F314827

General Info

Members Datasets Scaffolds Average Seq Length
206 145 196 404

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10155256|Ga0070681_101552562
Length 425
Sequence MRRRAFREIPPTAGLPLRAADLLPRRGALPETLAAQLGTPPLLLTCSGTAALLVALRTLGERAPHRRVVVVPAYTCPLVAIAVRSLGLHLRLCDSRPGHFDMDPAALARACRADTLAVVPTHLAGLVADVDMARTIAHQAGAWVIEDAAQALGARDRGYSVGLRGDIGFFSLAAGKGLSIHEGGLLTARDPSLRAALRRTHDTLAPRGGWWEWRRSVELLGLAALYRPGGLALAYGRPLRRKLRQGDPVAAVGDRFDPLIPLHRVGRWRQGVGTRAAARWPAFLAERRALASRRVARLQQIDGLDVITPGVGTEGSWPFLLLRLPDEACRDAVLARLWTAGVGVSRLFVHALPDYAYLADRVPQEPMPNARDFAQCTLTLSNSPWLDDATFEDVALVIGQVLAGAHSRRGECDEWRTAEEHAPSP

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
3 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
4 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
5 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
6 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
7 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
8 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
9 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
10 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
57 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
58 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
103 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
104 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
114 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
117 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
145 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.15
Metatranscriptomes 0
Isolates 4.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.62
Nodule 0.97
Rhizoplane 0.49
Rhizosphere 75.73
Stem 0
Stem Tuber 0
Unclassified 10.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000605 3300002737 Bacteria 25839
2 JGI25162J39368_1001369 3300002737 Bacteria 13418
3 JGI25157J39369_1001032 3300002741 Bacteria 12792
4 JGI25164J39214_1000390 3300002772 Bacteria 25835
5 JGI25164J39214_1000439 3300002772 Bacteria 22628
6 JGI25165J46597_1000725 3300003214 Bacteria 25839
7 rootL2_10081353 3300003322 Bacteria 3488
8 Ga0055526_1000012 3300003771 Bacteria 234368
9 Ga0055537_1000021 3300003773 Bacteria 116840
10 Ga0055524_1000037 3300003775 Bacteria 167140
11 Ga0055534_1000006 3300003784 Bacteria 234368
12 Ga0055528_1000006 3300003790 Bacteria 234368
13 Ga0065165_1000566 3300005262 Bacteria 54948
14 Ga0070670_100004512 3300005331 Bacteria 11671
15 Ga0070660_100021077 3300005339 Bacteria 4800
16 Ga0070659_100007777 3300005366 Bacteria 7797
17 Ga0070659_100133803 3300005366 Bacteria 2015
18 Ga0070667_100031251 3300005367 Bacteria 4440
19 Ga0070667_100080763 3300005367 Bacteria 2782
20 Ga0070713_100001474 3300005436 Bacteria 15027
21 Ga0070663_100037618 3300005455 Bacteria 3370
22 Ga0070663_100063153 3300005455 Bacteria 2673
23 Ga0070662_100055644 3300005457 Bacteria 2870
24 Ga0070681_10040856 3300005458 Bacteria 4646
25 Ga0070681_10051234 3300005458 Unclassified 4117
26 Ga0070681_10108477 3300005458 Bacteria 2716
27 Ga0070681_10155256 3300005458 Bacteria 2214
28 Ga0070685_10000461 3300005466 Bacteria 23671
29 Ga0070698_100017753 3300005471 Bacteria 7493
30 Ga0070699_100114632 3300005518 Bacteria 2368
31 Ga0070679_100039770 3300005530 Bacteria 4675
32 Ga0070679_100053143 3300005530 Unclassified 4033
33 Ga0070679_100149893 3300005530 Bacteria 2309
34 Ga0068853_100002636 3300005539 Bacteria 13511
35 Ga0068853_100003899 3300005539 Bacteria 11435
36 Ga0068853_100018029 3300005539 Bacteria 5836
37 Ga0068853_100066463 3300005539 Bacteria 3131
38 Ga0070696_100015121 3300005546 Bacteria 5181
39 Ga0070696_100024281 3300005546 Bacteria 4120
40 Ga0070693_100054140 3300005547 Bacteria 2306
41 Ga0070665_100001431 3300005548 Bacteria 27984
42 Ga0070665_100047084 3300005548 Bacteria 4328
43 Ga0068855_100004495 3300005563 Bacteria 17044
44 Ga0068855_100043549 3300005563 Bacteria 5316
45 Ga0068857_100014373 3300005577 Bacteria 6901
46 Ga0068857_100135300 3300005577 Bacteria 2225
47 Ga0068854_100001789 3300005578 Bacteria 13094
48 Ga0068854_100062286 3300005578 Bacteria 2704
49 Ga0070702_100018753 3300005615 Unclassified 3594
50 Ga0068863_100006400 3300005841 Bacteria 11545
51 Ga0068863_100304090 3300005841 Bacteria 1547
52 Ga0070712_100199309 3300006175 Bacteria 1571
53 Ga0068865_100017240 3300006881 Bacteria 4642
54 Ga0079104_1000240 3300006946 Bacteria 72956
55 Ga0105251_10001961 3300009011 Bacteria 16825
56 Ga0105240_10000609 3300009093 Bacteria 66384
57 Ga0105240_10053958 3300009093 Bacteria 5040
58 Ga0105241_10099051 3300009174 Bacteria 2314
59 Ga0105238_10012418 3300009551 Bacteria 8591
60 Ga0105249_10094316 3300009553 Bacteria 2805
61 Ga0105239_10009035 3300010375 Bacteria 11284
62 Ga0105239_10044428 3300010375 Bacteria 4870
63 Ga0105239_10071872 3300010375 Bacteria 3801
64 Ga0157373_10035698 3300013100 Bacteria 3568
65 Ga0157371_10025302 3300013102 Bacteria 4327
66 Ga0157371_10119374 3300013102 Bacteria 1874
67 Ga0157371_10146393 3300013102 Bacteria 1683
68 Ga0157370_10000662 3300013104 Bacteria 42848
69 Ga0157370_10019836 3300013104 Bacteria 6728
70 Ga0157372_10009430 3300013307 Bacteria 10386
71 Ga0157372_10031116 3300013307 Bacteria 5843
72 Ga0157372_10154518 3300013307 Bacteria 2650
73 Ga0157372_10220223 3300013307 Bacteria 2200
74 Ga0183369_1020 3300015685 Bacteria 111322
75 Ga0183360_10002 3300015689 Bacteria 953821
76 Ga0207427_100118 3300025231 Bacteria 102109
77 Ga0207427_100120 3300025231 Bacteria 101516
78 Ga0209437_100020 3300025233 Bacteria 656374
79 Ga0209437_100231 3300025233 Bacteria 94387
80 Ga0209026_1000037 3300025250 Bacteria 282562
81 Ga0209233_1000020 3300025261 Bacteria 798224
82 Ga0209233_1000147 3300025261 Bacteria 186517
83 Ga0209233_1016709 3300025261 Bacteria 2016
84 Ga0209565_1000002 3300025263 Bacteria 1423083
85 Ga0209673_1000002 3300025273 Bacteria 1423083
86 Ga0209675_1000002 3300025291 Bacteria 1423083
87 Ga0209564_1000004 3300025295 Bacteria 1424639
88 Ga0209256_1000004 3300025299 Bacteria 1424643
89 Ga0207713_1008532 3300025735 Bacteria 5887
90 Ga0207647_10000700 3300025904 Bacteria 26295
91 Ga0207707_10031108 3300025912 Bacteria 4670
92 Ga0207707_10039209 3300025912 Bacteria 4142
93 Ga0207695_10000007 3300025913 Bacteria 1092551
94 Ga0207695_10018412 3300025913 Bacteria 8078
95 Ga0207695_10021772 3300025913 Bacteria 7302
96 Ga0207671_10014511 3300025914 Bacteria 6222
97 Ga0207671_10019695 3300025914 Bacteria 5153
98 Ga0207657_10042130 3300025919 Bacteria 4031
99 Ga0207657_10121998 3300025919 Bacteria 2144
100 Ga0207657_10122040 3300025919 Bacteria 2143
101 Ga0207652_10049997 3300025921 Bacteria 3581
102 Ga0207652_10136871 3300025921 Bacteria 2188
103 Ga0207646_10028965 3300025922 Bacteria 5037
104 Ga0207694_10002959 3300025924 Bacteria 13645
105 Ga0207650_10007249 3300025925 Bacteria 7553
106 Ga0207700_10102431 3300025928 Bacteria 2286
107 Ga0207664_10000026 3300025929 Bacteria 194571
108 Ga0207664_10014498 3300025929 Bacteria 5694
109 Ga0207644_10133468 3300025931 Bacteria 1904
110 Ga0207690_10003519 3300025932 Bacteria 9330
111 Ga0207690_10026659 3300025932 Bacteria 3641
112 Ga0207690_10230573 3300025932 Bacteria 1421
113 Ga0207706_10016229 3300025933 Bacteria 6730
114 Ga0207706_10020265 3300025933 Bacteria 5977
115 Ga0207704_10114758 3300025938 Bacteria 1829
116 Ga0207665_10111521 3300025939 Bacteria 1923
117 Ga0207667_10007122 3300025949 Bacteria 13499
118 Ga0207667_10030752 3300025949 Bacteria 5802
119 Ga0207667_10093207 3300025949 Bacteria 3110
120 Ga0207712_10000197 3300025961 Bacteria 61066
121 Ga0207658_10015119 3300025986 Bacteria 5293
122 Ga0207658_10039606 3300025986 Bacteria 3401
123 Ga0207639_10001062 3300026041 Bacteria 18645
124 Ga0207639_10001158 3300026041 Bacteria 17882
125 Ga0207678_10048376 3300026067 Bacteria 3675
126 Ga0207702_10125161 3300026078 Bacteria 2306
127 Ga0207641_10069464 3300026088 Bacteria 3024
128 Ga0207674_10008153 3300026116 Bacteria 12146
129 Ga0207674_10028427 3300026116 Bacteria 5902
130 Ga0207674_10068623 3300026116 Bacteria 3568
131 Ga0209281_1000313 3300027111 Bacteria 86484
132 Ga0268266_10000006 3300028379 Bacteria 1410021
133 Ga0268266_10017869 3300028379 Bacteria 6043
134 Ga0265327_10003963 3300031251 Bacteria 13524
135 Ga0395899_0015695 3300037312 Bacteria 5775
136 Ga0395899_0030414 3300037312 Bacteria 4061
137 Ga0395900_0043991 3300037418 Bacteria 4602
138 Ga0395901_0002971 3300038443 Bacteria 17103
139 Ga0395901_0003001 3300038443 Bacteria 17020
140 Ga0395901_0043917 3300038443 Bacteria 4635
141 Ga0395901_0064734 3300038443 Bacteria 3806
142 Ga0436365_0281649 3300039437 Bacteria 2099
143 Ga0451577_0013048 3300042876 Bacteria 7795
144 Ga0466982_0000381 3300044672 Bacteria 12638
145 Ga0466959_0009051 3300045049 Bacteria 7064
146 Ga0495627_001602 3300046453 Bacteria 12661
147 Ga0495591_001265 3300046458 Bacteria 16172
148 Ga0495583_0003495 3300046506 Bacteria 11905
149 Ga0495606_0006812 3300046507 Bacteria 10434
150 Ga0495606_0013905 3300046507 Bacteria 6318
151 Ga0495606_0019015 3300046507 Bacteria 5130
152 Ga0495620_0001173 3300046515 Bacteria 16042
153 Ga0495632_0002953 3300046519 Bacteria 12465
154 Ga0495637_0008698 3300046520 Bacteria 4978
155 Ga0495643_0027043 3300046522 Bacteria 3229
156 Ga0495654_0002468 3300046530 Bacteria 11893
157 Ga0495654_0013512 3300046530 Bacteria 4368
158 Ga0495622_0145524 3300046557 Bacteria 1074
159 Ga0495633_0000648 3300046558 Bacteria 32320
160 Ga0495661_0001947 3300046665 Bacteria 16378
161 Ga0495589_0004089 3300046794 Bacteria 7811
162 Ga0495672_0018155 3300047320 Bacteria 4681
163 Ga0495679_003858 3300047446 Bacteria 7096
164 Ga0495681_0017189 3300047470 Bacteria 4027
165 Ga0495681_0017381 3300047470 Bacteria 3994
166 Ga0495686_0116585 3300047472 Bacteria 1596
167 Ga0496101_0107737 3300048904 Bacteria 2094
168 Ga0496117_0004018 3300048920 Bacteria 16586
169 Ga0496118_0021066 3300048921 Bacteria 5755
170 Ga0496119_0013565 3300048922 Bacteria 6475
171 Ga0496120_0052319 3300048923 Bacteria 2326
172 Ga0496121_0001076 3300048924 Bacteria 48261
173 Ga0496122_0027898 3300048925 Bacteria 4812
174 Ga0496123_0030477 3300048926 Bacteria 3947
175 Ga0496124_0004361 3300048927 Bacteria 16552
176 Ga0496125_0004304 3300048928 Bacteria 16529
177 Ga0496125_0102518 3300048928 Bacteria 2103
178 Ga0496126_0016406 3300048929 Bacteria 7408
179 Ga0501031_0004231 3300049568 Bacteria 9272
180 Ga0501032_0002075 3300049569 Bacteria 15819
181 Ga0501033_0010047 3300049570 Bacteria 7265
182 Ga0501034_0009482 3300049571 Bacteria 10190
183 Ga0501036_0023458 3300049572 Bacteria 5198
184 Ga0501037_0003644 3300049573 Bacteria 11178
185 Ga0501039_0026145 3300049575 Bacteria 4485
186 Ga0501043_0020348 3300049579 Bacteria 5205
187 Ga0501046_0008146 3300049580 Bacteria 9155
188 Ga0501047_0065149 3300049581 Bacteria 3512
189 Ga0501048_0015431 3300049582 Bacteria 5642
190 Ga0501080_0019179 3300049742 Bacteria 6333
191 Ga0501035_0002506 3300049822 Bacteria 17942
192 Ga0501044_0029433 3300049823 Bacteria 5791
193 Ga0501044_0332499 3300049823 Bacteria 1442
194 Ga0500651_0000513 3300053093 Bacteria 19980
195 Ga0500651_0022061 3300053093 Bacteria 3976
196 Ga0500562_000937 3300053108 Bacteria 7099

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046557 Ga0495622_0145524 Ga0495622_0145524_36_1043 333
2 3300045049 Ga0466959_0009051 Ga0466959_0009051_58_1290 363
3 3300039437 Ga0436365_0281649 Ga0436365_0281649_64_1257 366
4 3300046507 Ga0495606_0013905 Ga0495606_0013905_3604_4821 368
5 3300053093 Ga0500651_0022061 Ga0500651_0022061_2712_3956 378
6 3300046520 Ga0495637_0008698 Ga0495637_0008698_3084_4307 379
7 3300046558 Ga0495633_0000648 Ga0495633_0000648_2248_3486 381
8 3300037312 Ga0395899_0015695 Ga0395899_0015695_2421_3629 382
9 3300053108 Ga0500562_000937 Ga0500562_000937_3935_5164 384
10 3300013307 Ga0157372_10009430 Ga0157372_1000943010 386
11 3300042876 Ga0451577_0013048 Ga0451577_0013048_5834_7069 388
12 iso_pu_bacteria 2946006987 2946013310 393
13 iso_pu_bacteria 2675903420 2677897107 394
14 3300044672 Ga0466982_0000381 Ga0466982_0000381_9214_10440 395
15 iso_pu_bacteria 2908446538 2908452557 395
16 iso_pu_bacteria 2941489479 2941494181 395
17 3300005367 Ga0070667_100080763 Ga0070667_1000807632 396
18 3300005455 Ga0070663_100063153 Ga0070663_1000631532 396
19 3300005539 Ga0068853_100002636 Ga0068853_1000026362 396
20 3300005548 Ga0070665_100047084 Ga0070665_1000470846 396
21 3300005563 Ga0068855_100004495 Ga0068855_1000044952 396
22 3300005841 Ga0068863_100006400 Ga0068863_1000064002 396
23 3300010375 Ga0105239_10009035 Ga0105239_100090356 396
24 3300025949 Ga0207667_10007122 Ga0207667_100071223 396
25 3300025986 Ga0207658_10039606 Ga0207658_100396062 396
26 3300026041 Ga0207639_10001062 Ga0207639_100010622 396
27 3300026088 Ga0207641_10069464 Ga0207641_100694644 396
28 3300028379 Ga0268266_10017869 Ga0268266_100178692 396
29 iso_pu_bacteria 2687453130 2687583861 396
30 3300005458 Ga0070681_10051234 Ga0070681_100512343 397
31 3300005471 Ga0070698_100017753 Ga0070698_1000177535 397
32 3300005518 Ga0070699_100114632 Ga0070699_1001146323 397
33 3300005530 Ga0070679_100053143 Ga0070679_1000531435 397
34 3300005546 Ga0070696_100024281 Ga0070696_1000242812 397
35 3300005547 Ga0070693_100054140 Ga0070693_1000541402 397
36 3300005615 Ga0070702_100018753 Ga0070702_1000187533 397
37 3300025912 Ga0207707_10039209 Ga0207707_100392094 397
38 3300025921 Ga0207652_10049997 Ga0207652_100499972 397
39 3300025922 Ga0207646_10028965 Ga0207646_100289653 397
40 3300025939 Ga0207665_10111521 Ga0207665_101115213 397
41 3300046507 Ga0495606_0019015 Ga0495606_0019015_2506_3723 397
42 3300047320 Ga0495672_0018155 Ga0495672_0018155_1453_2670 397
43 iso_pu_bacteria 2537561836 2538832170 397
44 iso_pu_bacteria 2895395659 2895398037 397
45 iso_pu_bacteria 2908669403 2908671062 397
46 iso_pu_bacteria 2939611941 2939612614 397
47 3300003322 rootL2_10081353 rootL2_100813535 398
48 3300003771 Ga0055526_1000012 Ga0055526_1000012177 398
49 3300003773 Ga0055537_1000021 Ga0055537_100002144 398
50 3300003775 Ga0055524_1000037 Ga0055524_1000037121 398
51 3300003784 Ga0055534_1000006 Ga0055534_1000006177 398
52 3300003790 Ga0055528_1000006 Ga0055528_1000006177 398
53 3300015689 Ga0183360_10002 Ga0183360_10002189 398
54 3300025263 Ga0209565_1000002 Ga0209565_1000002784 398
55 3300025273 Ga0209673_1000002 Ga0209673_1000002784 398
56 3300025291 Ga0209675_1000002 Ga0209675_1000002784 398
57 3300025295 Ga0209564_1000004 Ga0209564_1000004785 398
58 3300025299 Ga0209256_1000004 Ga0209256_1000004785 398
59 3300048904 Ga0496101_0107737 Ga0496101_0107737_196_1392 398
60 3300048924 Ga0496121_0001076 Ga0496121_0001076_41206_42435 398
61 iso_pu_bacteria 2945961074 2945966831 398
62 3300005331 Ga0070670_100004512 Ga0070670_1000045122 399
63 3300005367 Ga0070667_100031251 Ga0070667_1000312514 399
64 3300005455 Ga0070663_100037618 Ga0070663_1000376182 399
65 3300005539 Ga0068853_100003899 Ga0068853_1000038992 399
66 3300005539 Ga0068853_100066463 Ga0068853_1000664634 399
67 3300005548 Ga0070665_100001431 Ga0070665_10000143111 399
68 3300005563 Ga0068855_100043549 Ga0068855_1000435495 399
69 3300005577 Ga0068857_100014373 Ga0068857_1000143738 399
70 3300005577 Ga0068857_100135300 Ga0068857_1001353001 399
71 3300005578 Ga0068854_100001789 Ga0068854_1000017898 399
72 3300005841 Ga0068863_100304090 Ga0068863_1003040901 399
73 3300006881 Ga0068865_100017240 Ga0068865_1000172404 399
74 3300006946 Ga0079104_1000240 Ga0079104_100024033 399
75 3300009011 Ga0105251_10001961 Ga0105251_1000196111 399
76 3300009093 Ga0105240_10053958 Ga0105240_100539584 399
77 3300009174 Ga0105241_10099051 Ga0105241_100990513 399
78 3300010375 Ga0105239_10044428 Ga0105239_100444285 399
79 3300010375 Ga0105239_10071872 Ga0105239_100718722 399
80 3300013307 Ga0157372_10220223 Ga0157372_102202234 399
81 3300025735 Ga0207713_1008532 Ga0207713_10085324 399
82 3300025904 Ga0207647_10000700 Ga0207647_1000070011 399
83 3300025913 Ga0207695_10018412 Ga0207695_100184128 399
84 3300025913 Ga0207695_10021772 Ga0207695_100217726 399
85 3300025914 Ga0207671_10019695 Ga0207671_100196952 399
86 3300025924 Ga0207694_10002959 Ga0207694_100029596 399
87 3300025925 Ga0207650_10007249 Ga0207650_100072492 399
88 3300025931 Ga0207644_10133468 Ga0207644_101334681 399
89 3300025933 Ga0207706_10020265 Ga0207706_100202654 399
90 3300025938 Ga0207704_10114758 Ga0207704_101147582 399
91 3300025949 Ga0207667_10093207 Ga0207667_100932073 399
92 3300025961 Ga0207712_10000197 Ga0207712_1000019747 399
93 3300025986 Ga0207658_10015119 Ga0207658_100151192 399
94 3300026041 Ga0207639_10001158 Ga0207639_100011588 399
95 3300026067 Ga0207678_10048376 Ga0207678_100483764 399
96 3300026078 Ga0207702_10125161 Ga0207702_101251612 399
97 3300026116 Ga0207674_10008153 Ga0207674_1000815316 399
98 3300026116 Ga0207674_10068623 Ga0207674_100686232 399
99 3300027111 Ga0209281_1000313 Ga0209281_100031353 399
100 3300028379 Ga0268266_10000006 Ga0268266_1000000678 399
101 3300037312 Ga0395899_0030414 Ga0395899_0030414_60_1268 399
102 3300037418 Ga0395900_0043991 Ga0395900_0043991_2866_4074 399
103 3300038443 Ga0395901_0003001 Ga0395901_0003001_781_1989 399
104 3300038443 Ga0395901_0043917 Ga0395901_0043917_1551_2759 399
105 3300046506 Ga0495583_0003495 Ga0495583_0003495_3131_4354 399
106 3300046530 Ga0495654_0002468 Ga0495654_0002468_7539_8762 399
107 3300048920 Ga0496117_0004018 Ga0496117_0004018_8916_10139 399
108 3300048922 Ga0496119_0013565 Ga0496119_0013565_2670_3893 399
109 3300048923 Ga0496120_0052319 Ga0496120_0052319_727_1950 399
110 3300048925 Ga0496122_0027898 Ga0496122_0027898_1749_2972 399
111 3300048926 Ga0496123_0030477 Ga0496123_0030477_948_2171 399
112 3300048927 Ga0496124_0004361 Ga0496124_0004361_8886_10109 399
113 3300048928 Ga0496125_0004304 Ga0496125_0004304_8856_10079 399
114 3300048928 Ga0496125_0102518 Ga0496125_0102518_638_1882 399
115 3300048929 Ga0496126_0016406 Ga0496126_0016406_3811_5034 399
116 3300049582 Ga0501048_0015431 Ga0501048_0015431_3523_4728 399
117 3300053093 Ga0500651_0000513 Ga0500651_0000513_6369_7586 399
118 3300005262 Ga0065165_1000566 Ga0065165_100056640 400
119 3300005458 Ga0070681_10155256 Ga0070681_101552562 400
120 3300005466 Ga0070685_10000461 Ga0070685_1000046113 400
121 3300009093 Ga0105240_10000609 Ga0105240_1000060965 400
122 3300009551 Ga0105238_10012418 Ga0105238_100124182 400
123 3300009553 Ga0105249_10094316 Ga0105249_100943162 400
124 3300013102 Ga0157371_10119374 Ga0157371_101193742 400
125 3300013307 Ga0157372_10154518 Ga0157372_101545183 400
126 3300015685 Ga0183369_1020 Ga0183369_102056 400
127 3300025261 Ga0209233_1016709 Ga0209233_10167092 400
128 3300025913 Ga0207695_10000007 Ga0207695_10000007655 400
129 3300025914 Ga0207671_10014511 Ga0207671_100145112 400
130 3300025932 Ga0207690_10230573 Ga0207690_102305731 400
131 3300025949 Ga0207667_10030752 Ga0207667_100307527 400
132 3300031251 Ga0265327_10003963 Ga0265327_1000396310 400
133 3300038443 Ga0395901_0064734 Ga0395901_0064734_1102_2307 400
134 3300046453 Ga0495627_001602 Ga0495627_001602_8876_10102 400
135 3300046458 Ga0495591_001265 Ga0495591_001265_8716_9942 400
136 3300046507 Ga0495606_0006812 Ga0495606_0006812_2961_4187 400
137 3300046515 Ga0495620_0001173 Ga0495620_0001173_8491_9717 400
138 3300046519 Ga0495632_0002953 Ga0495632_0002953_7934_9160 400
139 3300046522 Ga0495643_0027043 Ga0495643_0027043_1097_2323 400
140 3300046530 Ga0495654_0013512 Ga0495654_0013512_1925_3151 400
141 3300046665 Ga0495661_0001947 Ga0495661_0001947_8890_10116 400
142 3300046794 Ga0495589_0004089 Ga0495589_0004089_3355_4581 400
143 3300047446 Ga0495679_003858 Ga0495679_003858_2643_3869 400
144 3300047470 Ga0495681_0017189 Ga0495681_0017189_2374_3600 400
145 3300047470 Ga0495681_0017381 Ga0495681_0017381_2394_3620 400
146 3300047472 Ga0495686_0116585 Ga0495686_0116585_298_1524 400
147 3300048921 Ga0496118_0021066 Ga0496118_0021066_3944_5179 400
148 3300049568 Ga0501031_0004231 Ga0501031_0004231_2904_4145 400
149 3300049569 Ga0501032_0002075 Ga0501032_0002075_11703_12944 400
150 3300049570 Ga0501033_0010047 Ga0501033_0010047_2551_3792 400
151 3300049571 Ga0501034_0009482 Ga0501034_0009482_3600_4841 400
152 3300049572 Ga0501036_0023458 Ga0501036_0023458_3500_4741 400
153 3300049573 Ga0501037_0003644 Ga0501037_0003644_6419_7660 400
154 3300049575 Ga0501039_0026145 Ga0501039_0026145_2472_3713 400
155 3300049579 Ga0501043_0020348 Ga0501043_0020348_3101_4342 400
156 3300049580 Ga0501046_0008146 Ga0501046_0008146_4378_5619 400
157 3300049581 Ga0501047_0065149 Ga0501047_0065149_1922_3163 400
158 3300049742 Ga0501080_0019179 Ga0501080_0019179_4425_5666 400
159 3300049822 Ga0501035_0002506 Ga0501035_0002506_13036_14277 400
160 3300049823 Ga0501044_0029433 Ga0501044_0029433_1547_2788 400
161 3300049823 Ga0501044_0332499 Ga0501044_0332499_42_1250 400
162 3300002737 JGI25162J39368_1000605 JGI25162J39368_10006057 401
163 3300002737 JGI25162J39368_1001369 JGI25162J39368_10013698 401
164 3300002741 JGI25157J39369_1001032 JGI25157J39369_100103212 401
165 3300002772 JGI25164J39214_1000390 JGI25164J39214_100039020 401
166 3300002772 JGI25164J39214_1000439 JGI25164J39214_10004398 401
167 3300003214 JGI25165J46597_1000725 JGI25165J46597_100072520 401
168 3300005339 Ga0070660_100021077 Ga0070660_1000210774 401
169 3300005366 Ga0070659_100007777 Ga0070659_1000077778 401
170 3300005366 Ga0070659_100133803 Ga0070659_1001338032 401
171 3300005436 Ga0070713_100001474 Ga0070713_10000147410 401
172 3300005457 Ga0070662_100055644 Ga0070662_1000556442 401
173 3300005458 Ga0070681_10040856 Ga0070681_100408565 401
174 3300005458 Ga0070681_10108477 Ga0070681_101084772 401
175 3300005530 Ga0070679_100039770 Ga0070679_1000397703 401
176 3300005530 Ga0070679_100149893 Ga0070679_1001498932 401
177 3300005539 Ga0068853_100018029 Ga0068853_1000180294 401
178 3300005546 Ga0070696_100015121 Ga0070696_1000151214 401
179 3300005578 Ga0068854_100062286 Ga0068854_1000622864 401
180 3300006175 Ga0070712_100199309 Ga0070712_1001993092 401
181 3300013100 Ga0157373_10035698 Ga0157373_100356985 401
182 3300013102 Ga0157371_10025302 Ga0157371_100253023 401
183 3300013102 Ga0157371_10146393 Ga0157371_101463932 401
184 3300013104 Ga0157370_10000662 Ga0157370_1000066220 401
185 3300013104 Ga0157370_10019836 Ga0157370_100198366 401
186 3300013307 Ga0157372_10031116 Ga0157372_100311165 401
187 3300025231 Ga0207427_100118 Ga0207427_10011881 401
188 3300025231 Ga0207427_100120 Ga0207427_10012020 401
189 3300025233 Ga0209437_100020 Ga0209437_100020495 401
190 3300025233 Ga0209437_100231 Ga0209437_1002317 401
191 3300025250 Ga0209026_1000037 Ga0209026_1000037217 401
192 3300025261 Ga0209233_1000020 Ga0209233_1000020131 401
193 3300025261 Ga0209233_1000147 Ga0209233_1000147135 401
194 3300025912 Ga0207707_10031108 Ga0207707_100311085 401
195 3300025919 Ga0207657_10042130 Ga0207657_100421303 401
196 3300025919 Ga0207657_10121998 Ga0207657_101219983 401
197 3300025919 Ga0207657_10122040 Ga0207657_101220403 401
198 3300025921 Ga0207652_10136871 Ga0207652_101368712 401
199 3300025928 Ga0207700_10102431 Ga0207700_101024312 401
200 3300025929 Ga0207664_10000026 Ga0207664_10000026110 401
201 3300025929 Ga0207664_10014498 Ga0207664_100144983 401
202 3300025932 Ga0207690_10003519 Ga0207690_100035196 401
203 3300025932 Ga0207690_10026659 Ga0207690_100266594 401
204 3300025933 Ga0207706_10016229 Ga0207706_100162297 401
205 3300026116 Ga0207674_10028427 Ga0207674_100284274 401
206 3300038443 Ga0395901_0002971 Ga0395901_0002971_7227_8432 401

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

24

219

0.95

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

271

399

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uid-assembly2.cif.gz_D the crystal structure of an aminotransferase tlmj from streptoalloteichus hindustanus 0.8332 19 400
3bn1-assembly2.cif.gz_C crystal structure of gdp-perosamine synthase 0.8301 29 400
2oga-assembly1.cif.gz_A x-ray crystal structure of s. venezuelae desv in complex with ketimine intermediate 0.8262 17 400
3uwc-assembly1.cif.gz_A structure of an aminotransferase (degt-dnrj-eryc1-strs family) from coxiella burnetii in complex with pmp 0.8246 28 400
7n63-assembly1.cif.gz_A-2 x-ray structure of hcan_0200, an aminotransferase from helicobacter canadensis in complex with its external aldimine 0.8241 28 400
ID Description Score Start End Superfamily
af_L0T6V0_4_199_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9082 30 190 3.40.640.10
2po3B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9048 25 202 3.40.640.10
5u1zA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8892 28 209 3.40.640.10
4k2bA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8749 24 197 3.40.640.10
2ogeD01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8745 17 198 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A318DRV6-F1-model_v4 dTDP-4-amino-4,6-dideoxygalactose transaminase 0.9959 7 400 GO:0000271
GO:0008483
GO:0030170
AF-A0A318NA66-F1-model_v4 Nucleotide sugar aminotransferase 0.9876 5 400 GO:0000271
GO:0008483
GO:0030170
AF-A0A318DRV6-F1-model_v4 dTDP-4-amino-4,6-dideoxygalactose transaminase 0.9834 7 400 GO:0000271
GO:0008483
GO:0030170
AF-A0A4P5TXC4-F1-model_v4 Nucleotide sugar aminotransferase 0.9809 7 400 GO:0000271
GO:0008483
GO:0016020
GO:0030170
AF-A0A318NA66-F1-model_v4 Nucleotide sugar aminotransferase 0.9777 5 400 GO:0000271
GO:0008483
GO:0030170

Feature Viewer

pLDDT pTM Quality
96.03 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map