F314827
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 206 | 145 | 196 | 404 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10155256|Ga0070681_101552562 |
| Length | 425 |
| Sequence | MRRRAFREIPPTAGLPLRAADLLPRRGALPETLAAQLGTPPLLLTCSGTAALLVALRTLGERAPHRRVVVVPAYTCPLVAIAVRSLGLHLRLCDSRPGHFDMDPAALARACRADTLAVVPTHLAGLVADVDMARTIAHQAGAWVIEDAAQALGARDRGYSVGLRGDIGFFSLAAGKGLSIHEGGLLTARDPSLRAALRRTHDTLAPRGGWWEWRRSVELLGLAALYRPGGLALAYGRPLRRKLRQGDPVAAVGDRFDPLIPLHRVGRWRQGVGTRAAARWPAFLAERRALASRRVARLQQIDGLDVITPGVGTEGSWPFLLLRLPDEACRDAVLARLWTAGVGVSRLFVHALPDYAYLADRVPQEPMPNARDFAQCTLTLSNSPWLDDATFEDVALVIGQVLAGAHSRRGECDEWRTAEEHAPSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 3 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 4 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 5 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 6 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 7 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 8 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 9 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 10 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 11 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 46 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 57 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 58 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 61 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 95 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 96 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 97 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 98 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 99 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 100 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 101 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 102 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 121 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 122 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 123 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 124 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 125 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 126 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 127 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 128 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 129 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 130 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 145 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.15 |
| Metatranscriptomes | 0 |
| Isolates | 4.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.62 |
| Nodule | 0.97 |
| Rhizoplane | 0.49 |
| Rhizosphere | 75.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000605 | 3300002737 | Bacteria | 25839 |
| 2 | JGI25162J39368_1001369 | 3300002737 | Bacteria | 13418 |
| 3 | JGI25157J39369_1001032 | 3300002741 | Bacteria | 12792 |
| 4 | JGI25164J39214_1000390 | 3300002772 | Bacteria | 25835 |
| 5 | JGI25164J39214_1000439 | 3300002772 | Bacteria | 22628 |
| 6 | JGI25165J46597_1000725 | 3300003214 | Bacteria | 25839 |
| 7 | rootL2_10081353 | 3300003322 | Bacteria | 3488 |
| 8 | Ga0055526_1000012 | 3300003771 | Bacteria | 234368 |
| 9 | Ga0055537_1000021 | 3300003773 | Bacteria | 116840 |
| 10 | Ga0055524_1000037 | 3300003775 | Bacteria | 167140 |
| 11 | Ga0055534_1000006 | 3300003784 | Bacteria | 234368 |
| 12 | Ga0055528_1000006 | 3300003790 | Bacteria | 234368 |
| 13 | Ga0065165_1000566 | 3300005262 | Bacteria | 54948 |
| 14 | Ga0070670_100004512 | 3300005331 | Bacteria | 11671 |
| 15 | Ga0070660_100021077 | 3300005339 | Bacteria | 4800 |
| 16 | Ga0070659_100007777 | 3300005366 | Bacteria | 7797 |
| 17 | Ga0070659_100133803 | 3300005366 | Bacteria | 2015 |
| 18 | Ga0070667_100031251 | 3300005367 | Bacteria | 4440 |
| 19 | Ga0070667_100080763 | 3300005367 | Bacteria | 2782 |
| 20 | Ga0070713_100001474 | 3300005436 | Bacteria | 15027 |
| 21 | Ga0070663_100037618 | 3300005455 | Bacteria | 3370 |
| 22 | Ga0070663_100063153 | 3300005455 | Bacteria | 2673 |
| 23 | Ga0070662_100055644 | 3300005457 | Bacteria | 2870 |
| 24 | Ga0070681_10040856 | 3300005458 | Bacteria | 4646 |
| 25 | Ga0070681_10051234 | 3300005458 | Unclassified | 4117 |
| 26 | Ga0070681_10108477 | 3300005458 | Bacteria | 2716 |
| 27 | Ga0070681_10155256 | 3300005458 | Bacteria | 2214 |
| 28 | Ga0070685_10000461 | 3300005466 | Bacteria | 23671 |
| 29 | Ga0070698_100017753 | 3300005471 | Bacteria | 7493 |
| 30 | Ga0070699_100114632 | 3300005518 | Bacteria | 2368 |
| 31 | Ga0070679_100039770 | 3300005530 | Bacteria | 4675 |
| 32 | Ga0070679_100053143 | 3300005530 | Unclassified | 4033 |
| 33 | Ga0070679_100149893 | 3300005530 | Bacteria | 2309 |
| 34 | Ga0068853_100002636 | 3300005539 | Bacteria | 13511 |
| 35 | Ga0068853_100003899 | 3300005539 | Bacteria | 11435 |
| 36 | Ga0068853_100018029 | 3300005539 | Bacteria | 5836 |
| 37 | Ga0068853_100066463 | 3300005539 | Bacteria | 3131 |
| 38 | Ga0070696_100015121 | 3300005546 | Bacteria | 5181 |
| 39 | Ga0070696_100024281 | 3300005546 | Bacteria | 4120 |
| 40 | Ga0070693_100054140 | 3300005547 | Bacteria | 2306 |
| 41 | Ga0070665_100001431 | 3300005548 | Bacteria | 27984 |
| 42 | Ga0070665_100047084 | 3300005548 | Bacteria | 4328 |
| 43 | Ga0068855_100004495 | 3300005563 | Bacteria | 17044 |
| 44 | Ga0068855_100043549 | 3300005563 | Bacteria | 5316 |
| 45 | Ga0068857_100014373 | 3300005577 | Bacteria | 6901 |
| 46 | Ga0068857_100135300 | 3300005577 | Bacteria | 2225 |
| 47 | Ga0068854_100001789 | 3300005578 | Bacteria | 13094 |
| 48 | Ga0068854_100062286 | 3300005578 | Bacteria | 2704 |
| 49 | Ga0070702_100018753 | 3300005615 | Unclassified | 3594 |
| 50 | Ga0068863_100006400 | 3300005841 | Bacteria | 11545 |
| 51 | Ga0068863_100304090 | 3300005841 | Bacteria | 1547 |
| 52 | Ga0070712_100199309 | 3300006175 | Bacteria | 1571 |
| 53 | Ga0068865_100017240 | 3300006881 | Bacteria | 4642 |
| 54 | Ga0079104_1000240 | 3300006946 | Bacteria | 72956 |
| 55 | Ga0105251_10001961 | 3300009011 | Bacteria | 16825 |
| 56 | Ga0105240_10000609 | 3300009093 | Bacteria | 66384 |
| 57 | Ga0105240_10053958 | 3300009093 | Bacteria | 5040 |
| 58 | Ga0105241_10099051 | 3300009174 | Bacteria | 2314 |
| 59 | Ga0105238_10012418 | 3300009551 | Bacteria | 8591 |
| 60 | Ga0105249_10094316 | 3300009553 | Bacteria | 2805 |
| 61 | Ga0105239_10009035 | 3300010375 | Bacteria | 11284 |
| 62 | Ga0105239_10044428 | 3300010375 | Bacteria | 4870 |
| 63 | Ga0105239_10071872 | 3300010375 | Bacteria | 3801 |
| 64 | Ga0157373_10035698 | 3300013100 | Bacteria | 3568 |
| 65 | Ga0157371_10025302 | 3300013102 | Bacteria | 4327 |
| 66 | Ga0157371_10119374 | 3300013102 | Bacteria | 1874 |
| 67 | Ga0157371_10146393 | 3300013102 | Bacteria | 1683 |
| 68 | Ga0157370_10000662 | 3300013104 | Bacteria | 42848 |
| 69 | Ga0157370_10019836 | 3300013104 | Bacteria | 6728 |
| 70 | Ga0157372_10009430 | 3300013307 | Bacteria | 10386 |
| 71 | Ga0157372_10031116 | 3300013307 | Bacteria | 5843 |
| 72 | Ga0157372_10154518 | 3300013307 | Bacteria | 2650 |
| 73 | Ga0157372_10220223 | 3300013307 | Bacteria | 2200 |
| 74 | Ga0183369_1020 | 3300015685 | Bacteria | 111322 |
| 75 | Ga0183360_10002 | 3300015689 | Bacteria | 953821 |
| 76 | Ga0207427_100118 | 3300025231 | Bacteria | 102109 |
| 77 | Ga0207427_100120 | 3300025231 | Bacteria | 101516 |
| 78 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 79 | Ga0209437_100231 | 3300025233 | Bacteria | 94387 |
| 80 | Ga0209026_1000037 | 3300025250 | Bacteria | 282562 |
| 81 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 82 | Ga0209233_1000147 | 3300025261 | Bacteria | 186517 |
| 83 | Ga0209233_1016709 | 3300025261 | Bacteria | 2016 |
| 84 | Ga0209565_1000002 | 3300025263 | Bacteria | 1423083 |
| 85 | Ga0209673_1000002 | 3300025273 | Bacteria | 1423083 |
| 86 | Ga0209675_1000002 | 3300025291 | Bacteria | 1423083 |
| 87 | Ga0209564_1000004 | 3300025295 | Bacteria | 1424639 |
| 88 | Ga0209256_1000004 | 3300025299 | Bacteria | 1424643 |
| 89 | Ga0207713_1008532 | 3300025735 | Bacteria | 5887 |
| 90 | Ga0207647_10000700 | 3300025904 | Bacteria | 26295 |
| 91 | Ga0207707_10031108 | 3300025912 | Bacteria | 4670 |
| 92 | Ga0207707_10039209 | 3300025912 | Bacteria | 4142 |
| 93 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 94 | Ga0207695_10018412 | 3300025913 | Bacteria | 8078 |
| 95 | Ga0207695_10021772 | 3300025913 | Bacteria | 7302 |
| 96 | Ga0207671_10014511 | 3300025914 | Bacteria | 6222 |
| 97 | Ga0207671_10019695 | 3300025914 | Bacteria | 5153 |
| 98 | Ga0207657_10042130 | 3300025919 | Bacteria | 4031 |
| 99 | Ga0207657_10121998 | 3300025919 | Bacteria | 2144 |
| 100 | Ga0207657_10122040 | 3300025919 | Bacteria | 2143 |
| 101 | Ga0207652_10049997 | 3300025921 | Bacteria | 3581 |
| 102 | Ga0207652_10136871 | 3300025921 | Bacteria | 2188 |
| 103 | Ga0207646_10028965 | 3300025922 | Bacteria | 5037 |
| 104 | Ga0207694_10002959 | 3300025924 | Bacteria | 13645 |
| 105 | Ga0207650_10007249 | 3300025925 | Bacteria | 7553 |
| 106 | Ga0207700_10102431 | 3300025928 | Bacteria | 2286 |
| 107 | Ga0207664_10000026 | 3300025929 | Bacteria | 194571 |
| 108 | Ga0207664_10014498 | 3300025929 | Bacteria | 5694 |
| 109 | Ga0207644_10133468 | 3300025931 | Bacteria | 1904 |
| 110 | Ga0207690_10003519 | 3300025932 | Bacteria | 9330 |
| 111 | Ga0207690_10026659 | 3300025932 | Bacteria | 3641 |
| 112 | Ga0207690_10230573 | 3300025932 | Bacteria | 1421 |
| 113 | Ga0207706_10016229 | 3300025933 | Bacteria | 6730 |
| 114 | Ga0207706_10020265 | 3300025933 | Bacteria | 5977 |
| 115 | Ga0207704_10114758 | 3300025938 | Bacteria | 1829 |
| 116 | Ga0207665_10111521 | 3300025939 | Bacteria | 1923 |
| 117 | Ga0207667_10007122 | 3300025949 | Bacteria | 13499 |
| 118 | Ga0207667_10030752 | 3300025949 | Bacteria | 5802 |
| 119 | Ga0207667_10093207 | 3300025949 | Bacteria | 3110 |
| 120 | Ga0207712_10000197 | 3300025961 | Bacteria | 61066 |
| 121 | Ga0207658_10015119 | 3300025986 | Bacteria | 5293 |
| 122 | Ga0207658_10039606 | 3300025986 | Bacteria | 3401 |
| 123 | Ga0207639_10001062 | 3300026041 | Bacteria | 18645 |
| 124 | Ga0207639_10001158 | 3300026041 | Bacteria | 17882 |
| 125 | Ga0207678_10048376 | 3300026067 | Bacteria | 3675 |
| 126 | Ga0207702_10125161 | 3300026078 | Bacteria | 2306 |
| 127 | Ga0207641_10069464 | 3300026088 | Bacteria | 3024 |
| 128 | Ga0207674_10008153 | 3300026116 | Bacteria | 12146 |
| 129 | Ga0207674_10028427 | 3300026116 | Bacteria | 5902 |
| 130 | Ga0207674_10068623 | 3300026116 | Bacteria | 3568 |
| 131 | Ga0209281_1000313 | 3300027111 | Bacteria | 86484 |
| 132 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 133 | Ga0268266_10017869 | 3300028379 | Bacteria | 6043 |
| 134 | Ga0265327_10003963 | 3300031251 | Bacteria | 13524 |
| 135 | Ga0395899_0015695 | 3300037312 | Bacteria | 5775 |
| 136 | Ga0395899_0030414 | 3300037312 | Bacteria | 4061 |
| 137 | Ga0395900_0043991 | 3300037418 | Bacteria | 4602 |
| 138 | Ga0395901_0002971 | 3300038443 | Bacteria | 17103 |
| 139 | Ga0395901_0003001 | 3300038443 | Bacteria | 17020 |
| 140 | Ga0395901_0043917 | 3300038443 | Bacteria | 4635 |
| 141 | Ga0395901_0064734 | 3300038443 | Bacteria | 3806 |
| 142 | Ga0436365_0281649 | 3300039437 | Bacteria | 2099 |
| 143 | Ga0451577_0013048 | 3300042876 | Bacteria | 7795 |
| 144 | Ga0466982_0000381 | 3300044672 | Bacteria | 12638 |
| 145 | Ga0466959_0009051 | 3300045049 | Bacteria | 7064 |
| 146 | Ga0495627_001602 | 3300046453 | Bacteria | 12661 |
| 147 | Ga0495591_001265 | 3300046458 | Bacteria | 16172 |
| 148 | Ga0495583_0003495 | 3300046506 | Bacteria | 11905 |
| 149 | Ga0495606_0006812 | 3300046507 | Bacteria | 10434 |
| 150 | Ga0495606_0013905 | 3300046507 | Bacteria | 6318 |
| 151 | Ga0495606_0019015 | 3300046507 | Bacteria | 5130 |
| 152 | Ga0495620_0001173 | 3300046515 | Bacteria | 16042 |
| 153 | Ga0495632_0002953 | 3300046519 | Bacteria | 12465 |
| 154 | Ga0495637_0008698 | 3300046520 | Bacteria | 4978 |
| 155 | Ga0495643_0027043 | 3300046522 | Bacteria | 3229 |
| 156 | Ga0495654_0002468 | 3300046530 | Bacteria | 11893 |
| 157 | Ga0495654_0013512 | 3300046530 | Bacteria | 4368 |
| 158 | Ga0495622_0145524 | 3300046557 | Bacteria | 1074 |
| 159 | Ga0495633_0000648 | 3300046558 | Bacteria | 32320 |
| 160 | Ga0495661_0001947 | 3300046665 | Bacteria | 16378 |
| 161 | Ga0495589_0004089 | 3300046794 | Bacteria | 7811 |
| 162 | Ga0495672_0018155 | 3300047320 | Bacteria | 4681 |
| 163 | Ga0495679_003858 | 3300047446 | Bacteria | 7096 |
| 164 | Ga0495681_0017189 | 3300047470 | Bacteria | 4027 |
| 165 | Ga0495681_0017381 | 3300047470 | Bacteria | 3994 |
| 166 | Ga0495686_0116585 | 3300047472 | Bacteria | 1596 |
| 167 | Ga0496101_0107737 | 3300048904 | Bacteria | 2094 |
| 168 | Ga0496117_0004018 | 3300048920 | Bacteria | 16586 |
| 169 | Ga0496118_0021066 | 3300048921 | Bacteria | 5755 |
| 170 | Ga0496119_0013565 | 3300048922 | Bacteria | 6475 |
| 171 | Ga0496120_0052319 | 3300048923 | Bacteria | 2326 |
| 172 | Ga0496121_0001076 | 3300048924 | Bacteria | 48261 |
| 173 | Ga0496122_0027898 | 3300048925 | Bacteria | 4812 |
| 174 | Ga0496123_0030477 | 3300048926 | Bacteria | 3947 |
| 175 | Ga0496124_0004361 | 3300048927 | Bacteria | 16552 |
| 176 | Ga0496125_0004304 | 3300048928 | Bacteria | 16529 |
| 177 | Ga0496125_0102518 | 3300048928 | Bacteria | 2103 |
| 178 | Ga0496126_0016406 | 3300048929 | Bacteria | 7408 |
| 179 | Ga0501031_0004231 | 3300049568 | Bacteria | 9272 |
| 180 | Ga0501032_0002075 | 3300049569 | Bacteria | 15819 |
| 181 | Ga0501033_0010047 | 3300049570 | Bacteria | 7265 |
| 182 | Ga0501034_0009482 | 3300049571 | Bacteria | 10190 |
| 183 | Ga0501036_0023458 | 3300049572 | Bacteria | 5198 |
| 184 | Ga0501037_0003644 | 3300049573 | Bacteria | 11178 |
| 185 | Ga0501039_0026145 | 3300049575 | Bacteria | 4485 |
| 186 | Ga0501043_0020348 | 3300049579 | Bacteria | 5205 |
| 187 | Ga0501046_0008146 | 3300049580 | Bacteria | 9155 |
| 188 | Ga0501047_0065149 | 3300049581 | Bacteria | 3512 |
| 189 | Ga0501048_0015431 | 3300049582 | Bacteria | 5642 |
| 190 | Ga0501080_0019179 | 3300049742 | Bacteria | 6333 |
| 191 | Ga0501035_0002506 | 3300049822 | Bacteria | 17942 |
| 192 | Ga0501044_0029433 | 3300049823 | Bacteria | 5791 |
| 193 | Ga0501044_0332499 | 3300049823 | Bacteria | 1442 |
| 194 | Ga0500651_0000513 | 3300053093 | Bacteria | 19980 |
| 195 | Ga0500651_0022061 | 3300053093 | Bacteria | 3976 |
| 196 | Ga0500562_000937 | 3300053108 | Bacteria | 7099 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046557 | Ga0495622_0145524 | Ga0495622_0145524_36_1043 | 333 |
| 2 | 3300045049 | Ga0466959_0009051 | Ga0466959_0009051_58_1290 | 363 |
| 3 | 3300039437 | Ga0436365_0281649 | Ga0436365_0281649_64_1257 | 366 |
| 4 | 3300046507 | Ga0495606_0013905 | Ga0495606_0013905_3604_4821 | 368 |
| 5 | 3300053093 | Ga0500651_0022061 | Ga0500651_0022061_2712_3956 | 378 |
| 6 | 3300046520 | Ga0495637_0008698 | Ga0495637_0008698_3084_4307 | 379 |
| 7 | 3300046558 | Ga0495633_0000648 | Ga0495633_0000648_2248_3486 | 381 |
| 8 | 3300037312 | Ga0395899_0015695 | Ga0395899_0015695_2421_3629 | 382 |
| 9 | 3300053108 | Ga0500562_000937 | Ga0500562_000937_3935_5164 | 384 |
| 10 | 3300013307 | Ga0157372_10009430 | Ga0157372_1000943010 | 386 |
| 11 | 3300042876 | Ga0451577_0013048 | Ga0451577_0013048_5834_7069 | 388 |
| 12 | iso_pu_bacteria | 2946006987 | 2946013310 | 393 |
| 13 | iso_pu_bacteria | 2675903420 | 2677897107 | 394 |
| 14 | 3300044672 | Ga0466982_0000381 | Ga0466982_0000381_9214_10440 | 395 |
| 15 | iso_pu_bacteria | 2908446538 | 2908452557 | 395 |
| 16 | iso_pu_bacteria | 2941489479 | 2941494181 | 395 |
| 17 | 3300005367 | Ga0070667_100080763 | Ga0070667_1000807632 | 396 |
| 18 | 3300005455 | Ga0070663_100063153 | Ga0070663_1000631532 | 396 |
| 19 | 3300005539 | Ga0068853_100002636 | Ga0068853_1000026362 | 396 |
| 20 | 3300005548 | Ga0070665_100047084 | Ga0070665_1000470846 | 396 |
| 21 | 3300005563 | Ga0068855_100004495 | Ga0068855_1000044952 | 396 |
| 22 | 3300005841 | Ga0068863_100006400 | Ga0068863_1000064002 | 396 |
| 23 | 3300010375 | Ga0105239_10009035 | Ga0105239_100090356 | 396 |
| 24 | 3300025949 | Ga0207667_10007122 | Ga0207667_100071223 | 396 |
| 25 | 3300025986 | Ga0207658_10039606 | Ga0207658_100396062 | 396 |
| 26 | 3300026041 | Ga0207639_10001062 | Ga0207639_100010622 | 396 |
| 27 | 3300026088 | Ga0207641_10069464 | Ga0207641_100694644 | 396 |
| 28 | 3300028379 | Ga0268266_10017869 | Ga0268266_100178692 | 396 |
| 29 | iso_pu_bacteria | 2687453130 | 2687583861 | 396 |
| 30 | 3300005458 | Ga0070681_10051234 | Ga0070681_100512343 | 397 |
| 31 | 3300005471 | Ga0070698_100017753 | Ga0070698_1000177535 | 397 |
| 32 | 3300005518 | Ga0070699_100114632 | Ga0070699_1001146323 | 397 |
| 33 | 3300005530 | Ga0070679_100053143 | Ga0070679_1000531435 | 397 |
| 34 | 3300005546 | Ga0070696_100024281 | Ga0070696_1000242812 | 397 |
| 35 | 3300005547 | Ga0070693_100054140 | Ga0070693_1000541402 | 397 |
| 36 | 3300005615 | Ga0070702_100018753 | Ga0070702_1000187533 | 397 |
| 37 | 3300025912 | Ga0207707_10039209 | Ga0207707_100392094 | 397 |
| 38 | 3300025921 | Ga0207652_10049997 | Ga0207652_100499972 | 397 |
| 39 | 3300025922 | Ga0207646_10028965 | Ga0207646_100289653 | 397 |
| 40 | 3300025939 | Ga0207665_10111521 | Ga0207665_101115213 | 397 |
| 41 | 3300046507 | Ga0495606_0019015 | Ga0495606_0019015_2506_3723 | 397 |
| 42 | 3300047320 | Ga0495672_0018155 | Ga0495672_0018155_1453_2670 | 397 |
| 43 | iso_pu_bacteria | 2537561836 | 2538832170 | 397 |
| 44 | iso_pu_bacteria | 2895395659 | 2895398037 | 397 |
| 45 | iso_pu_bacteria | 2908669403 | 2908671062 | 397 |
| 46 | iso_pu_bacteria | 2939611941 | 2939612614 | 397 |
| 47 | 3300003322 | rootL2_10081353 | rootL2_100813535 | 398 |
| 48 | 3300003771 | Ga0055526_1000012 | Ga0055526_1000012177 | 398 |
| 49 | 3300003773 | Ga0055537_1000021 | Ga0055537_100002144 | 398 |
| 50 | 3300003775 | Ga0055524_1000037 | Ga0055524_1000037121 | 398 |
| 51 | 3300003784 | Ga0055534_1000006 | Ga0055534_1000006177 | 398 |
| 52 | 3300003790 | Ga0055528_1000006 | Ga0055528_1000006177 | 398 |
| 53 | 3300015689 | Ga0183360_10002 | Ga0183360_10002189 | 398 |
| 54 | 3300025263 | Ga0209565_1000002 | Ga0209565_1000002784 | 398 |
| 55 | 3300025273 | Ga0209673_1000002 | Ga0209673_1000002784 | 398 |
| 56 | 3300025291 | Ga0209675_1000002 | Ga0209675_1000002784 | 398 |
| 57 | 3300025295 | Ga0209564_1000004 | Ga0209564_1000004785 | 398 |
| 58 | 3300025299 | Ga0209256_1000004 | Ga0209256_1000004785 | 398 |
| 59 | 3300048904 | Ga0496101_0107737 | Ga0496101_0107737_196_1392 | 398 |
| 60 | 3300048924 | Ga0496121_0001076 | Ga0496121_0001076_41206_42435 | 398 |
| 61 | iso_pu_bacteria | 2945961074 | 2945966831 | 398 |
| 62 | 3300005331 | Ga0070670_100004512 | Ga0070670_1000045122 | 399 |
| 63 | 3300005367 | Ga0070667_100031251 | Ga0070667_1000312514 | 399 |
| 64 | 3300005455 | Ga0070663_100037618 | Ga0070663_1000376182 | 399 |
| 65 | 3300005539 | Ga0068853_100003899 | Ga0068853_1000038992 | 399 |
| 66 | 3300005539 | Ga0068853_100066463 | Ga0068853_1000664634 | 399 |
| 67 | 3300005548 | Ga0070665_100001431 | Ga0070665_10000143111 | 399 |
| 68 | 3300005563 | Ga0068855_100043549 | Ga0068855_1000435495 | 399 |
| 69 | 3300005577 | Ga0068857_100014373 | Ga0068857_1000143738 | 399 |
| 70 | 3300005577 | Ga0068857_100135300 | Ga0068857_1001353001 | 399 |
| 71 | 3300005578 | Ga0068854_100001789 | Ga0068854_1000017898 | 399 |
| 72 | 3300005841 | Ga0068863_100304090 | Ga0068863_1003040901 | 399 |
| 73 | 3300006881 | Ga0068865_100017240 | Ga0068865_1000172404 | 399 |
| 74 | 3300006946 | Ga0079104_1000240 | Ga0079104_100024033 | 399 |
| 75 | 3300009011 | Ga0105251_10001961 | Ga0105251_1000196111 | 399 |
| 76 | 3300009093 | Ga0105240_10053958 | Ga0105240_100539584 | 399 |
| 77 | 3300009174 | Ga0105241_10099051 | Ga0105241_100990513 | 399 |
| 78 | 3300010375 | Ga0105239_10044428 | Ga0105239_100444285 | 399 |
| 79 | 3300010375 | Ga0105239_10071872 | Ga0105239_100718722 | 399 |
| 80 | 3300013307 | Ga0157372_10220223 | Ga0157372_102202234 | 399 |
| 81 | 3300025735 | Ga0207713_1008532 | Ga0207713_10085324 | 399 |
| 82 | 3300025904 | Ga0207647_10000700 | Ga0207647_1000070011 | 399 |
| 83 | 3300025913 | Ga0207695_10018412 | Ga0207695_100184128 | 399 |
| 84 | 3300025913 | Ga0207695_10021772 | Ga0207695_100217726 | 399 |
| 85 | 3300025914 | Ga0207671_10019695 | Ga0207671_100196952 | 399 |
| 86 | 3300025924 | Ga0207694_10002959 | Ga0207694_100029596 | 399 |
| 87 | 3300025925 | Ga0207650_10007249 | Ga0207650_100072492 | 399 |
| 88 | 3300025931 | Ga0207644_10133468 | Ga0207644_101334681 | 399 |
| 89 | 3300025933 | Ga0207706_10020265 | Ga0207706_100202654 | 399 |
| 90 | 3300025938 | Ga0207704_10114758 | Ga0207704_101147582 | 399 |
| 91 | 3300025949 | Ga0207667_10093207 | Ga0207667_100932073 | 399 |
| 92 | 3300025961 | Ga0207712_10000197 | Ga0207712_1000019747 | 399 |
| 93 | 3300025986 | Ga0207658_10015119 | Ga0207658_100151192 | 399 |
| 94 | 3300026041 | Ga0207639_10001158 | Ga0207639_100011588 | 399 |
| 95 | 3300026067 | Ga0207678_10048376 | Ga0207678_100483764 | 399 |
| 96 | 3300026078 | Ga0207702_10125161 | Ga0207702_101251612 | 399 |
| 97 | 3300026116 | Ga0207674_10008153 | Ga0207674_1000815316 | 399 |
| 98 | 3300026116 | Ga0207674_10068623 | Ga0207674_100686232 | 399 |
| 99 | 3300027111 | Ga0209281_1000313 | Ga0209281_100031353 | 399 |
| 100 | 3300028379 | Ga0268266_10000006 | Ga0268266_1000000678 | 399 |
| 101 | 3300037312 | Ga0395899_0030414 | Ga0395899_0030414_60_1268 | 399 |
| 102 | 3300037418 | Ga0395900_0043991 | Ga0395900_0043991_2866_4074 | 399 |
| 103 | 3300038443 | Ga0395901_0003001 | Ga0395901_0003001_781_1989 | 399 |
| 104 | 3300038443 | Ga0395901_0043917 | Ga0395901_0043917_1551_2759 | 399 |
| 105 | 3300046506 | Ga0495583_0003495 | Ga0495583_0003495_3131_4354 | 399 |
| 106 | 3300046530 | Ga0495654_0002468 | Ga0495654_0002468_7539_8762 | 399 |
| 107 | 3300048920 | Ga0496117_0004018 | Ga0496117_0004018_8916_10139 | 399 |
| 108 | 3300048922 | Ga0496119_0013565 | Ga0496119_0013565_2670_3893 | 399 |
| 109 | 3300048923 | Ga0496120_0052319 | Ga0496120_0052319_727_1950 | 399 |
| 110 | 3300048925 | Ga0496122_0027898 | Ga0496122_0027898_1749_2972 | 399 |
| 111 | 3300048926 | Ga0496123_0030477 | Ga0496123_0030477_948_2171 | 399 |
| 112 | 3300048927 | Ga0496124_0004361 | Ga0496124_0004361_8886_10109 | 399 |
| 113 | 3300048928 | Ga0496125_0004304 | Ga0496125_0004304_8856_10079 | 399 |
| 114 | 3300048928 | Ga0496125_0102518 | Ga0496125_0102518_638_1882 | 399 |
| 115 | 3300048929 | Ga0496126_0016406 | Ga0496126_0016406_3811_5034 | 399 |
| 116 | 3300049582 | Ga0501048_0015431 | Ga0501048_0015431_3523_4728 | 399 |
| 117 | 3300053093 | Ga0500651_0000513 | Ga0500651_0000513_6369_7586 | 399 |
| 118 | 3300005262 | Ga0065165_1000566 | Ga0065165_100056640 | 400 |
| 119 | 3300005458 | Ga0070681_10155256 | Ga0070681_101552562 | 400 |
| 120 | 3300005466 | Ga0070685_10000461 | Ga0070685_1000046113 | 400 |
| 121 | 3300009093 | Ga0105240_10000609 | Ga0105240_1000060965 | 400 |
| 122 | 3300009551 | Ga0105238_10012418 | Ga0105238_100124182 | 400 |
| 123 | 3300009553 | Ga0105249_10094316 | Ga0105249_100943162 | 400 |
| 124 | 3300013102 | Ga0157371_10119374 | Ga0157371_101193742 | 400 |
| 125 | 3300013307 | Ga0157372_10154518 | Ga0157372_101545183 | 400 |
| 126 | 3300015685 | Ga0183369_1020 | Ga0183369_102056 | 400 |
| 127 | 3300025261 | Ga0209233_1016709 | Ga0209233_10167092 | 400 |
| 128 | 3300025913 | Ga0207695_10000007 | Ga0207695_10000007655 | 400 |
| 129 | 3300025914 | Ga0207671_10014511 | Ga0207671_100145112 | 400 |
| 130 | 3300025932 | Ga0207690_10230573 | Ga0207690_102305731 | 400 |
| 131 | 3300025949 | Ga0207667_10030752 | Ga0207667_100307527 | 400 |
| 132 | 3300031251 | Ga0265327_10003963 | Ga0265327_1000396310 | 400 |
| 133 | 3300038443 | Ga0395901_0064734 | Ga0395901_0064734_1102_2307 | 400 |
| 134 | 3300046453 | Ga0495627_001602 | Ga0495627_001602_8876_10102 | 400 |
| 135 | 3300046458 | Ga0495591_001265 | Ga0495591_001265_8716_9942 | 400 |
| 136 | 3300046507 | Ga0495606_0006812 | Ga0495606_0006812_2961_4187 | 400 |
| 137 | 3300046515 | Ga0495620_0001173 | Ga0495620_0001173_8491_9717 | 400 |
| 138 | 3300046519 | Ga0495632_0002953 | Ga0495632_0002953_7934_9160 | 400 |
| 139 | 3300046522 | Ga0495643_0027043 | Ga0495643_0027043_1097_2323 | 400 |
| 140 | 3300046530 | Ga0495654_0013512 | Ga0495654_0013512_1925_3151 | 400 |
| 141 | 3300046665 | Ga0495661_0001947 | Ga0495661_0001947_8890_10116 | 400 |
| 142 | 3300046794 | Ga0495589_0004089 | Ga0495589_0004089_3355_4581 | 400 |
| 143 | 3300047446 | Ga0495679_003858 | Ga0495679_003858_2643_3869 | 400 |
| 144 | 3300047470 | Ga0495681_0017189 | Ga0495681_0017189_2374_3600 | 400 |
| 145 | 3300047470 | Ga0495681_0017381 | Ga0495681_0017381_2394_3620 | 400 |
| 146 | 3300047472 | Ga0495686_0116585 | Ga0495686_0116585_298_1524 | 400 |
| 147 | 3300048921 | Ga0496118_0021066 | Ga0496118_0021066_3944_5179 | 400 |
| 148 | 3300049568 | Ga0501031_0004231 | Ga0501031_0004231_2904_4145 | 400 |
| 149 | 3300049569 | Ga0501032_0002075 | Ga0501032_0002075_11703_12944 | 400 |
| 150 | 3300049570 | Ga0501033_0010047 | Ga0501033_0010047_2551_3792 | 400 |
| 151 | 3300049571 | Ga0501034_0009482 | Ga0501034_0009482_3600_4841 | 400 |
| 152 | 3300049572 | Ga0501036_0023458 | Ga0501036_0023458_3500_4741 | 400 |
| 153 | 3300049573 | Ga0501037_0003644 | Ga0501037_0003644_6419_7660 | 400 |
| 154 | 3300049575 | Ga0501039_0026145 | Ga0501039_0026145_2472_3713 | 400 |
| 155 | 3300049579 | Ga0501043_0020348 | Ga0501043_0020348_3101_4342 | 400 |
| 156 | 3300049580 | Ga0501046_0008146 | Ga0501046_0008146_4378_5619 | 400 |
| 157 | 3300049581 | Ga0501047_0065149 | Ga0501047_0065149_1922_3163 | 400 |
| 158 | 3300049742 | Ga0501080_0019179 | Ga0501080_0019179_4425_5666 | 400 |
| 159 | 3300049822 | Ga0501035_0002506 | Ga0501035_0002506_13036_14277 | 400 |
| 160 | 3300049823 | Ga0501044_0029433 | Ga0501044_0029433_1547_2788 | 400 |
| 161 | 3300049823 | Ga0501044_0332499 | Ga0501044_0332499_42_1250 | 400 |
| 162 | 3300002737 | JGI25162J39368_1000605 | JGI25162J39368_10006057 | 401 |
| 163 | 3300002737 | JGI25162J39368_1001369 | JGI25162J39368_10013698 | 401 |
| 164 | 3300002741 | JGI25157J39369_1001032 | JGI25157J39369_100103212 | 401 |
| 165 | 3300002772 | JGI25164J39214_1000390 | JGI25164J39214_100039020 | 401 |
| 166 | 3300002772 | JGI25164J39214_1000439 | JGI25164J39214_10004398 | 401 |
| 167 | 3300003214 | JGI25165J46597_1000725 | JGI25165J46597_100072520 | 401 |
| 168 | 3300005339 | Ga0070660_100021077 | Ga0070660_1000210774 | 401 |
| 169 | 3300005366 | Ga0070659_100007777 | Ga0070659_1000077778 | 401 |
| 170 | 3300005366 | Ga0070659_100133803 | Ga0070659_1001338032 | 401 |
| 171 | 3300005436 | Ga0070713_100001474 | Ga0070713_10000147410 | 401 |
| 172 | 3300005457 | Ga0070662_100055644 | Ga0070662_1000556442 | 401 |
| 173 | 3300005458 | Ga0070681_10040856 | Ga0070681_100408565 | 401 |
| 174 | 3300005458 | Ga0070681_10108477 | Ga0070681_101084772 | 401 |
| 175 | 3300005530 | Ga0070679_100039770 | Ga0070679_1000397703 | 401 |
| 176 | 3300005530 | Ga0070679_100149893 | Ga0070679_1001498932 | 401 |
| 177 | 3300005539 | Ga0068853_100018029 | Ga0068853_1000180294 | 401 |
| 178 | 3300005546 | Ga0070696_100015121 | Ga0070696_1000151214 | 401 |
| 179 | 3300005578 | Ga0068854_100062286 | Ga0068854_1000622864 | 401 |
| 180 | 3300006175 | Ga0070712_100199309 | Ga0070712_1001993092 | 401 |
| 181 | 3300013100 | Ga0157373_10035698 | Ga0157373_100356985 | 401 |
| 182 | 3300013102 | Ga0157371_10025302 | Ga0157371_100253023 | 401 |
| 183 | 3300013102 | Ga0157371_10146393 | Ga0157371_101463932 | 401 |
| 184 | 3300013104 | Ga0157370_10000662 | Ga0157370_1000066220 | 401 |
| 185 | 3300013104 | Ga0157370_10019836 | Ga0157370_100198366 | 401 |
| 186 | 3300013307 | Ga0157372_10031116 | Ga0157372_100311165 | 401 |
| 187 | 3300025231 | Ga0207427_100118 | Ga0207427_10011881 | 401 |
| 188 | 3300025231 | Ga0207427_100120 | Ga0207427_10012020 | 401 |
| 189 | 3300025233 | Ga0209437_100020 | Ga0209437_100020495 | 401 |
| 190 | 3300025233 | Ga0209437_100231 | Ga0209437_1002317 | 401 |
| 191 | 3300025250 | Ga0209026_1000037 | Ga0209026_1000037217 | 401 |
| 192 | 3300025261 | Ga0209233_1000020 | Ga0209233_1000020131 | 401 |
| 193 | 3300025261 | Ga0209233_1000147 | Ga0209233_1000147135 | 401 |
| 194 | 3300025912 | Ga0207707_10031108 | Ga0207707_100311085 | 401 |
| 195 | 3300025919 | Ga0207657_10042130 | Ga0207657_100421303 | 401 |
| 196 | 3300025919 | Ga0207657_10121998 | Ga0207657_101219983 | 401 |
| 197 | 3300025919 | Ga0207657_10122040 | Ga0207657_101220403 | 401 |
| 198 | 3300025921 | Ga0207652_10136871 | Ga0207652_101368712 | 401 |
| 199 | 3300025928 | Ga0207700_10102431 | Ga0207700_101024312 | 401 |
| 200 | 3300025929 | Ga0207664_10000026 | Ga0207664_10000026110 | 401 |
| 201 | 3300025929 | Ga0207664_10014498 | Ga0207664_100144983 | 401 |
| 202 | 3300025932 | Ga0207690_10003519 | Ga0207690_100035196 | 401 |
| 203 | 3300025932 | Ga0207690_10026659 | Ga0207690_100266594 | 401 |
| 204 | 3300025933 | Ga0207706_10016229 | Ga0207706_100162297 | 401 |
| 205 | 3300026116 | Ga0207674_10028427 | Ga0207674_100284274 | 401 |
| 206 | 3300038443 | Ga0395901_0002971 | Ga0395901_0002971_7227_8432 | 401 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5uid-assembly2.cif.gz_D | the crystal structure of an aminotransferase tlmj from streptoalloteichus hindustanus | 0.8332 | 19 | 400 |
| 3bn1-assembly2.cif.gz_C | crystal structure of gdp-perosamine synthase | 0.8301 | 29 | 400 |
| 2oga-assembly1.cif.gz_A | x-ray crystal structure of s. venezuelae desv in complex with ketimine intermediate | 0.8262 | 17 | 400 |
| 3uwc-assembly1.cif.gz_A | structure of an aminotransferase (degt-dnrj-eryc1-strs family) from coxiella burnetii in complex with pmp | 0.8246 | 28 | 400 |
| 7n63-assembly1.cif.gz_A-2 | x-ray structure of hcan_0200, an aminotransferase from helicobacter canadensis in complex with its external aldimine | 0.8241 | 28 | 400 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_L0T6V0_4_199_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9082 | 30 | 190 | 3.40.640.10 |
| 2po3B01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9048 | 25 | 202 | 3.40.640.10 |
| 5u1zA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8892 | 28 | 209 | 3.40.640.10 |
| 4k2bA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8749 | 24 | 197 | 3.40.640.10 |
| 2ogeD01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.8745 | 17 | 198 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A318DRV6-F1-model_v4 | dTDP-4-amino-4,6-dideoxygalactose transaminase | 0.9959 | 7 | 400 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A318NA66-F1-model_v4 | Nucleotide sugar aminotransferase | 0.9876 | 5 | 400 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A318DRV6-F1-model_v4 | dTDP-4-amino-4,6-dideoxygalactose transaminase | 0.9834 | 7 | 400 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A4P5TXC4-F1-model_v4 | Nucleotide sugar aminotransferase | 0.9809 | 7 | 400 |
GO:0000271
GO:0008483 GO:0016020 GO:0030170 |
| AF-A0A318NA66-F1-model_v4 | Nucleotide sugar aminotransferase | 0.9777 | 5 | 400 |
GO:0000271
GO:0008483 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar