F314862

General Info

Members Datasets Scaffolds Average Seq Length
206 152 412 196

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100442918|Ga0068853_1004429182
Length 238
Sequence MPRRLLSSQEWNDLVDIAATNFDLRSPKTCVSSEKSQLDALLSNIRACRACAGEFSHEPRPVVQVTSETRLLICGQAPGRRVHESGLPFDDPSGDRLREWLGLDRHVFYGDSRIGVAPMAFCFPGTNPKGGDYPPPPRCATLWRRSLLACLPRVELTLLVGAYAQRWALQHTSGPSMTATVAAWRTYGPAVIPLPHPSWRSTVWLRRNPWFENELAPHLRTRVAHILGGAATPHVPAS

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
37 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
38 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
43 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
86 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
91 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
92 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
93 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
94 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
106 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
107 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
108 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
114 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
133 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
134 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
135 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
136 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
137 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
138 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
139 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
140 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
141 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
144 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
145 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
146 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
147 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
148 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
149 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
150 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
151 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
152 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 0
Isolates 2.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.59
Nodule 1.46
Rhizoplane 1.94
Rhizosphere 77.18
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100442918 3300005539 Bacteria 1221
2 JGI24735J21928_10004000 3300002067 Bacteria 4989
3 Ga0055524_1003335 3300003775 Bacteria 7831
4 Ga0055528_1021164 3300003790 Bacteria 2076
5 Ga0055531_10002841 3300003794 Bacteria 11336
6 Ga0070658_10014202 3300005327 Bacteria 6393
7 Ga0070658_10044728 3300005327 Bacteria 3579
8 Ga0070658_10238319 3300005327 Bacteria 1541
9 Ga0070680_100220635 3300005336 Bacteria 1600
10 Ga0070660_100000228 3300005339 Bacteria 37163
11 Ga0070660_100126321 3300005339 Bacteria 2044
12 Ga0070692_10008979 3300005345 Bacteria 4484
13 Ga0070692_10050774 3300005345 Bacteria 2155
14 Ga0070668_100010099 3300005347 Bacteria 6998
15 Ga0070668_100790838 3300005347 Bacteria 842
16 Ga0070659_100002577 3300005366 Bacteria 12877
17 Ga0070663_100044631 3300005455 Bacteria 3126
18 Ga0070697_100020199 3300005536 Bacteria 5266
19 Ga0070696_100003530 3300005546 Bacteria 10406
20 Ga0070693_100285980 3300005547 Bacteria 1106
21 Ga0068855_100003361 3300005563 Bacteria 19587
22 Ga0068856_100307408 3300005614 Bacteria 1603
23 Ga0068856_101533437 3300005614 Bacteria 680
24 Ga0068862_100001001 3300005844 Bacteria 27048
25 Ga0070716_100102028 3300006173 Bacteria 1761
26 Ga0075433_10143838 3300006852 Bacteria 2120
27 Ga0075434_100001630 3300006871 Bacteria 19105
28 Ga0075434_100073322 3300006871 Bacteria 3416
29 Ga0075436_100007640 3300006914 Bacteria 7386
30 Ga0075436_100095333 3300006914 Bacteria 2070
31 Ga0097620_100989969 3300006931 Bacteria 923
32 Ga0075435_100036418 3300007076 Bacteria 3911
33 Ga0075435_100149258 3300007076 Bacteria 1964
34 Ga0075435_100415772 3300007076 Bacteria 1158
35 Ga0105240_10002395 3300009093 Bacteria 30188
36 Ga0105240_10006262 3300009093 Bacteria 17508
37 Ga0105241_10597274 3300009174 Bacteria 997
38 Ga0105237_10005460 3300009545 Bacteria 14337
39 Ga0105237_10799630 3300009545 Bacteria 950
40 Ga0105238_10002508 3300009551 Bacteria 18368
41 Ga0105238_10328632 3300009551 Bacteria 1515
42 Ga0105238_11060486 3300009551 Bacteria 832
43 Ga0105239_10002456 3300010375 Bacteria 23614
44 Ga0157373_10012682 3300013100 Bacteria 6195
45 Ga0157371_10115106 3300013102 Bacteria 1910
46 Ga0157370_10008921 3300013104 Bacteria 10772
47 Ga0157370_10020605 3300013104 Bacteria 6582
48 Ga0157370_10859482 3300013104 Unclassified 824
49 Ga0157369_10000838 3300013105 Bacteria 39310
50 Ga0157369_10071541 3300013105 Bacteria 3723
51 Ga0157374_10003914 3300013296 Bacteria 12509
52 Ga0157374_11454155 3300013296 Bacteria 708
53 Ga0157372_10003437 3300013307 Bacteria 17085
54 Ga0209026_1012366 3300025250 Bacteria 1491
55 Ga0209759_1005294 3300025256 Bacteria 4566
56 Ga0209565_1000491 3300025263 Bacteria 28967
57 Ga0209673_1002030 3300025273 Bacteria 15409
58 Ga0209675_1009769 3300025291 Bacteria 3353
59 Ga0209564_1000892 3300025295 Bacteria 39200
60 Ga0209564_1007278 3300025295 Bacteria 5745
61 Ga0209758_1001122 3300025297 Bacteria 34484
62 Ga0209256_1001228 3300025299 Bacteria 28537
63 Ga0209256_1002936 3300025299 Bacteria 12801
64 Ga0209257_1000066 3300025304 Bacteria 344166
65 Ga0209257_1063210 3300025304 Bacteria 999
66 Ga0207647_10003183 3300025904 Bacteria 12316
67 Ga0207705_10065073 3300025909 Unclassified 2635
68 Ga0207695_10005616 3300025913 Bacteria 16573
69 Ga0207695_10026284 3300025913 Bacteria 6497
70 Ga0207671_10125844 3300025914 Bacteria 1963
71 Ga0207671_10566946 3300025914 Bacteria 905
72 Ga0207671_10681643 3300025914 Bacteria 818
73 Ga0207657_10003415 3300025919 Bacteria 16949
74 Ga0207657_10021196 3300025919 Bacteria 6121
75 Ga0207694_10132170 3300025924 Bacteria 2001
76 Ga0207665_10120996 3300025939 Bacteria 1849
77 Ga0207667_10003326 3300025949 Bacteria 19847
78 Ga0207668_10006678 3300025972 Bacteria 6822
79 Ga0207668_10676392 3300025972 Bacteria 905
80 Ga0207640_10158992 3300025981 Bacteria 1669
81 Ga0207639_10657809 3300026041 Bacteria 970
82 Ga0207678_10009974 3300026067 Bacteria 8334
83 Ga0268265_10000975 3300028380 Bacteria 26114
84 Ga0268265_10075826 3300028380 Bacteria 2636
85 Ga0265338_10125817 3300028800 Bacteria 2034
86 Ga0265338_10151510 3300028800 Bacteria 1801
87 Ga0265325_10000161 3300031241 Bacteria 47245
88 Ga0265339_10001879 3300031249 Bacteria 15422
89 Ga0265327_10000677 3300031251 Bacteria 54772
90 Ga0265327_10004132 3300031251 Bacteria 13105
91 Ga0265316_10020465 3300031344 Bacteria 5630
92 Ga0307513_10008063 3300031456 Bacteria 13522
93 Ga0265313_10001891 3300031595 Bacteria 19016
94 Ga0265314_10032625 3300031711 Bacteria 3828
95 Ga0265342_10037201 3300031712 Bacteria 2969
96 Ga0307413_10211053 3300031824 Bacteria 1410
97 Ga0307407_10266678 3300031903 Bacteria 1180
98 Ga0307412_10001349 3300031911 Bacteria 13650
99 Ga0307409_100956824 3300031995 Bacteria 872
100 Ga0307414_10144805 3300032004 Bacteria 1865
101 Ga0307414_10306247 3300032004 Bacteria 1346
102 Ga0307414_10458519 3300032004 Bacteria 1119
103 Ga0307414_10525155 3300032004 Bacteria 1051
104 Ga0307414_10569916 3300032004 Bacteria 1011
105 Ga0307414_10670201 3300032004 Bacteria 936
106 Ga0307411_10076878 3300032005 Bacteria 2283
107 Ga0307411_10496304 3300032005 Bacteria 1031
108 Ga0307510_10136278 3300033180 Bacteria 2112
109 Ga0373943_0092073 3300035170 Bacteria 1572
110 Ga0373931_0275015 3300035691 Bacteria 1032
111 Ga0373933_0232614 3300035724 Bacteria 1184
112 Ga0373937_0485251 3300036401 Bacteria 1174
113 Ga0395899_0132970 3300037312 Bacteria 1775
114 Ga0395899_0455811 3300037312 Bacteria 836
115 Ga0395900_0007068 3300037418 Bacteria 11624
116 Ga0395898_0169921 3300037466 Bacteria 2084
117 Ga0395898_0568665 3300037466 Bacteria 1076
118 Ga0395898_1668835 3300037466 Bacteria 560
119 Ga0395905_0228894 3300037471 Bacteria 1738
120 Ga0395905_0256364 3300037471 Bacteria 1634
121 Ga0436364_0113449 3300037853 Bacteria 1842
122 Ga0395901_0167714 3300038443 Bacteria 2305
123 Ga0395901_0327761 3300038443 Bacteria 1583
124 Ga0395901_0570533 3300038443 Bacteria 1144
125 Ga0436365_1291533 3300039437 Bacteria 2680
126 Ga0439448_0004647 3300042005 Bacteria 3883
127 Ga0466960_0017197 3300044901 Bacteria 3148
128 Ga0466959_0106354 3300045049 Bacteria 2006
129 Ga0466959_0217829 3300045049 Bacteria 1325
130 Ga0451576_0119765 3300045051 Bacteria 2740
131 Ga0495638_0002300 3300046460 Bacteria 15755
132 Ga0495584_0119434 3300046491 Bacteria 1335
133 Ga0495606_0005604 3300046507 Bacteria 11939
134 Ga0495616_0000461 3300046513 Bacteria 30938
135 Ga0495616_0058552 3300046513 Bacteria 1897
136 Ga0495632_0116134 3300046519 Bacteria 1253
137 Ga0495637_0007257 3300046520 Bacteria 5512
138 Ga0495643_0113702 3300046522 Bacteria 1374
139 Ga0495642_0047681 3300046528 Bacteria 1755
140 Ga0495652_0012872 3300046529 Bacteria 7537
141 Ga0495652_0316003 3300046529 Bacteria 1130
142 Ga0495645_0284128 3300046543 Bacteria 1087
143 Ga0495622_0013554 3300046557 Bacteria 3781
144 Ga0495668_0010342 3300046616 Bacteria 5651
145 Ga0495668_0037579 3300046616 Bacteria 2709
146 Ga0495625_0013180 3300046660 Bacteria 6658
147 Ga0495625_0059311 3300046660 Bacteria 2715
148 Ga0495588_0079327 3300046674 Bacteria 1713
149 Ga0495669_0009963 3300046684 Bacteria 4017
150 Ga0495669_0110106 3300046684 Bacteria 1285
151 Ga0495613_0001386 3300046689 Bacteria 18424
152 Ga0495660_0050317 3300046810 Bacteria 2271
153 Ga0495677_0019705 3300047445 Bacteria 2446
154 Ga0495679_002473 3300047446 Bacteria 9391
155 Ga0495673_0001293 3300047469 Bacteria 20448
156 Ga0495686_0151431 3300047472 Bacteria 1361
157 Ga0496106_0456671 3300048909 Bacteria 1026
158 Ga0496115_0006124 3300048918 Bacteria 8794
159 Ga0496115_0372363 3300048918 Bacteria 1162
160 Ga0496115_0904398 3300048918 Bacteria 680
161 Ga0496121_0346528 3300048924 Bacteria 991
162 Ga0496122_0002860 3300048925 Bacteria 23639
163 Ga0496123_0001072 3300048926 Bacteria 41355
164 Ga0496125_0001101 3300048928 Bacteria 41572
165 Ga0501033_0087988 3300049570 Bacteria 2273
166 Ga0501033_0289641 3300049570 Bacteria 1155
167 Ga0501036_0210672 3300049572 Bacteria 1633
168 Ga0501037_0522538 3300049573 Bacteria 803
169 Ga0501042_0066646 3300049578 Bacteria 2574
170 Ga0501043_0470373 3300049579 Bacteria 942
171 Ga0501046_0308866 3300049580 Bacteria 1154
172 Ga0501047_0233304 3300049581 Bacteria 1693
173 Ga0501047_0825967 3300049581 Bacteria 741
174 Ga0501047_0869140 3300049581 Bacteria 715
175 Ga0501048_0051065 3300049582 Bacteria 2944
176 Ga0501257_022921 3300049686 Bacteria 1479
177 Ga0501035_0789349 3300049822 Bacteria 759
178 Ga0501045_0066609 3300049824 Bacteria 2644
179 nmdc:mga05p37_210376_c1 3300050507 Bacteria 2351
180 nmdc:mga0n895_255357_c1 3300050512 Bacteria 1779
181 nmdc:mga0n895_2655_c1 3300050512 Bacteria 14111
182 nmdc:mga0rr50_238522_c1 3300050513 Bacteria 1507
183 nmdc:mga08x19_79772_c1 3300050514 Bacteria 2147
184 nmdc:mga08x19_87363_c1 3300050514 Bacteria 2054
185 nmdc:mga0a205_163193_c1 3300050515 Bacteria 2124
186 Ga0500643_031884 3300053087 Bacteria 1603
187 Ga0500644_0001433 3300053088 Bacteria 6313
188 Ga0500646_0065151 3300053090 Bacteria 1081
189 Ga0500566_0256922 3300053094 Bacteria 846
190 Ga0500556_0000706 3300053104 Bacteria 20354
191 Ga0500618_000063 3300053125 Bacteria 93515
192 Ga0500658_0003149 3300053134 Bacteria 6295
193 Ga0500559_0000152 3300053136 Bacteria 54664
194 Ga0500573_0054219 3300053140 Bacteria 2302
195 Ga0500577_0001126 3300053142 Bacteria 6849
196 Ga0500616_0058851 3300053153 Bacteria 1997
197 Ga0500622_0030353 3300053156 Bacteria 2838
198 Ga0500637_0001892 3300053178 Bacteria 9096
199 Ga0500645_001516 3300053730 Bacteria 11624
200 Ga0500609_000762 3300053731 Bacteria 4834
201 2513868214 2513237138 Bacteria 7368160
202 2644550392 2643221699 Bacteria 5731501
203 2838016916 2838016132 Bacteria 6577831
204 2871482429 2871481445 Bacteria 6700002
205 2928972861 2928972540 Bacteria 3058286
206 2977242640 2977240413 Bacteria 3191065
207 Ga0068853_100442918
208 JGI24735J21928_10004000
209 Ga0055524_1003335
210 Ga0055528_1021164
211 Ga0055531_10002841
212 Ga0070658_10014202
213 Ga0070658_10044728
214 Ga0070658_10238319
215 Ga0070680_100220635
216 Ga0070660_100000228
217 Ga0070660_100126321
218 Ga0070692_10008979
219 Ga0070692_10050774
220 Ga0070668_100010099
221 Ga0070668_100790838
222 Ga0070659_100002577
223 Ga0070663_100044631
224 Ga0070697_100020199
225 Ga0070696_100003530
226 Ga0070693_100285980
227 Ga0068855_100003361
228 Ga0068856_100307408
229 Ga0068856_101533437
230 Ga0068862_100001001
231 Ga0070716_100102028
232 Ga0075433_10143838
233 Ga0075434_100001630
234 Ga0075434_100073322
235 Ga0075436_100007640
236 Ga0075436_100095333
237 Ga0097620_100989969
238 Ga0075435_100036418
239 Ga0075435_100149258
240 Ga0075435_100415772
241 Ga0105240_10002395
242 Ga0105240_10006262
243 Ga0105241_10597274
244 Ga0105237_10005460
245 Ga0105237_10799630
246 Ga0105238_10002508
247 Ga0105238_10328632
248 Ga0105238_11060486
249 Ga0105239_10002456
250 Ga0157373_10012682
251 Ga0157371_10115106
252 Ga0157370_10008921
253 Ga0157370_10020605
254 Ga0157370_10859482
255 Ga0157369_10000838
256 Ga0157369_10071541
257 Ga0157374_10003914
258 Ga0157374_11454155
259 Ga0157372_10003437
260 Ga0209026_1012366
261 Ga0209759_1005294
262 Ga0209565_1000491
263 Ga0209673_1002030
264 Ga0209675_1009769
265 Ga0209564_1000892
266 Ga0209564_1007278
267 Ga0209758_1001122
268 Ga0209256_1001228
269 Ga0209256_1002936
270 Ga0209257_1000066
271 Ga0209257_1063210
272 Ga0207647_10003183
273 Ga0207705_10065073
274 Ga0207695_10005616
275 Ga0207695_10026284
276 Ga0207671_10125844
277 Ga0207671_10566946
278 Ga0207671_10681643
279 Ga0207657_10003415
280 Ga0207657_10021196
281 Ga0207694_10132170
282 Ga0207665_10120996
283 Ga0207667_10003326
284 Ga0207668_10006678
285 Ga0207668_10676392
286 Ga0207640_10158992
287 Ga0207639_10657809
288 Ga0207678_10009974
289 Ga0268265_10000975
290 Ga0268265_10075826
291 Ga0265338_10125817
292 Ga0265338_10151510
293 Ga0265325_10000161
294 Ga0265339_10001879
295 Ga0265327_10000677
296 Ga0265327_10004132
297 Ga0265316_10020465
298 Ga0307513_10008063
299 Ga0265313_10001891
300 Ga0265314_10032625
301 Ga0265342_10037201
302 Ga0307413_10211053
303 Ga0307407_10266678
304 Ga0307412_10001349
305 Ga0307409_100956824
306 Ga0307414_10144805
307 Ga0307414_10306247
308 Ga0307414_10458519
309 Ga0307414_10525155
310 Ga0307414_10569916
311 Ga0307414_10670201
312 Ga0307411_10076878
313 Ga0307411_10496304
314 Ga0307510_10136278
315 Ga0373943_0092073
316 Ga0373931_0275015
317 Ga0373933_0232614
318 Ga0373937_0485251
319 Ga0395899_0132970
320 Ga0395899_0455811
321 Ga0395900_0007068
322 Ga0395898_0169921
323 Ga0395898_0568665
324 Ga0395898_1668835
325 Ga0395905_0228894
326 Ga0395905_0256364
327 Ga0436364_0113449
328 Ga0395901_0167714
329 Ga0395901_0327761
330 Ga0395901_0570533
331 Ga0436365_1291533
332 Ga0439448_0004647
333 Ga0466960_0017197
334 Ga0466959_0106354
335 Ga0466959_0217829
336 Ga0451576_0119765
337 Ga0495638_0002300
338 Ga0495584_0119434
339 Ga0495606_0005604
340 Ga0495616_0000461
341 Ga0495616_0058552
342 Ga0495632_0116134
343 Ga0495637_0007257
344 Ga0495643_0113702
345 Ga0495642_0047681
346 Ga0495652_0012872
347 Ga0495652_0316003
348 Ga0495645_0284128
349 Ga0495622_0013554
350 Ga0495668_0010342
351 Ga0495668_0037579
352 Ga0495625_0013180
353 Ga0495625_0059311
354 Ga0495588_0079327
355 Ga0495669_0009963
356 Ga0495669_0110106
357 Ga0495613_0001386
358 Ga0495660_0050317
359 Ga0495677_0019705
360 Ga0495679_002473
361 Ga0495673_0001293
362 Ga0495686_0151431
363 Ga0496106_0456671
364 Ga0496115_0006124
365 Ga0496115_0372363
366 Ga0496115_0904398
367 Ga0496121_0346528
368 Ga0496122_0002860
369 Ga0496123_0001072
370 Ga0496125_0001101
371 Ga0501033_0087988
372 Ga0501033_0289641
373 Ga0501036_0210672
374 Ga0501037_0522538
375 Ga0501042_0066646
376 Ga0501043_0470373
377 Ga0501046_0308866
378 Ga0501047_0233304
379 Ga0501047_0825967
380 Ga0501047_0869140
381 Ga0501048_0051065
382 Ga0501257_022921
383 Ga0501035_0789349
384 Ga0501045_0066609
385 nmdc:mga05p37_210376_c1
386 nmdc:mga0n895_255357_c1
387 nmdc:mga0n895_2655_c1
388 nmdc:mga0rr50_238522_c1
389 nmdc:mga08x19_79772_c1
390 nmdc:mga08x19_87363_c1
391 nmdc:mga0a205_163193_c1
392 Ga0500643_031884
393 Ga0500644_0001433
394 Ga0500646_0065151
395 Ga0500566_0256922
396 Ga0500556_0000706
397 Ga0500618_000063
398 Ga0500658_0003149
399 Ga0500559_0000152
400 Ga0500573_0054219
401 Ga0500577_0001126
402 Ga0500616_0058851
403 Ga0500622_0030353
404 Ga0500637_0001892
405 Ga0500645_001516
406 Ga0500609_000762
407 2513868214
408 2644550392
409 2838016916
410 2871482429
411 2928972861
412 2977242640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

63

220

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ikb-assembly2.cif.gz_B the structure of a conserved protein from streptococcus mutans ua159. 0.9026 9 200
3ikb-assembly2.cif.gz_B the structure of a conserved protein from streptococcus mutans ua159. 0.8809 9 200
8iig-assembly1.cif.gz_A complex form of msmudgx h109a mutant and uracil- obtained from uracil dna (ttutt) post its cleavage by udgx h109a 0.7421 9 195
8iie-assembly1.cif.gz_A complex form of msmudgx and uracil- obtained from uracil dna (ttutt) post its cleavage by msmudgx 0.7385 9 195
8iii-assembly1.cif.gz_A complex form of msmudgx h109c mutant and uracil- obtained from uracil dna (ttutt) post its cleavage by msmudgx h109c 0.736 9 195
ID Description Score Start End Superfamily
3ikbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9329 32 200 3.40.470.10
3ikbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8111 32 200 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.6973 9 201 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.692 9 201 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.6793 9 201 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A7W0X675-F1-model_v4 Uracil-DNA glycosylase family protein 0.9986 9 155
AF-A0A1X7CM00-F1-model_v4 Uracil-DNA glycosylase 0.9985 26 201
AF-A0A1D9HAA0-F1-model_v4 Uracil-DNA glycosylase 0.9982 9 198
AF-A0A4R5MFA0-F1-model_v4 DUF488 family protein 0.9981 10 197
AF-A0A522IAB9-F1-model_v4 DUF488 family protein 0.9978 9 198

Map