F314933
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 206 | 150 | 206 | 472 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10005759|Ga0075365_100057592 |
| Length | 496 |
| Sequence | MSDVLELTAAQALERISAGEISADEYFDAYAARAAADDLGAYLWRAEAGSPNGAGDGPLSRAPIAVKDIFCTEGIETTAGSRILEGYRPPYTATAVRRLSEAGARILGKTNMDEFAMGSSNENSGYGPVRNPWDPERVPGGSSGXXAAAVAGRLAPWAIGTDTGGSIRQPASLCGVVGLKPTYGAISRYGMIAFASSLDQCGPLTRDVTDAAILMRAMEGRDRCDSTSVGIDGGVSLPSRTDLKGLRFGVPRELTADAQGIEAGVTEVFERAVDRIRDLGAEVDECELPHSSHGISAYYVLAPAEASANLARYDGVRYGMRSAAAADAEGGLGDGIAPAEADLVSMYERTRAAGFGPEVKRRIMLGTYALSSGYYEAYYGRAQRVRTKIAQDFAAAFERFDYLVTPTSPTVAFKLGARAENPLAMYMSDYCTVPMSLAGVPAISIPGGLAAPDDGGPELPVGLQIVAPAFGESGLLDAAHAIEGAIGFDSAPGSRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 25 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 26 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 27 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 28 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 30 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 31 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 32 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 33 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 34 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 35 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 36 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 37 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 68 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 71 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 72 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 73 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 74 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 75 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 76 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 77 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 78 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 79 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 80 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 81 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 82 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 83 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 84 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 93 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 94 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 95 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 96 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 97 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 98 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 99 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 100 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 101 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 102 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 103 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 104 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 105 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 106 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 107 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 108 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 109 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 110 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 111 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 113 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 114 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 140 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 141 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 148 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.25 |
| Nodule | 0 |
| Rhizoplane | 11.65 |
| Rhizosphere | 79.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000510 | 3300001977 | Bacteria | 5825 |
| 2 | Ga0070658_10007843 | 3300005327 | Bacteria | 8600 |
| 3 | Ga0070683_100046280 | 3300005329 | Bacteria | 4019 |
| 4 | Ga0070670_100007053 | 3300005331 | Bacteria | 9526 |
| 5 | Ga0070682_100025786 | 3300005337 | Bacteria | 3512 |
| 6 | Ga0068868_100024807 | 3300005338 | Bacteria | 4552 |
| 7 | Ga0070660_100014786 | 3300005339 | Bacteria | 5631 |
| 8 | Ga0070689_100033735 | 3300005340 | Bacteria | 3902 |
| 9 | Ga0070675_100016563 | 3300005354 | Bacteria | 5852 |
| 10 | Ga0070674_100000012 | 3300005356 | Bacteria | 130773 |
| 11 | Ga0070674_100011717 | 3300005356 | Bacteria | 5348 |
| 12 | Ga0070674_100037568 | 3300005356 | Bacteria | 3258 |
| 13 | Ga0070674_100091516 | 3300005356 | Bacteria | 2197 |
| 14 | Ga0070673_100164511 | 3300005364 | Bacteria | 1889 |
| 15 | Ga0070659_100130031 | 3300005366 | Bacteria | 2044 |
| 16 | Ga0070667_100006662 | 3300005367 | Bacteria | 9601 |
| 17 | Ga0070711_100011956 | 3300005439 | Bacteria | 5406 |
| 18 | Ga0070700_100006066 | 3300005441 | Bacteria | 6434 |
| 19 | Ga0070679_100000225 | 3300005530 | Bacteria | 46317 |
| 20 | Ga0070684_100021470 | 3300005535 | Bacteria | 5373 |
| 21 | Ga0068853_100011898 | 3300005539 | Bacteria | 7077 |
| 22 | Ga0070686_100011276 | 3300005544 | Bacteria | 5065 |
| 23 | Ga0070665_100008226 | 3300005548 | Bacteria | 10559 |
| 24 | Ga0070704_100003568 | 3300005549 | Bacteria | 8942 |
| 25 | Ga0070664_100038455 | 3300005564 | Bacteria | 4027 |
| 26 | Ga0070702_100023606 | 3300005615 | Bacteria | 3271 |
| 27 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 28 | Ga0068866_10000062 | 3300005718 | Bacteria | 42082 |
| 29 | Ga0068858_100000075 | 3300005842 | Bacteria | 104349 |
| 30 | Ga0068862_100002829 | 3300005844 | Bacteria | 15219 |
| 31 | Ga0068862_100097413 | 3300005844 | Bacteria | 2568 |
| 32 | Ga0081538_10004234 | 3300005981 | Bacteria | 13311 |
| 33 | Ga0081538_10004701 | 3300005981 | Bacteria | 12502 |
| 34 | Ga0081538_10053023 | 3300005981 | Bacteria | 2416 |
| 35 | Ga0081540_1000063 | 3300005983 | Bacteria | 119510 |
| 36 | Ga0075365_10005759 | 3300006038 | Bacteria | 6726 |
| 37 | Ga0075365_10006698 | 3300006038 | Bacteria | 6368 |
| 38 | Ga0075365_10040399 | 3300006038 | Bacteria | 3042 |
| 39 | Ga0075365_10041225 | 3300006038 | Bacteria | 3015 |
| 40 | Ga0075365_10102937 | 3300006038 | Bacteria | 1957 |
| 41 | Ga0075363_100023016 | 3300006048 | Bacteria | 3154 |
| 42 | Ga0075364_10017763 | 3300006051 | Bacteria | 4448 |
| 43 | Ga0075364_10046893 | 3300006051 | Bacteria | 2814 |
| 44 | Ga0075364_10054618 | 3300006051 | Bacteria | 2612 |
| 45 | Ga0075431_100001038 | 3300006847 | Bacteria | 24774 |
| 46 | Ga0075433_10015784 | 3300006852 | Bacteria | 6208 |
| 47 | Ga0075433_10114414 | 3300006852 | Bacteria | 2393 |
| 48 | Ga0075434_100004619 | 3300006871 | Bacteria | 12440 |
| 49 | Ga0075434_100005817 | 3300006871 | Bacteria | 11261 |
| 50 | Ga0075434_100019757 | 3300006871 | Bacteria | 6523 |
| 51 | Ga0075435_100076605 | 3300007076 | Bacteria | 2741 |
| 52 | Ga0111539_10057733 | 3300009094 | Bacteria | 4608 |
| 53 | Ga0105245_10000690 | 3300009098 | Bacteria | 30407 |
| 54 | Ga0105245_10005396 | 3300009098 | Bacteria | 11235 |
| 55 | Ga0105245_10111013 | 3300009098 | Bacteria | 2550 |
| 56 | Ga0114129_10003763 | 3300009147 | Bacteria | 21387 |
| 57 | Ga0114129_10088210 | 3300009147 | Bacteria | 4301 |
| 58 | Ga0105242_10030340 | 3300009176 | Bacteria | 4316 |
| 59 | Ga0105237_10002855 | 3300009545 | Bacteria | 21010 |
| 60 | Ga0105239_10305266 | 3300010375 | Bacteria | 1793 |
| 61 | Ga0157370_10001872 | 3300013104 | Bacteria | 25939 |
| 62 | Ga0157375_10005672 | 3300013308 | Bacteria | 10862 |
| 63 | Ga0207642_10000558 | 3300025899 | Bacteria | 11452 |
| 64 | Ga0207705_10055407 | 3300025909 | Bacteria | 2859 |
| 65 | Ga0207671_10003194 | 3300025914 | Bacteria | 16519 |
| 66 | Ga0207663_10013075 | 3300025916 | Bacteria | 4503 |
| 67 | Ga0207657_10002227 | 3300025919 | Bacteria | 21031 |
| 68 | Ga0207652_10000309 | 3300025921 | Bacteria | 50266 |
| 69 | Ga0207650_10007000 | 3300025925 | Bacteria | 7691 |
| 70 | Ga0207659_10057283 | 3300025926 | Bacteria | 2793 |
| 71 | Ga0207687_10044256 | 3300025927 | Bacteria | 3071 |
| 72 | Ga0207690_10021008 | 3300025932 | Bacteria | 4043 |
| 73 | Ga0207669_10000017 | 3300025937 | Bacteria | 119878 |
| 74 | Ga0207669_10026565 | 3300025937 | Bacteria | 3152 |
| 75 | Ga0207669_10033050 | 3300025937 | Bacteria | 2914 |
| 76 | Ga0207665_10016726 | 3300025939 | Bacteria | 4818 |
| 77 | Ga0207691_10015522 | 3300025940 | Bacteria | 7241 |
| 78 | Ga0207661_10035498 | 3300025944 | Bacteria | 3886 |
| 79 | Ga0207712_10013637 | 3300025961 | Bacteria | 5211 |
| 80 | Ga0207677_10058161 | 3300026023 | Bacteria | 2660 |
| 81 | Ga0207703_10000088 | 3300026035 | Bacteria | 106080 |
| 82 | Ga0207708_10001257 | 3300026075 | Bacteria | 19093 |
| 83 | Ga0207641_10000077 | 3300026088 | Bacteria | 144978 |
| 84 | Ga0207648_10027315 | 3300026089 | Bacteria | 5067 |
| 85 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 86 | Ga0207698_10051449 | 3300026142 | Bacteria | 3150 |
| 87 | Ga0207428_10012713 | 3300027907 | Bacteria | 7382 |
| 88 | Ga0268266_10059217 | 3300028379 | Bacteria | 3299 |
| 89 | Ga0268265_10001933 | 3300028380 | Bacteria | 16442 |
| 90 | Ga0265338_10052983 | 3300028800 | Bacteria | 3635 |
| 91 | Ga0316576_10046285 | 3300031727 | Bacteria | 3148 |
| 92 | Ga0316574_0007529 | 3300035398 | Bacteria | 5974 |
| 93 | Ga0316584_0079347 | 3300036712 | Bacteria | 2459 |
| 94 | Ga0395899_0087627 | 3300037312 | Bacteria | 2259 |
| 95 | Ga0395900_0003414 | 3300037418 | Bacteria | 17170 |
| 96 | Ga0395898_0003860 | 3300037466 | Bacteria | 16582 |
| 97 | Ga0395905_0003148 | 3300037471 | Bacteria | 17774 |
| 98 | Ga0395901_0013272 | 3300038443 | Bacteria | 8367 |
| 99 | Ga0395901_0030013 | 3300038443 | Bacteria | 5601 |
| 100 | Ga0451577_0000046 | 3300042876 | Bacteria | 320581 |
| 101 | Ga0451577_0000360 | 3300042876 | Bacteria | 84786 |
| 102 | Ga0451577_0001348 | 3300042876 | Bacteria | 33237 |
| 103 | Ga0451577_0036372 | 3300042876 | Bacteria | 4431 |
| 104 | Ga0453683_0062142 | 3300044673 | Bacteria | 2335 |
| 105 | Ga0453684_0000178 | 3300044712 | Bacteria | 282502 |
| 106 | Ga0453684_0000261 | 3300044712 | Bacteria | 226765 |
| 107 | Ga0453684_0001267 | 3300044712 | Bacteria | 75707 |
| 108 | Ga0453684_0036198 | 3300044712 | Bacteria | 6806 |
| 109 | Ga0451576_0000354 | 3300045051 | Bacteria | 110089 |
| 110 | Ga0451576_0053300 | 3300045051 | Bacteria | 4237 |
| 111 | Ga0451576_0114845 | 3300045051 | Bacteria | 2803 |
| 112 | Ga0466967_0005895 | 3300045976 | Bacteria | 8585 |
| 113 | Ga0495603_0000711 | 3300046455 | Bacteria | 18835 |
| 114 | Ga0495641_0000014 | 3300046461 | Bacteria | 140908 |
| 115 | Ga0495641_0010053 | 3300046461 | Bacteria | 5545 |
| 116 | Ga0495594_0000011 | 3300046499 | Bacteria | 118444 |
| 117 | Ga0495608_0000183 | 3300046511 | Bacteria | 44585 |
| 118 | Ga0495652_0000023 | 3300046529 | Bacteria | 168049 |
| 119 | Ga0495634_0002740 | 3300046642 | Bacteria | 14492 |
| 120 | Ga0495672_0041236 | 3300047320 | Bacteria | 2793 |
| 121 | Ga0495680_0123612 | 3300047322 | Bacteria | 1908 |
| 122 | Ga0496100_0003883 | 3300048903 | Bacteria | 7845 |
| 123 | Ga0496100_0095689 | 3300048903 | Bacteria | 2036 |
| 124 | Ga0496101_0001718 | 3300048904 | Bacteria | 13120 |
| 125 | Ga0496102_0029637 | 3300048905 | Bacteria | 4897 |
| 126 | Ga0496105_0107329 | 3300048908 | Bacteria | 2305 |
| 127 | Ga0496106_0014155 | 3300048909 | Bacteria | 5893 |
| 128 | Ga0496106_0022190 | 3300048909 | Bacteria | 4715 |
| 129 | Ga0496107_0005917 | 3300048910 | Bacteria | 8381 |
| 130 | Ga0496107_0031441 | 3300048910 | Bacteria | 3788 |
| 131 | Ga0496108_0000365 | 3300048911 | Bacteria | 38077 |
| 132 | Ga0496108_0006005 | 3300048911 | Bacteria | 9834 |
| 133 | Ga0496108_0139991 | 3300048911 | Bacteria | 2084 |
| 134 | Ga0496109_0000174 | 3300048912 | Bacteria | 63794 |
| 135 | Ga0496109_0026910 | 3300048912 | Bacteria | 5131 |
| 136 | Ga0496109_0093247 | 3300048912 | Bacteria | 2786 |
| 137 | Ga0496110_0091937 | 3300048913 | Bacteria | 2714 |
| 138 | Ga0496111_0019089 | 3300048914 | Bacteria | 4756 |
| 139 | Ga0496111_0111512 | 3300048914 | Bacteria | 2015 |
| 140 | Ga0496112_0000085 | 3300048915 | Bacteria | 61255 |
| 141 | Ga0496113_0018425 | 3300048916 | Bacteria | 4862 |
| 142 | Ga0496113_0019698 | 3300048916 | Bacteria | 4727 |
| 143 | Ga0496113_0138538 | 3300048916 | Bacteria | 1913 |
| 144 | Ga0496114_0003970 | 3300048917 | Bacteria | 11423 |
| 145 | Ga0496115_0040550 | 3300048918 | Bacteria | 3702 |
| 146 | Ga0496117_0004213 | 3300048920 | Bacteria | 16061 |
| 147 | Ga0496118_0001908 | 3300048921 | Bacteria | 29656 |
| 148 | Ga0501031_0001878 | 3300049568 | Bacteria | 13220 |
| 149 | Ga0501031_0214398 | 3300049568 | Bacteria | 1254 |
| 150 | Ga0501032_0007695 | 3300049569 | Bacteria | 7854 |
| 151 | Ga0501033_0008747 | 3300049570 | Bacteria | 7829 |
| 152 | Ga0501034_0057908 | 3300049571 | Bacteria | 3895 |
| 153 | Ga0501034_0079255 | 3300049571 | Bacteria | 3288 |
| 154 | Ga0501036_0010040 | 3300049572 | Bacteria | 7799 |
| 155 | Ga0501037_0001052 | 3300049573 | Bacteria | 20410 |
| 156 | Ga0501038_0004347 | 3300049574 | Bacteria | 13183 |
| 157 | Ga0501039_0026162 | 3300049575 | Bacteria | 4484 |
| 158 | Ga0501040_0036505 | 3300049576 | Bacteria | 3336 |
| 159 | Ga0501040_0159705 | 3300049576 | Bacteria | 1593 |
| 160 | Ga0501042_0032531 | 3300049578 | Bacteria | 3694 |
| 161 | Ga0501043_0009171 | 3300049579 | Bacteria | 7777 |
| 162 | Ga0501046_0003881 | 3300049580 | Bacteria | 13675 |
| 163 | Ga0501047_0004213 | 3300049581 | Bacteria | 13542 |
| 164 | Ga0501048_0008394 | 3300049582 | Bacteria | 7810 |
| 165 | Ga0501068_0024271 | 3300049584 | Bacteria | 3560 |
| 166 | Ga0501069_0014612 | 3300049585 | Bacteria | 4198 |
| 167 | Ga0501070_0003577 | 3300049586 | Bacteria | 13441 |
| 168 | Ga0501070_0089267 | 3300049586 | Bacteria | 2551 |
| 169 | Ga0501071_0027693 | 3300049587 | Bacteria | 3990 |
| 170 | Ga0501072_0011231 | 3300049588 | Bacteria | 6838 |
| 171 | Ga0501072_0018359 | 3300049588 | Bacteria | 5384 |
| 172 | Ga0501072_0033485 | 3300049588 | Bacteria | 4026 |
| 173 | Ga0501073_0009971 | 3300049589 | Bacteria | 6989 |
| 174 | Ga0501074_0013834 | 3300049590 | Bacteria | 5868 |
| 175 | Ga0501075_0112688 | 3300049591 | Bacteria | 2068 |
| 176 | Ga0501076_0064125 | 3300049592 | Bacteria | 2928 |
| 177 | Ga0501077_0083848 | 3300049593 | Bacteria | 2020 |
| 178 | Ga0501079_0013853 | 3300049741 | Bacteria | 6151 |
| 179 | Ga0501080_0016329 | 3300049742 | Bacteria | 6855 |
| 180 | Ga0501081_0043853 | 3300049743 | Bacteria | 3069 |
| 181 | Ga0501083_0009767 | 3300049744 | Bacteria | 6775 |
| 182 | Ga0501035_0001452 | 3300049822 | Bacteria | 24292 |
| 183 | Ga0501044_0016967 | 3300049823 | Bacteria | 7812 |
| 184 | Ga0501045_0022581 | 3300049824 | Bacteria | 4506 |
| 185 | nmdc:mga00v17_60674_c1 | 3300050491 | Bacteria | 2323 |
| 186 | nmdc:mga00v17_62990_c1 | 3300050491 | Bacteria | 2283 |
| 187 | nmdc:mga00v17_8087_c1 | 3300050491 | Bacteria | 5647 |
| 188 | nmdc:mga0yw44_101087_c1 | 3300050492 | Bacteria | 1837 |
| 189 | nmdc:mga0yw44_1268_c1 | 3300050492 | Bacteria | 9942 |
| 190 | nmdc:mga0yw44_31166_c1 | 3300050492 | Bacteria | 3098 |
| 191 | nmdc:mga0yw44_80881_c1 | 3300050492 | Bacteria | 2036 |
| 192 | nmdc:mga05p37_172420_c1 | 3300050507 | Bacteria | 2638 |
| 193 | nmdc:mga08y16_148461_c1 | 3300050511 | Bacteria | 2437 |
| 194 | nmdc:mga0n895_10516_c1 | 3300050512 | Bacteria | 8184 |
| 195 | nmdc:mga0n895_8286_c1 | 3300050512 | Bacteria | 8990 |
| 196 | nmdc:mga0a205_8632_c1 | 3300050515 | Bacteria | 9272 |
| 197 | nmdc:mga0a205_934_c2 | 3300050515 | Bacteria | 7669 |
| 198 | Ga0495601_0099743 | 3300053077 | Bacteria | 1875 |
| 199 | Ga0495619_0000008 | 3300053085 | Bacteria | 305999 |
| 200 | Ga0495619_0002234 | 3300053085 | Bacteria | 12803 |
| 201 | Ga0500614_001513 | 3300053123 | Bacteria | 5532 |
| 202 | Ga0501084_0014064 | 3300054114 | Bacteria | 6627 |
| 203 | Ga0501084_0060836 | 3300054114 | Bacteria | 3162 |
| 204 | Ga0501084_0118298 | 3300054114 | Bacteria | 2227 |
| 205 | Ga0501082_0019366 | 3300060353 | Bacteria | 5865 |
| 206 | Ga0530510_0048162 | 3300061734 | Bacteria | 3080 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049568 | Ga0501031_0214398 | Ga0501031_0214398_21_1181 | 352 |
| 2 | 3300049576 | Ga0501040_0159705 | Ga0501040_0159705_262_1551 | 395 |
| 3 | 3300048914 | Ga0496111_0111512 | Ga0496111_0111512_86_1333 | 401 |
| 4 | 3300044673 | Ga0453683_0062142 | Ga0453683_0062142_421_1785 | 432 |
| 5 | 3300045051 | Ga0451576_0053300 | Ga0451576_0053300_1397_2761 | 432 |
| 6 | 3300005331 | Ga0070670_100007053 | Ga0070670_1000070539 | 437 |
| 7 | 3300025925 | Ga0207650_10007000 | Ga0207650_100070003 | 437 |
| 8 | 3300061734 | Ga0530510_0048162 | Ga0530510_0048162_1354_2787 | 440 |
| 9 | 3300005615 | Ga0070702_100023606 | Ga0070702_1000236062 | 443 |
| 10 | 3300049588 | Ga0501072_0033485 | Ga0501072_0033485_1383_2816 | 443 |
| 11 | 3300049743 | Ga0501081_0043853 | Ga0501081_0043853_187_1620 | 443 |
| 12 | 3300054114 | Ga0501084_0014064 | Ga0501084_0014064_5009_6442 | 443 |
| 13 | 3300009098 | Ga0105245_10000690 | Ga0105245_1000069028 | 444 |
| 14 | 3300005981 | Ga0081538_10053023 | Ga0081538_100530233 | 449 |
| 15 | 3300025914 | Ga0207671_10003194 | Ga0207671_100031942 | 449 |
| 16 | 3300048903 | Ga0496100_0003883 | Ga0496100_0003883_4701_6221 | 449 |
| 17 | 3300005548 | Ga0070665_100008226 | Ga0070665_1000082262 | 450 |
| 18 | 3300005981 | Ga0081538_10004701 | Ga0081538_1000470111 | 450 |
| 19 | 3300009545 | Ga0105237_10002855 | Ga0105237_1000285516 | 450 |
| 20 | 3300028379 | Ga0268266_10059217 | Ga0268266_100592174 | 450 |
| 21 | 3300048908 | Ga0496105_0107329 | Ga0496105_0107329_696_2117 | 450 |
| 22 | 3300006852 | Ga0075433_10114414 | Ga0075433_101144143 | 454 |
| 23 | 3300006871 | Ga0075434_100019757 | Ga0075434_1000197575 | 454 |
| 24 | 3300007076 | Ga0075435_100076605 | Ga0075435_1000766053 | 454 |
| 25 | 3300050491 | nmdc:mga00v17_60674_c1 | nmdc:mga00v17_60674_c1_693_2153 | 455 |
| 26 | 3300005329 | Ga0070683_100046280 | Ga0070683_1000462803 | 456 |
| 27 | 3300025944 | Ga0207661_10035498 | Ga0207661_100354983 | 456 |
| 28 | 3300005356 | Ga0070674_100037568 | Ga0070674_1000375682 | 457 |
| 29 | 3300006871 | Ga0075434_100004619 | Ga0075434_1000046195 | 457 |
| 30 | 3300009147 | Ga0114129_10003763 | Ga0114129_1000376315 | 457 |
| 31 | 3300037312 | Ga0395899_0087627 | Ga0395899_0087627_544_2010 | 457 |
| 32 | 3300037418 | Ga0395900_0003414 | Ga0395900_0003414_15068_16534 | 457 |
| 33 | 3300037466 | Ga0395898_0003860 | Ga0395898_0003860_14862_16328 | 457 |
| 34 | 3300037471 | Ga0395905_0003148 | Ga0395905_0003148_717_2183 | 457 |
| 35 | 3300038443 | Ga0395901_0013272 | Ga0395901_0013272_1867_3333 | 457 |
| 36 | 3300050507 | nmdc:mga05p37_172420_c1 | nmdc:mga05p37_172420_c1_831_2261 | 457 |
| 37 | 3300050512 | nmdc:mga0n895_10516_c1 | nmdc:mga0n895_10516_c1_1880_3310 | 457 |
| 38 | 3300050515 | nmdc:mga0a205_8632_c1 | nmdc:mga0a205_8632_c1_1185_2615 | 457 |
| 39 | 3300046529 | Ga0495652_0000023 | Ga0495652_0000023_118198_119613 | 458 |
| 40 | 3300053077 | Ga0495601_0099743 | Ga0495601_0099743_53_1468 | 458 |
| 41 | 3300005981 | Ga0081538_10004234 | Ga0081538_1000423415 | 459 |
| 42 | 3300005983 | Ga0081540_1000063 | Ga0081540_100006316 | 459 |
| 43 | 3300009094 | Ga0111539_10057733 | Ga0111539_100577336 | 459 |
| 44 | 3300005367 | Ga0070667_100006662 | Ga0070667_1000066625 | 460 |
| 45 | 3300005844 | Ga0068862_100002829 | Ga0068862_10000282911 | 460 |
| 46 | 3300025961 | Ga0207712_10013637 | Ga0207712_100136372 | 460 |
| 47 | 3300028380 | Ga0268265_10001933 | Ga0268265_100019336 | 460 |
| 48 | 3300053085 | Ga0495619_0002234 | Ga0495619_0002234_10469_11932 | 460 |
| 49 | 3300042876 | Ga0451577_0036372 | Ga0451577_0036372_1387_2862 | 461 |
| 50 | 3300044712 | Ga0453684_0036198 | Ga0453684_0036198_4361_5836 | 461 |
| 51 | 3300045051 | Ga0451576_0114845 | Ga0451576_0114845_1226_2701 | 461 |
| 52 | 3300048915 | Ga0496112_0000085 | Ga0496112_0000085_43941_45368 | 461 |
| 53 | 3300042876 | Ga0451577_0000046 | Ga0451577_0000046_104204_105676 | 462 |
| 54 | 3300044712 | Ga0453684_0000178 | Ga0453684_0000178_104204_105676 | 462 |
| 55 | 3300005844 | Ga0068862_100097413 | Ga0068862_1000974133 | 463 |
| 56 | 3300028800 | Ga0265338_10052983 | Ga0265338_100529832 | 463 |
| 57 | 3300042876 | Ga0451577_0000360 | Ga0451577_0000360_50985_52460 | 463 |
| 58 | 3300042876 | Ga0451577_0001348 | Ga0451577_0001348_19305_20780 | 463 |
| 59 | 3300044712 | Ga0453684_0000261 | Ga0453684_0000261_29176_30651 | 463 |
| 60 | 3300044712 | Ga0453684_0001267 | Ga0453684_0001267_29061_30536 | 463 |
| 61 | 3300045051 | Ga0451576_0000354 | Ga0451576_0000354_99974_101449 | 463 |
| 62 | 3300046455 | Ga0495603_0000711 | Ga0495603_0000711_15536_16969 | 464 |
| 63 | 3300005618 | Ga0068864_100000015 | Ga0068864_100000015261 | 465 |
| 64 | 3300026095 | Ga0207676_10000018 | Ga0207676_1000001839 | 465 |
| 65 | 3300036712 | Ga0316584_0079347 | Ga0316584_0079347_710_2152 | 465 |
| 66 | 3300049588 | Ga0501072_0018359 | Ga0501072_0018359_295_1737 | 465 |
| 67 | 3300005337 | Ga0070682_100025786 | Ga0070682_1000257863 | 466 |
| 68 | 3300005338 | Ga0068868_100024807 | Ga0068868_1000248072 | 466 |
| 69 | 3300005340 | Ga0070689_100033735 | Ga0070689_1000337353 | 466 |
| 70 | 3300005356 | Ga0070674_100000012 | Ga0070674_10000001285 | 466 |
| 71 | 3300005356 | Ga0070674_100091516 | Ga0070674_1000915162 | 466 |
| 72 | 3300005439 | Ga0070711_100011956 | Ga0070711_1000119564 | 466 |
| 73 | 3300005544 | Ga0070686_100011276 | Ga0070686_1000112764 | 466 |
| 74 | 3300005549 | Ga0070704_100003568 | Ga0070704_1000035685 | 466 |
| 75 | 3300005718 | Ga0068866_10000062 | Ga0068866_1000006232 | 466 |
| 76 | 3300005842 | Ga0068858_100000075 | Ga0068858_10000007556 | 466 |
| 77 | 3300006038 | Ga0075365_10005759 | Ga0075365_100057592 | 466 |
| 78 | 3300006038 | Ga0075365_10040399 | Ga0075365_100403995 | 466 |
| 79 | 3300006038 | Ga0075365_10041225 | Ga0075365_100412252 | 466 |
| 80 | 3300006038 | Ga0075365_10102937 | Ga0075365_101029372 | 466 |
| 81 | 3300006048 | Ga0075363_100023016 | Ga0075363_1000230162 | 466 |
| 82 | 3300006051 | Ga0075364_10017763 | Ga0075364_100177632 | 466 |
| 83 | 3300006051 | Ga0075364_10046893 | Ga0075364_100468932 | 466 |
| 84 | 3300006051 | Ga0075364_10054618 | Ga0075364_100546182 | 466 |
| 85 | 3300006847 | Ga0075431_100001038 | Ga0075431_1000010388 | 466 |
| 86 | 3300006852 | Ga0075433_10015784 | Ga0075433_100157843 | 466 |
| 87 | 3300006871 | Ga0075434_100005817 | Ga0075434_1000058176 | 466 |
| 88 | 3300009098 | Ga0105245_10005396 | Ga0105245_100053964 | 466 |
| 89 | 3300009176 | Ga0105242_10030340 | Ga0105242_100303402 | 466 |
| 90 | 3300013104 | Ga0157370_10001872 | Ga0157370_1000187214 | 466 |
| 91 | 3300025899 | Ga0207642_10000558 | Ga0207642_100005582 | 466 |
| 92 | 3300025916 | Ga0207663_10013075 | Ga0207663_100130751 | 466 |
| 93 | 3300025927 | Ga0207687_10044256 | Ga0207687_100442562 | 466 |
| 94 | 3300025937 | Ga0207669_10000017 | Ga0207669_1000001770 | 466 |
| 95 | 3300025937 | Ga0207669_10033050 | Ga0207669_100330502 | 466 |
| 96 | 3300026035 | Ga0207703_10000088 | Ga0207703_1000008856 | 466 |
| 97 | 3300027907 | Ga0207428_10012713 | Ga0207428_100127135 | 466 |
| 98 | 3300038443 | Ga0395901_0030013 | Ga0395901_0030013_3757_5247 | 466 |
| 99 | 3300046461 | Ga0495641_0010053 | Ga0495641_0010053_1819_3276 | 466 |
| 100 | 3300048903 | Ga0496100_0095689 | Ga0496100_0095689_343_1800 | 466 |
| 101 | 3300048904 | Ga0496101_0001718 | Ga0496101_0001718_5049_6506 | 466 |
| 102 | 3300048905 | Ga0496102_0029637 | Ga0496102_0029637_292_1749 | 466 |
| 103 | 3300048909 | Ga0496106_0014155 | Ga0496106_0014155_2922_4379 | 466 |
| 104 | 3300048910 | Ga0496107_0005917 | Ga0496107_0005917_24_1481 | 466 |
| 105 | 3300048911 | Ga0496108_0000365 | Ga0496108_0000365_21762_23201 | 466 |
| 106 | 3300048911 | Ga0496108_0006005 | Ga0496108_0006005_1855_3294 | 466 |
| 107 | 3300048911 | Ga0496108_0139991 | Ga0496108_0139991_181_1638 | 466 |
| 108 | 3300048912 | Ga0496109_0000174 | Ga0496109_0000174_10016_11455 | 466 |
| 109 | 3300048912 | Ga0496109_0026910 | Ga0496109_0026910_2869_4308 | 466 |
| 110 | 3300048913 | Ga0496110_0091937 | Ga0496110_0091937_764_2221 | 466 |
| 111 | 3300048914 | Ga0496111_0019089 | Ga0496111_0019089_562_2019 | 466 |
| 112 | 3300048916 | Ga0496113_0018425 | Ga0496113_0018425_2724_4163 | 466 |
| 113 | 3300048917 | Ga0496114_0003970 | Ga0496114_0003970_1617_3074 | 466 |
| 114 | 3300048918 | Ga0496115_0040550 | Ga0496115_0040550_1026_2483 | 466 |
| 115 | 3300049586 | Ga0501070_0089267 | Ga0501070_0089267_832_2271 | 466 |
| 116 | 3300049587 | Ga0501071_0027693 | Ga0501071_0027693_2475_3935 | 466 |
| 117 | 3300049591 | Ga0501075_0112688 | Ga0501075_0112688_549_2009 | 466 |
| 118 | 3300050491 | nmdc:mga00v17_62990_c1 | nmdc:mga00v17_62990_c1_439_1896 | 466 |
| 119 | 3300050492 | nmdc:mga0yw44_101087_c1 | nmdc:mga0yw44_101087_c1_182_1642 | 466 |
| 120 | 3300050492 | nmdc:mga0yw44_1268_c1 | nmdc:mga0yw44_1268_c1_6513_8003 | 466 |
| 121 | 3300050492 | nmdc:mga0yw44_80881_c1 | nmdc:mga0yw44_80881_c1_19_1470 | 466 |
| 122 | 3300050512 | nmdc:mga0n895_8286_c1 | nmdc:mga0n895_8286_c1_5336_6826 | 466 |
| 123 | 3300050515 | nmdc:mga0a205_934_c2 | nmdc:mga0a205_934_c2_4251_5690 | 466 |
| 124 | 3300053085 | Ga0495619_0000008 | Ga0495619_0000008_255197_256636 | 466 |
| 125 | 3300005327 | Ga0070658_10007843 | Ga0070658_100078432 | 467 |
| 126 | 3300005339 | Ga0070660_100014786 | Ga0070660_1000147863 | 467 |
| 127 | 3300005354 | Ga0070675_100016563 | Ga0070675_1000165632 | 467 |
| 128 | 3300005356 | Ga0070674_100011717 | Ga0070674_1000117172 | 467 |
| 129 | 3300005364 | Ga0070673_100164511 | Ga0070673_1001645112 | 467 |
| 130 | 3300005366 | Ga0070659_100130031 | Ga0070659_1001300312 | 467 |
| 131 | 3300005441 | Ga0070700_100006066 | Ga0070700_1000060665 | 467 |
| 132 | 3300005535 | Ga0070684_100021470 | Ga0070684_1000214702 | 467 |
| 133 | 3300005539 | Ga0068853_100011898 | Ga0068853_1000118985 | 467 |
| 134 | 3300005564 | Ga0070664_100038455 | Ga0070664_1000384554 | 467 |
| 135 | 3300006038 | Ga0075365_10006698 | Ga0075365_100066982 | 467 |
| 136 | 3300009098 | Ga0105245_10111013 | Ga0105245_101110133 | 467 |
| 137 | 3300009147 | Ga0114129_10088210 | Ga0114129_100882102 | 467 |
| 138 | 3300010375 | Ga0105239_10305266 | Ga0105239_103052662 | 467 |
| 139 | 3300013308 | Ga0157375_10005672 | Ga0157375_100056728 | 467 |
| 140 | 3300025909 | Ga0207705_10055407 | Ga0207705_100554072 | 467 |
| 141 | 3300025919 | Ga0207657_10002227 | Ga0207657_100022277 | 467 |
| 142 | 3300025926 | Ga0207659_10057283 | Ga0207659_100572833 | 467 |
| 143 | 3300025932 | Ga0207690_10021008 | Ga0207690_100210082 | 467 |
| 144 | 3300025937 | Ga0207669_10026565 | Ga0207669_100265652 | 467 |
| 145 | 3300025940 | Ga0207691_10015522 | Ga0207691_100155225 | 467 |
| 146 | 3300026023 | Ga0207677_10058161 | Ga0207677_100581612 | 467 |
| 147 | 3300026075 | Ga0207708_10001257 | Ga0207708_100012572 | 467 |
| 148 | 3300026089 | Ga0207648_10027315 | Ga0207648_100273155 | 467 |
| 149 | 3300026142 | Ga0207698_10051449 | Ga0207698_100514492 | 467 |
| 150 | 3300046499 | Ga0495594_0000011 | Ga0495594_0000011_20021_21463 | 467 |
| 151 | 3300046642 | Ga0495634_0002740 | Ga0495634_0002740_9660_11108 | 467 |
| 152 | 3300047322 | Ga0495680_0123612 | Ga0495680_0123612_323_1768 | 467 |
| 153 | 3300048909 | Ga0496106_0022190 | Ga0496106_0022190_3222_4673 | 467 |
| 154 | 3300048910 | Ga0496107_0031441 | Ga0496107_0031441_2194_3645 | 467 |
| 155 | 3300048912 | Ga0496109_0093247 | Ga0496109_0093247_333_1784 | 467 |
| 156 | 3300048916 | Ga0496113_0019698 | Ga0496113_0019698_2971_4422 | 467 |
| 157 | 3300048916 | Ga0496113_0138538 | Ga0496113_0138538_177_1625 | 467 |
| 158 | 3300049592 | Ga0501076_0064125 | Ga0501076_0064125_1137_2588 | 467 |
| 159 | 3300049593 | Ga0501077_0083848 | Ga0501077_0083848_171_1634 | 467 |
| 160 | 3300050491 | nmdc:mga00v17_8087_c1 | nmdc:mga00v17_8087_c1_3358_4809 | 467 |
| 161 | 3300050492 | nmdc:mga0yw44_31166_c1 | nmdc:mga0yw44_31166_c1_1601_3061 | 467 |
| 162 | 3300050511 | nmdc:mga08y16_148461_c1 | nmdc:mga08y16_148461_c1_239_1690 | 467 |
| 163 | 3300054114 | Ga0501084_0118298 | Ga0501084_0118298_333_1796 | 467 |
| 164 | 3300031727 | Ga0316576_10046285 | Ga0316576_100462853 | 468 |
| 165 | 3300035398 | Ga0316574_0007529 | Ga0316574_0007529_4328_5785 | 468 |
| 166 | 3300046461 | Ga0495641_0000014 | Ga0495641_0000014_136708_138153 | 468 |
| 167 | 3300046511 | Ga0495608_0000183 | Ga0495608_0000183_37007_38452 | 468 |
| 168 | 3300047320 | Ga0495672_0041236 | Ga0495672_0041236_658_2121 | 468 |
| 169 | 3300053123 | Ga0500614_001513 | Ga0500614_001513_2681_4126 | 468 |
| 170 | 3300045976 | Ga0466967_0005895 | Ga0466967_0005895_784_2241 | 471 |
| 171 | 3300049568 | Ga0501031_0001878 | Ga0501031_0001878_9681_11240 | 471 |
| 172 | 3300049569 | Ga0501032_0007695 | Ga0501032_0007695_4285_5844 | 471 |
| 173 | 3300049570 | Ga0501033_0008747 | Ga0501033_0008747_1991_3550 | 471 |
| 174 | 3300049571 | Ga0501034_0057908 | Ga0501034_0057908_347_1906 | 471 |
| 175 | 3300049571 | Ga0501034_0079255 | Ga0501034_0079255_1692_3251 | 471 |
| 176 | 3300049572 | Ga0501036_0010040 | Ga0501036_0010040_1976_3535 | 471 |
| 177 | 3300049573 | Ga0501037_0001052 | Ga0501037_0001052_4280_5839 | 471 |
| 178 | 3300049574 | Ga0501038_0004347 | Ga0501038_0004347_9658_11217 | 471 |
| 179 | 3300049575 | Ga0501039_0026162 | Ga0501039_0026162_1211_2770 | 471 |
| 180 | 3300049576 | Ga0501040_0036505 | Ga0501040_0036505_55_1614 | 471 |
| 181 | 3300049578 | Ga0501042_0032531 | Ga0501042_0032531_120_1679 | 471 |
| 182 | 3300049579 | Ga0501043_0009171 | Ga0501043_0009171_4262_5821 | 471 |
| 183 | 3300049580 | Ga0501046_0003881 | Ga0501046_0003881_2223_3782 | 471 |
| 184 | 3300049581 | Ga0501047_0004213 | Ga0501047_0004213_1987_3546 | 471 |
| 185 | 3300049582 | Ga0501048_0008394 | Ga0501048_0008394_1969_3528 | 471 |
| 186 | 3300049584 | Ga0501068_0024271 | Ga0501068_0024271_586_2145 | 471 |
| 187 | 3300049585 | Ga0501069_0014612 | Ga0501069_0014612_679_2238 | 471 |
| 188 | 3300049586 | Ga0501070_0003577 | Ga0501070_0003577_2201_3760 | 471 |
| 189 | 3300049588 | Ga0501072_0011231 | Ga0501072_0011231_3442_5001 | 471 |
| 190 | 3300049589 | Ga0501073_0009971 | Ga0501073_0009971_3416_4975 | 471 |
| 191 | 3300049590 | Ga0501074_0013834 | Ga0501074_0013834_1416_2975 | 471 |
| 192 | 3300049741 | Ga0501079_0013853 | Ga0501079_0013853_4286_5845 | 471 |
| 193 | 3300049742 | Ga0501080_0016329 | Ga0501080_0016329_3329_4888 | 471 |
| 194 | 3300049744 | Ga0501083_0009767 | Ga0501083_0009767_1758_3317 | 471 |
| 195 | 3300049822 | Ga0501035_0001452 | Ga0501035_0001452_17424_18983 | 471 |
| 196 | 3300049823 | Ga0501044_0016967 | Ga0501044_0016967_1980_3539 | 471 |
| 197 | 3300049824 | Ga0501045_0022581 | Ga0501045_0022581_987_2546 | 471 |
| 198 | 3300054114 | Ga0501084_0060836 | Ga0501084_0060836_350_1909 | 471 |
| 199 | 3300060353 | Ga0501082_0019366 | Ga0501082_0019366_14_1573 | 471 |
| 200 | 3300048920 | Ga0496117_0004213 | Ga0496117_0004213_2976_4526 | 474 |
| 201 | 3300048921 | Ga0496118_0001908 | Ga0496118_0001908_22229_23779 | 474 |
| 202 | 3300005530 | Ga0070679_100000225 | Ga0070679_10000022510 | 484 |
| 203 | 3300025921 | Ga0207652_10000309 | Ga0207652_1000030943 | 484 |
| 204 | 3300025939 | Ga0207665_10016726 | Ga0207665_100167262 | 484 |
| 205 | 3300026088 | Ga0207641_10000077 | Ga0207641_1000007784 | 484 |
| 206 | 3300001977 | JGI24746J21847_1000510 | JGI24746J21847_10005106 | 488 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ip4-assembly1.cif.gz_A | the high resolution structure of gatcab | 0.8331 | 1 | 456 |
| 2gi3-assembly1.cif.gz_A-2 | crystal structure of glutamyl-trna(gln) amidotransferase subunit a (tm1272) from thermotoga maritima at 1.80 a resolution | 0.8303 | 5 | 456 |
| 4wj3-assembly2.cif.gz_D | crystal structure of the asparagine transamidosome from pseudomonas aeruginosa | 0.8196 | 5 | 456 |
| 3h0r-assembly7.cif.gz_S | structure of trna-dependent amidotransferase gatcab from aquifex aeolicus | 0.8115 | 5 | 456 |
| 3kfu-assembly1.cif.gz_H | crystal structure of the transamidosome | 0.805 | 13 | 457 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9LI77_43_527_3.90.1300.10 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.8444 | 13 | 456 | 3.90.1300.10 |
| 2gi3A01 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.8408 | 1 | 456 | 3.90.1300.10 |
| af_Q5FWT5_3_499_3.90.1300.10 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.84 | 8 | 459 | 3.90.1300.10 |
| 2dqnA00 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.8217 | 4 | 456 | 3.90.1300.10 |
| af_A0A0P0XRM7_54_372_3.90.1300.10 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.8215 | 5 | 217 | 3.90.1300.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D6GLT7-F1-model_v4 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A | 0.8858 | 3 | 299 |
GO:0016740
|
| AF-A0A2V7KPY6-F1-model_v4 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A (EC 6.3.5.-) | 0.8788 | 142 | 310 |
GO:0016740
GO:0016874 |
| AF-A0A2D5V731-F1-model_v4 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A | 0.8724 | 7 | 276 |
GO:0016740
|
| AF-A0A2V7CP85-F1-model_v4 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A | 0.8712 | 1 | 300 |
GO:0016740
|
| AF-A0A7V8ZI79-F1-model_v4 | Glutamyl-tRNA(Gln) amidotransferase subunit A (Glu-ADT subunit A) (EC 6.3.5.7) | 0.863 | 6 | 461 |
GO:0005524
GO:0006412 GO:0016740 GO:0030956 GO:0050567 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar