bacteria 4027
26 Ga0070702_100023606 3300005615 Bacteria 3271
27 Ga0068864_100000015 3300005618 Bacteria 303368
28 Ga0068866_10000062 3300005718 Bacteria 42082
29 Ga0068858_100000075 3300005842 Bacteria 104349
30 Ga0068862_100002829 3300005844 Bacteria 15219
31 Ga0068862_100097413 3300005844 Bacteria 2568
32 Ga0081538_10004234 3300005981 Bacteria 13311
33 Ga0081538_10004701 3300005981 Bacteria 12502
34 Ga0081538_10053023 3300005981 Bacteria 2416
35 Ga0081540_1000063 3300005983 Bacteria 119510
36 Ga0075365_10005759 3300006038 Bacteria 6726
37 Ga0075365_10006698 3300006038 Bacteria 6368
38 Ga0075365_10040399 3300006038 Bacteria 3042
39 Ga0075365_10041225 3300006038 Bacteria 3015
40 Ga0075365_10102937 3300006038 Bacteria 1957
41 Ga0075363_100023016 3300006048 Bacteria 3154
42 Ga0075364_10017763 3300006051 Bacteria 4448
43 Ga0075364_10046893 3300006051 Bacteria 2814
44 Ga0075364_10054618 3300006051 Bacteria 2612
45 Ga0075431_100001038 3300006847 Bacteria 24774
46 Ga0075433_10015784 3300006852 Bacteria 6208
47 Ga0075433_10114414 3300006852 Bacteria 2393
48 Ga0075434_100004619 3300006871 Bacteria 12440
49 Ga0075434_100005817 3300006871 Bacteria 11261
50 Ga0075434_100019757 3300006871 Bacteria 6523
51 Ga0075435_100076605 3300007076 Bacteria 2741
52 Ga0111539_10057733 3300009094 Bacteria 4608
53 Ga0105245_10000690 3300009098 Bacteria 30407
54 Ga0105245_10005396 3300009098 Bacteria 11235
55 Ga0105245_10111013 3300009098 Bacteria 2550
56 Ga0114129_10003763 3300009147 Bacteria 21387
57 Ga0114129_10088210 3300009147 Bacteria 4301
58 Ga0105242_10030340 3300009176 Bacteria 4316
59 Ga0105237_10002855 3300009545 Bacteria 21010
60 Ga0105239_10305266 3300010375 Bacteria 1793
61 Ga0157370_10001872 3300013104 Bacteria 25939
62 Ga0157375_10005672 3300013308 Bacteria 10862
63 Ga0207642_10000558 3300025899 Bacteria 11452
64 Ga0207705_10055407 3300025909 Bacteria 2859
65 Ga0207671_10003194 3300025914 Bacteria 16519
66 Ga0207663_10013075 3300025916 Bacteria 4503
67 Ga0207657_10002227 3300025919 Bacteria 21031
68 Ga0207652_10000309 3300025921 Bacteria 50266
69 Ga0207650_10007000 3300025925 Bacteria 7691
70 Ga0207659_10057283 3300025926 Bacteria 2793
71 Ga0207687_10044256 3300025927 Bacteria 3071
72 Ga0207690_10021008 3300025932 Bacteria 4043
73 Ga0207669_10000017 3300025937 Bacteria 119878
74 Ga0207669_10026565 3300025937 Bacteria 3152
75 Ga0207669_10033050 3300025937 Bacteria 2914
76 Ga0207665_10016726 3300025939 Bacteria 4818
77 Ga0207691_10015522 3300025940 Bacteria 7241
78 Ga0207661_10035498 3300025944 Bacteria 3886
79 Ga0207712_10013637 3300025961 Bacteria 5211
80 Ga0207677_10058161 3300026023 Bacteria 2660
81 Ga0207703_10000088 3300026035 Bacteria 106080
82 Ga0207708_10001257 3300026075 Bacteria 19093
83 Ga0207641_10000077 3300026088 Bacteria 144978
84 Ga0207648_10027315 3300026089 Bacteria 5067
85 Ga0207676_10000018 3300026095 Bacteria 306375
86 Ga0207698_10051449 3300026142 Bacteria 3150
87 Ga0207428_10012713 3300027907 Bacteria 7382
88 Ga0268266_10059217 3300028379 Bacteria 3299
89 Ga0268265_10001933 3300028380 Bacteria 16442
90 Ga0265338_10052983 3300028800 Bacteria 3635
91 Ga0316576_10046285 3300031727 Bacteria 3148
92 Ga0316574_0007529 3300035398 Bacteria 5974
93 Ga0316584_0079347 3300036712 Bacteria 2459
94 Ga0395899_0087627 3300037312 Bacteria 2259
95 Ga0395900_0003414 3300037418 Bacteria 17170
96 Ga0395898_0003860 3300037466 Bacteria 16582
97 Ga0395905_0003148 3300037471 Bacteria 17774
98 Ga0395901_0013272 3300038443 Bacteria 8367
99 Ga0395901_0030013 3300038443 Bacteria 5601
100 Ga0451577_0000046 3300042876 Bacteria 320581
101 Ga0451577_0000360 3300042876 Bacteria 84786
102 Ga0451577_0001348 3300042876 Bacteria 33237
103 Ga0451577_0036372 3300042876 Bacteria 4431
104 Ga0453683_0062142 3300044673 Bacteria 2335
105 Ga0453684_0000178 3300044712 Bacteria 282502
106 Ga0453684_0000261 3300044712 Bacteria 226765
107 Ga0453684_0001267 3300044712 Bacteria 75707
108 Ga0453684_0036198 3300044712 Bacteria 6806
109 Ga0451576_0000354 3300045051 Bacteria 110089
110 Ga0451576_0053300 3300045051 Bacteria 4237
111 Ga0451576_0114845 3300045051 Bacteria 2803
112 Ga0466967_0005895 3300045976 Bacteria 8585
113 Ga0495603_0000711 3300046455 Bacteria 18835
114 Ga0495641_0000014 3300046461 Bacteria 140908
115 Ga0495641_0010053 3300046461 Bacteria 5545
116 Ga0495594_0000011 3300046499 Bacteria 118444
117 Ga0495608_0000183 3300046511 Bacteria 44585
118 Ga0495652_0000023 3300046529 Bacteria 168049
119 Ga0495634_0002740 3300046642 Bacteria 14492
120 Ga0495672_0041236 3300047320 Bacteria 2793
121 Ga0495680_0123612 3300047322 Bacteria 1908
122 Ga0496100_0003883 3300048903 Bacteria 7845
123 Ga0496100_0095689 3300048903 Bacteria 2036
124 Ga0496101_0001718 3300048904 Bacteria 13120
125 Ga0496102_0029637 3300048905 Bacteria 4897
126 Ga0496105_0107329 3300048908 Bacteria 2305
127 Ga0496106_0014155 3300048909 Bacteria 5893
128 Ga0496106_0022190 3300048909 Bacteria 4715
129 Ga0496107_0005917 3300048910 Bacteria 8381
130 Ga0496107_0031441 3300048910 Bacteria 3788
131 Ga0496108_0000365 3300048911 Bacteria 38077
132 Ga0496108_0006005 3300048911 Bacteria 9834
133 Ga0496108_0139991 3300048911 Bacteria 2084
134 Ga0496109_0000174 3300048912 Bacteria 63794
135 Ga0496109_0026910 3300048912 Bacteria 5131
136 Ga0496109_0093247 3300048912 Bacteria 2786
137 Ga0496110_0091937 3300048913 Bacteria 2714
138 Ga0496111_0019089 3300048914 Bacteria 4756
139 Ga0496111_0111512 3300048914 Bacteria 2015
140 Ga0496112_0000085 3300048915 Bacteria 61255
141 Ga0496113_0018425 3300048916 Bacteria 4862
142 Ga0496113_0019698 3300048916 Bacteria 4727
143 Ga0496113_0138538 3300048916 Bacteria 1913
144 Ga0496114_0003970 3300048917 Bacteria 11423
145 Ga0496115_0040550 3300048918 Bacteria 3702
146 Ga0496117_0004213 3300048920 Bacteria 16061
147 Ga0496118_0001908 3300048921 Bacteria 29656
148 Ga0501031_0001878 3300049568 Bacteria 13220
149 Ga0501031_0214398 3300049568 Bacteria 1254
150 Ga0501032_0007695 3300049569 Bacteria 7854
151 Ga0501033_0008747 3300049570 Bacteria 7829
152 Ga0501034_0057908 3300049571 Bacteria 3895
153 Ga0501034_0079255 3300049571 Bacteria 3288
154 Ga0501036_0010040 3300049572 Bacteria 7799
155 Ga0501037_0001052 3300049573 Bacteria 20410
156 Ga0501038_0004347 3300049574 Bacteria 13183
157 Ga0501039_0026162 3300049575 Bacteria 4484
158 Ga0501040_0036505 3300049576 Bacteria 3336
159 Ga0501040_0159705 3300049576 Bacteria 1593
160 Ga0501042_0032531 3300049578 Bacteria 3694
161 Ga0501043_0009171 3300049579 Bacteria 7777
162 Ga0501046_0003881 3300049580 Bacteria 13675
163 Ga0501047_0004213 3300049581 Bacteria 13542
164 Ga0501048_0008394 3300049582 Bacteria 7810
165 Ga0501068_0024271 3300049584 Bacteria 3560
166 Ga0501069_0014612 3300049585 Bacteria 4198
167 Ga0501070_0003577 3300049586 Bacteria 13441
168 Ga0501070_0089267 3300049586 Bacteria 2551
169 Ga0501071_0027693 3300049587 Bacteria 3990
170 Ga0501072_0011231 3300049588 Bacteria 6838
171 Ga0501072_0018359 3300049588 Bacteria 5384
172 Ga0501072_0033485 3300049588 Bacteria 4026
173 Ga0501073_0009971 3300049589 Bacteria 6989
174 Ga0501074_0013834 3300049590 Bacteria 5868
175 Ga0501075_0112688 3300049591 Bacteria 2068
176 Ga0501076_0064125 3300049592 Bacteria 2928
177 Ga0501077_0083848 3300049593 Bacteria 2020
178 Ga0501079_0013853 3300049741 Bacteria 6151
179 Ga0501080_0016329 3300049742 Bacteria 6855
180 Ga0501081_0043853 3300049743 Bacteria 3069
181 Ga0501083_0009767 3300049744 Bacteria 6775
182 Ga0501035_0001452 3300049822 Bacteria 24292
183 Ga0501044_0016967 3300049823 Bacteria 7812
184 Ga0501045_0022581 3300049824 Bacteria 4506
185 nmdc:mga00v17_60674_c1 3300050491 Bacteria 2323
186 nmdc:mga00v17_62990_c1 3300050491 Bacteria 2283
187 nmdc:mga00v17_8087_c1 3300050491 Bacteria 5647
188 nmdc:mga0yw44_101087_c1 3300050492 Bacteria 1837
189 nmdc:mga0yw44_1268_c1 3300050492 Bacteria 9942
190 nmdc:mga0yw44_31166_c1 3300050492 Bacteria 3098
191 nmdc:mga0yw44_80881_c1 3300050492 Bacteria 2036
192 nmdc:mga05p37_172420_c1 3300050507 Bacteria 2638
193 nmdc:mga08y16_148461_c1 3300050511 Bacteria 2437
194 nmdc:mga0n895_10516_c1 3300050512 Bacteria 8184
195 nmdc:mga0n895_8286_c1 3300050512 Bacteria 8990
196 nmdc:mga0a205_8632_c1 3300050515 Bacteria 9272
197 nmdc:mga0a205_934_c2 3300050515 Bacteria 7669
198 Ga0495601_0099743 3300053077 Bacteria 1875
199 Ga0495619_0000008 3300053085 Bacteria 305999
200 Ga0495619_0002234 3300053085 Bacteria 12803
201 Ga0500614_001513 3300053123 Bacteria 5532
202 Ga0501084_0014064 3300054114 Bacteria 6627
203 Ga0501084_0060836 3300054114 Bacteria 3162
204 Ga0501084_0118298 3300054114 Bacteria 2227
205 Ga0501082_0019366 3300060353 Bacteria 5865
206 Ga0530510_0048162 3300061734 Bacteria 3080

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0214398 Ga0501031_0214398_21_1181 352
2 3300049576 Ga0501040_0159705 Ga0501040_0159705_262_1551 395
3 3300048914 Ga0496111_0111512 Ga0496111_0111512_86_1333 401
4 3300044673 Ga0453683_0062142 Ga0453683_0062142_421_1785 432
5 3300045051 Ga0451576_0053300 Ga0451576_0053300_1397_2761 432
6 3300005331 Ga0070670_100007053 Ga0070670_1000070539 437
7 3300025925 Ga0207650_10007000 Ga0207650_100070003 437
8 3300061734 Ga0530510_0048162 Ga0530510_0048162_1354_2787 440
9 3300005615 Ga0070702_100023606 Ga0070702_1000236062 443
10 3300049588 Ga0501072_0033485 Ga0501072_0033485_1383_2816 443
11 3300049743 Ga0501081_0043853 Ga0501081_0043853_187_1620 443
12 3300054114 Ga0501084_0014064 Ga0501084_0014064_5009_6442 443
13 3300009098 Ga0105245_10000690 Ga0105245_1000069028 444
14 3300005981 Ga0081538_10053023 Ga0081538_100530233 449
15 3300025914 Ga0207671_10003194 Ga0207671_100031942 449
16 3300048903 Ga0496100_0003883 Ga0496100_0003883_4701_6221 449
17 3300005548 Ga0070665_100008226 Ga0070665_1000082262 450
18 3300005981 Ga0081538_10004701 Ga0081538_1000470111 450
19 3300009545 Ga0105237_10002855 Ga0105237_1000285516 450
20 3300028379 Ga0268266_10059217 Ga0268266_100592174 450
21 3300048908 Ga0496105_0107329 Ga0496105_0107329_696_2117 450
22 3300006852 Ga0075433_10114414 Ga0075433_101144143 454
23 3300006871 Ga0075434_100019757 Ga0075434_1000197575 454
24 3300007076 Ga0075435_100076605 Ga0075435_1000766053 454
25 3300050491 nmdc:mga00v17_60674_c1 nmdc:mga00v17_60674_c1_693_2153 455
26 3300005329 Ga0070683_100046280 Ga0070683_1000462803 456
27 3300025944 Ga0207661_10035498 Ga0207661_100354983 456
28 3300005356 Ga0070674_100037568 Ga0070674_1000375682 457
29 3300006871 Ga0075434_100004619 Ga0075434_1000046195 457
30 3300009147 Ga0114129_10003763 Ga0114129_1000376315 457
31 3300037312 Ga0395899_0087627 Ga0395899_0087627_544_2010 457
32 3300037418 Ga0395900_0003414 Ga0395900_0003414_15068_16534 457
33 3300037466 Ga0395898_0003860 Ga0395898_0003860_14862_16328 457
34 3300037471 Ga0395905_0003148 Ga0395905_0003148_717_2183 457
35 3300038443 Ga0395901_0013272 Ga0395901_0013272_1867_3333 457
36 3300050507 nmdc:mga05p37_172420_c1 nmdc:mga05p37_172420_c1_831_2261 457
37 3300050512 nmdc:mga0n895_10516_c1 nmdc:mga0n895_10516_c1_1880_3310 457
38 3300050515 nmdc:mga0a205_8632_c1 nmdc:mga0a205_8632_c1_1185_2615 457
39 3300046529 Ga0495652_0000023 Ga0495652_0000023_118198_119613 458
40 3300053077 Ga0495601_0099743 Ga0495601_0099743_53_1468 458
41 3300005981 Ga0081538_10004234 Ga0081538_1000423415 459
42 3300005983 Ga0081540_1000063 Ga0081540_100006316 459
43 3300009094 Ga0111539_10057733 Ga0111539_100577336 459
44 3300005367 Ga0070667_100006662 Ga0070667_1000066625 460
45 3300005844 Ga0068862_100002829 Ga0068862_10000282911 460
46 3300025961 Ga0207712_10013637 Ga0207712_100136372 460
47 3300028380 Ga0268265_10001933 Ga0268265_100019336 460
48 3300053085 Ga0495619_0002234 Ga0495619_0002234_10469_11932 460
49 3300042876 Ga0451577_0036372 Ga0451577_0036372_1387_2862 461
50 3300044712 Ga0453684_0036198 Ga0453684_0036198_4361_5836 461
51 3300045051 Ga0451576_0114845 Ga0451576_0114845_1226_2701 461
52 3300048915 Ga0496112_0000085 Ga0496112_0000085_43941_45368 461
53 3300042876 Ga0451577_0000046 Ga0451577_0000046_104204_105676 462
54 3300044712 Ga0453684_0000178 Ga0453684_0000178_104204_105676 462
55 3300005844 Ga0068862_100097413 Ga0068862_1000974133 463
56 3300028800 Ga0265338_10052983 Ga0265338_100529832 463
57 3300042876 Ga0451577_0000360 Ga0451577_0000360_50985_52460 463
58 3300042876 Ga0451577_0001348 Ga0451577_0001348_19305_20780 463
59 3300044712 Ga0453684_0000261 Ga0453684_0000261_29176_30651 463
60 3300044712 Ga0453684_0001267 Ga0453684_0001267_29061_30536 463
61 3300045051 Ga0451576_0000354 Ga0451576_0000354_99974_101449 463
62 3300046455 Ga0495603_0000711 Ga0495603_0000711_15536_16969 464
63 3300005618 Ga0068864_100000015 Ga0068864_100000015261 465
64 3300026095 Ga0207676_10000018 Ga0207676_1000001839 465
65 3300036712 Ga0316584_0079347 Ga0316584_0079347_710_2152 465
66 3300049588 Ga0501072_0018359 Ga0501072_0018359_295_1737 465
67 3300005337 Ga0070682_100025786 Ga0070682_1000257863 466
68 3300005338 Ga0068868_100024807 Ga0068868_1000248072 466
69 3300005340 Ga0070689_100033735 Ga0070689_1000337353 466
70 3300005356 Ga0070674_100000012 Ga0070674_10000001285 466
71 3300005356 Ga0070674_100091516 Ga0070674_1000915162 466
72 3300005439 Ga0070711_100011956 Ga0070711_1000119564 466
73 3300005544 Ga0070686_100011276 Ga0070686_1000112764 466
74 3300005549 Ga0070704_100003568 Ga0070704_1000035685 466
75 3300005718 Ga0068866_10000062 Ga0068866_1000006232 466
76 3300005842 Ga0068858_100000075 Ga0068858_10000007556 466
77 3300006038 Ga0075365_10005759 Ga0075365_100057592 466
78 3300006038 Ga0075365_10040399 Ga0075365_100403995 466
79 3300006038 Ga0075365_10041225 Ga0075365_100412252 466
80 3300006038 Ga0075365_10102937 Ga0075365_101029372 466
81 3300006048 Ga0075363_100023016 Ga0075363_1000230162 466
82 3300006051 Ga0075364_10017763 Ga0075364_100177632 466
83 3300006051 Ga0075364_10046893 Ga0075364_100468932 466
84 3300006051 Ga0075364_10054618 Ga0075364_100546182 466
85 3300006847 Ga0075431_100001038 Ga0075431_1000010388 466
86 3300006852 Ga0075433_10015784 Ga0075433_100157843 466
87 3300006871 Ga0075434_100005817 Ga0075434_1000058176 466
88 3300009098 Ga0105245_10005396 Ga0105245_100053964 466
89 3300009176 Ga0105242_10030340 Ga0105242_100303402 466
90 3300013104 Ga0157370_10001872 Ga0157370_1000187214 466
91 3300025899 Ga0207642_10000558 Ga0207642_100005582 466
92 3300025916 Ga0207663_10013075 Ga0207663_100130751 466
93 3300025927 Ga0207687_10044256 Ga0207687_100442562 466
94 3300025937 Ga0207669_10000017 Ga0207669_1000001770 466
95 3300025937 Ga0207669_10033050 Ga0207669_100330502 466
96 3300026035 Ga0207703_10000088 Ga0207703_1000008856 466
97 3300027907 Ga0207428_10012713 Ga0207428_100127135 466
98 3300038443 Ga0395901_0030013 Ga0395901_0030013_3757_5247 466
99 3300046461 Ga0495641_0010053 Ga0495641_0010053_1819_3276 466
100 3300048903 Ga0496100_0095689 Ga0496100_0095689_343_1800 466
101 3300048904 Ga0496101_0001718 Ga0496101_0001718_5049_6506 466
102 3300048905 Ga0496102_0029637 Ga0496102_0029637_292_1749 466
103 3300048909 Ga0496106_0014155 Ga0496106_0014155_2922_4379 466
104 3300048910 Ga0496107_0005917 Ga0496107_0005917_24_1481 466
105 3300048911 Ga0496108_0000365 Ga0496108_0000365_21762_23201 466
106 3300048911 Ga0496108_0006005 Ga0496108_0006005_1855_3294 466
107 3300048911 Ga0496108_0139991 Ga0496108_0139991_181_1638 466
108 3300048912 Ga0496109_0000174 Ga0496109_0000174_10016_11455 466
109 3300048912 Ga0496109_0026910 Ga0496109_0026910_2869_4308 466
110 3300048913 Ga0496110_0091937 Ga0496110_0091937_764_2221 466
111 3300048914 Ga0496111_0019089 Ga0496111_0019089_562_2019 466
112 3300048916 Ga0496113_0018425 Ga0496113_0018425_2724_4163 466
113 3300048917 Ga0496114_0003970 Ga0496114_0003970_1617_3074 466
114 3300048918 Ga0496115_0040550 Ga0496115_0040550_1026_2483 466
115 3300049586 Ga0501070_0089267 Ga0501070_0089267_832_2271 466
116 3300049587 Ga0501071_0027693 Ga0501071_0027693_2475_3935 466
117 3300049591 Ga0501075_0112688 Ga0501075_0112688_549_2009 466
118 3300050491 nmdc:mga00v17_62990_c1 nmdc:mga00v17_62990_c1_439_1896 466
119 3300050492 nmdc:mga0yw44_101087_c1 nmdc:mga0yw44_101087_c1_182_1642 466
120 3300050492 nmdc:mga0yw44_1268_c1 nmdc:mga0yw44_1268_c1_6513_8003 466
121 3300050492 nmdc:mga0yw44_80881_c1 nmdc:mga0yw44_80881_c1_19_1470 466
122 3300050512 nmdc:mga0n895_8286_c1 nmdc:mga0n895_8286_c1_5336_6826 466
123 3300050515 nmdc:mga0a205_934_c2 nmdc:mga0a205_934_c2_4251_5690 466
124 3300053085 Ga0495619_0000008 Ga0495619_0000008_255197_256636 466
125 3300005327 Ga0070658_10007843 Ga0070658_100078432 467
126 3300005339 Ga0070660_100014786 Ga0070660_1000147863 467
127 3300005354 Ga0070675_100016563 Ga0070675_1000165632 467
128 3300005356 Ga0070674_100011717 Ga0070674_1000117172 467
129 3300005364 Ga0070673_100164511 Ga0070673_1001645112 467
130 3300005366 Ga0070659_100130031 Ga0070659_1001300312 467
131 3300005441 Ga0070700_100006066 Ga0070700_1000060665 467
132 3300005535 Ga0070684_100021470 Ga0070684_1000214702 467
133 3300005539 Ga0068853_100011898 Ga0068853_1000118985 467
134 3300005564 Ga0070664_100038455 Ga0070664_1000384554 467
135 3300006038 Ga0075365_10006698 Ga0075365_100066982 467
136 3300009098 Ga0105245_10111013 Ga0105245_101110133 467
137 3300009147 Ga0114129_10088210 Ga0114129_100882102 467
138 3300010375 Ga0105239_10305266 Ga0105239_103052662 467
139 3300013308 Ga0157375_10005672 Ga0157375_100056728 467
140 3300025909 Ga0207705_10055407 Ga0207705_100554072 467
141 3300025919 Ga0207657_10002227 Ga0207657_100022277 467
142 3300025926 Ga0207659_10057283 Ga0207659_100572833 467
143 3300025932 Ga0207690_10021008 Ga0207690_100210082 467
144 3300025937 Ga0207669_10026565 Ga0207669_100265652 467
145 3300025940 Ga0207691_10015522 Ga0207691_100155225 467
146 3300026023 Ga0207677_10058161 Ga0207677_100581612 467
147 3300026075 Ga0207708_10001257 Ga0207708_100012572 467
148 3300026089 Ga0207648_10027315 Ga0207648_100273155 467
149 3300026142 Ga0207698_10051449 Ga0207698_100514492 467
150 3300046499 Ga0495594_0000011 Ga0495594_0000011_20021_21463 467
151 3300046642 Ga0495634_0002740 Ga0495634_0002740_9660_11108 467
152 3300047322 Ga0495680_0123612 Ga0495680_0123612_323_1768 467
153 3300048909 Ga0496106_0022190 Ga0496106_0022190_3222_4673 467
154 3300048910 Ga0496107_0031441 Ga0496107_0031441_2194_3645 467
155 3300048912 Ga0496109_0093247 Ga0496109_0093247_333_1784 467
156 3300048916 Ga0496113_0019698 Ga0496113_0019698_2971_4422 467
157 3300048916 Ga0496113_0138538 Ga0496113_0138538_177_1625 467
158 3300049592 Ga0501076_0064125 Ga0501076_0064125_1137_2588 467
159 3300049593 Ga0501077_0083848 Ga0501077_0083848_171_1634 467
160 3300050491 nmdc:mga00v17_8087_c1 nmdc:mga00v17_8087_c1_3358_4809 467
161 3300050492 nmdc:mga0yw44_31166_c1 nmdc:mga0yw44_31166_c1_1601_3061 467
162 3300050511 nmdc:mga08y16_148461_c1 nmdc:mga08y16_148461_c1_239_1690 467
163 3300054114 Ga0501084_0118298 Ga0501084_0118298_333_1796 467
164 3300031727 Ga0316576_10046285 Ga0316576_100462853 468
165 3300035398 Ga0316574_0007529 Ga0316574_0007529_4328_5785 468
166 3300046461 Ga0495641_0000014 Ga0495641_0000014_136708_138153 468
167 3300046511 Ga0495608_0000183 Ga0495608_0000183_37007_38452 468
168 3300047320 Ga0495672_0041236 Ga0495672_0041236_658_2121 468
169 3300053123 Ga0500614_001513 Ga0500614_001513_2681_4126 468
170 3300045976 Ga0466967_0005895 Ga0466967_0005895_784_2241 471
171 3300049568 Ga0501031_0001878 Ga0501031_0001878_9681_11240 471
172 3300049569 Ga0501032_0007695 Ga0501032_0007695_4285_5844 471
173 3300049570 Ga0501033_0008747 Ga0501033_0008747_1991_3550 471
174 3300049571 Ga0501034_0057908 Ga0501034_0057908_347_1906 471
175 3300049571 Ga0501034_0079255 Ga0501034_0079255_1692_3251 471
176 3300049572 Ga0501036_0010040 Ga0501036_0010040_1976_3535 471
177 3300049573 Ga0501037_0001052 Ga0501037_0001052_4280_5839 471
178 3300049574 Ga0501038_0004347 Ga0501038_0004347_9658_11217 471
179 3300049575 Ga0501039_0026162 Ga0501039_0026162_1211_2770 471
180 3300049576 Ga0501040_0036505 Ga0501040_0036505_55_1614 471
181 3300049578 Ga0501042_0032531 Ga0501042_0032531_120_1679 471
182 3300049579 Ga0501043_0009171 Ga0501043_0009171_4262_5821 471
183 3300049580 Ga0501046_0003881 Ga0501046_0003881_2223_3782 471
184 3300049581 Ga0501047_0004213 Ga0501047_0004213_1987_3546 471
185 3300049582 Ga0501048_0008394 Ga0501048_0008394_1969_3528 471
186 3300049584 Ga0501068_0024271 Ga0501068_0024271_586_2145 471
187 3300049585 Ga0501069_0014612 Ga0501069_0014612_679_2238 471
188 3300049586 Ga0501070_0003577 Ga0501070_0003577_2201_3760 471
189 3300049588 Ga0501072_0011231 Ga0501072_0011231_3442_5001 471
190 3300049589 Ga0501073_0009971 Ga0501073_0009971_3416_4975 471
191 3300049590 Ga0501074_0013834 Ga0501074_0013834_1416_2975 471
192 3300049741 Ga0501079_0013853 Ga0501079_0013853_4286_5845 471
193 3300049742 Ga0501080_0016329 Ga0501080_0016329_3329_4888 471
194 3300049744 Ga0501083_0009767 Ga0501083_0009767_1758_3317 471
195 3300049822 Ga0501035_0001452 Ga0501035_0001452_17424_18983 471
196 3300049823 Ga0501044_0016967 Ga0501044_0016967_1980_3539 471
197 3300049824 Ga0501045_0022581 Ga0501045_0022581_987_2546 471
198 3300054114 Ga0501084_0060836 Ga0501084_0060836_350_1909 471
199 3300060353 Ga0501082_0019366 Ga0501082_0019366_14_1573 471
200 3300048920 Ga0496117_0004213 Ga0496117_0004213_2976_4526 474
201 3300048921 Ga0496118_0001908 Ga0496118_0001908_22229_23779 474
202 3300005530 Ga0070679_100000225 Ga0070679_10000022510 484
203 3300025921 Ga0207652_10000309 Ga0207652_1000030943 484
204 3300025939 Ga0207665_10016726 Ga0207665_100167262 484
205 3300026088 Ga0207641_10000077 Ga0207641_1000007784 484
206 3300001977 JGI24746J21847_1000510 JGI24746J21847_10005106 488

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

14

476

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ip4-assembly1.cif.gz_A the high resolution structure of gatcab 0.8331 1 456
2gi3-assembly1.cif.gz_A-2 crystal structure of glutamyl-trna(gln) amidotransferase subunit a (tm1272) from thermotoga maritima at 1.80 a resolution 0.8303 5 456
4wj3-assembly2.cif.gz_D crystal structure of the asparagine transamidosome from pseudomonas aeruginosa 0.8196 5 456
3h0r-assembly7.cif.gz_S structure of trna-dependent amidotransferase gatcab from aquifex aeolicus 0.8115 5 456
3kfu-assembly1.cif.gz_H crystal structure of the transamidosome 0.805 13 457
ID Description Score Start End Superfamily
af_Q9LI77_43_527_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8444 13 456 3.90.1300.10
2gi3A01 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8408 1 456 3.90.1300.10
af_Q5FWT5_3_499_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.84 8 459 3.90.1300.10
2dqnA00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8217 4 456 3.90.1300.10
af_A0A0P0XRM7_54_372_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8215 5 217 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A2D6GLT7-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A 0.8858 3 299 GO:0016740
AF-A0A2V7KPY6-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A (EC 6.3.5.-) 0.8788 142 310 GO:0016740
GO:0016874
AF-A0A2D5V731-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A 0.8724 7 276 GO:0016740
AF-A0A2V7CP85-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A 0.8712 1 300 GO:0016740
AF-A0A7V8ZI79-F1-model_v4 Glutamyl-tRNA(Gln) amidotransferase subunit A (Glu-ADT subunit A) (EC 6.3.5.7) 0.863 6 461 GO:0005524
GO:0006412
GO:0016740
GO:0030956
GO:0050567

Feature Viewer

pLDDT pTM Quality
78.42 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map