F314436

General Info

Members Datasets Scaffolds Average Seq Length
205 141 410 234

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_499063_c1|nmdc:mga06r32_499063_c1_255_1091
Length 278
Sequence LPSGQRVSRRAEAEEGGEGEAQVRGGGEPPGAGLTQVKPGHAGAPRIGRMVKSEAIAIPGYLAKTYWWAYVHPRAVRLFERQWLVNLILWGNFGRLRDAALRALGARLEGRTLQIACVYGDLTNRLRSRLAVGASLDVVDVLKVQLDNLGRKVRGDPRIGLIQGDSAALDIASASYDRALLFFLLHEQPEEVRRATLAEALRVVKPGGRLVIVDYHRPHALNPLYWPMVGVLRMLEPFAMDLWRSEIAAWFAPRAPVAELRKEILFGGLYQLVTLTKK

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
90 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
91 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 0.98
Rhizosphere 97.56
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_499063_c1 3300050510 Bacteria 1194
2 Ga0065707_10191530 3300005295 Unclassified 1358
3 Ga0070670_100028325 3300005331 Bacteria 4821
4 Ga0068868_100097994 3300005338 Bacteria 2370
5 Ga0070689_100004327 3300005340 Bacteria 9589
6 Ga0070692_10104996 3300005345 Bacteria 1554
7 Ga0070688_100061758 3300005365 Bacteria 2370
8 Ga0070688_100142832 3300005365 Bacteria 1628
9 Ga0070667_100109161 3300005367 Bacteria 2397
10 Ga0070714_100072896 3300005435 Bacteria 2974
11 Ga0070710_10038478 3300005437 Bacteria 2628
12 Ga0070701_10017816 3300005438 Bacteria 3327
13 Ga0070694_100050070 3300005444 Bacteria 2815
14 Ga0068867_100129353 3300005459 Bacteria 1960
15 Ga0068867_100616064 3300005459 Unclassified 948
16 Ga0070679_101013916 3300005530 Unclassified 774
17 Ga0068853_100236218 3300005539 Bacteria 1674
18 Ga0070672_100694991 3300005543 Bacteria 890
19 Ga0070686_100044348 3300005544 Bacteria 2795
20 Ga0070696_100092142 3300005546 Bacteria 2159
21 Ga0070696_100147532 3300005546 Bacteria 1724
22 Ga0068855_100015533 3300005563 Bacteria 9166
23 Ga0070664_100223091 3300005564 Unclassified 1687
24 Ga0068854_100508660 3300005578 Bacteria 1015
25 Ga0068854_100814535 3300005578 Bacteria 815
26 Ga0070702_100028095 3300005615 Bacteria 3045
27 Ga0068859_100071564 3300005617 Bacteria 3504
28 Ga0068859_100421976 3300005617 Bacteria 1430
29 Ga0068864_100043891 3300005618 Bacteria 3829
30 Ga0068861_100010218 3300005719 Bacteria 6515
31 Ga0068861_100065449 3300005719 Bacteria 2800
32 Ga0068863_100068461 3300005841 Bacteria 3358
33 Ga0068858_100076829 3300005842 Bacteria 3102
34 Ga0068858_100231108 3300005842 Bacteria 1753
35 Ga0068860_100989042 3300005843 Bacteria 859
36 Ga0075366_10122858 3300006195 Bacteria 1565
37 Ga0068871_100514530 3300006358 Bacteria 1080
38 Ga0075428_100005816 3300006844 Bacteria 13698
39 Ga0075428_100075057 3300006844 Bacteria 3693
40 Ga0075433_10072149 3300006852 Bacteria 3036
41 Ga0075433_10419695 3300006852 Bacteria 1180
42 Ga0075434_100000030 3300006871 Bacteria 64435
43 Ga0075434_100030885 3300006871 Bacteria 5279
44 Ga0075434_100206286 3300006871 Bacteria 1986
45 Ga0075434_100574280 3300006871 Bacteria 1147
46 Ga0075429_100001306 3300006880 Bacteria 20310
47 Ga0075429_100010182 3300006880 Bacteria 8140
48 Ga0075436_100000680 3300006914 Bacteria 22407
49 Ga0097620_100071559 3300006931 Bacteria 3504
50 Ga0097620_100421989 3300006931 Bacteria 1430
51 Ga0075435_100002432 3300007076 Bacteria 12359
52 Ga0075435_100051008 3300007076 Bacteria 3331
53 Ga0075435_100072617 3300007076 Bacteria 2811
54 Ga0075435_100695929 3300007076 Unclassified 883
55 Ga0105240_10015194 3300009093 Bacteria 10476
56 Ga0105240_10107001 3300009093 Bacteria 3391
57 Ga0105240_10684639 3300009093 Bacteria 1121
58 Ga0111539_10004562 3300009094 Bacteria 18106
59 Ga0111539_10013124 3300009094 Bacteria 10362
60 Ga0114129_10001453 3300009147 Bacteria 31988
61 Ga0114129_10759079 3300009147 Bacteria 1241
62 Ga0105242_10419521 3300009176 Bacteria 1254
63 Ga0105248_10277864 3300009177 Bacteria 1885
64 Ga0105248_11350954 3300009177 Bacteria 806
65 Ga0105238_10079630 3300009551 Bacteria 3266
66 Ga0157378_10005529 3300013297 Bacteria 11066
67 Ga0163162_10892893 3300013306 Bacteria 1002
68 Ga0163163_10055601 3300014325 Bacteria 3912
69 Ga0157379_10222448 3300014968 Bacteria 1710
70 Ga0209051_1049873 3300025303 Bacteria 1406
71 Ga0207642_10362525 3300025899 Bacteria 858
72 Ga0207705_10097800 3300025909 Bacteria 2156
73 Ga0207684_10075544 3300025910 Bacteria 2864
74 Ga0207707_10220987 3300025912 Bacteria 1649
75 Ga0207695_10062630 3300025913 Bacteria 3839
76 Ga0207695_10152518 3300025913 Bacteria 2249
77 Ga0207663_10138085 3300025916 Bacteria 1694
78 Ga0207657_10038747 3300025919 Bacteria 4239
79 Ga0207652_10010039 3300025921 Bacteria 7625
80 Ga0207694_10227542 3300025924 Bacteria 1522
81 Ga0207650_10065448 3300025925 Bacteria 2724
82 Ga0207664_10218622 3300025929 Bacteria 1651
83 Ga0207670_10001278 3300025936 Bacteria 13276
84 Ga0207704_10388068 3300025938 Bacteria 1098
85 Ga0207691_10678358 3300025940 Bacteria 870
86 Ga0207711_10192936 3300025941 Bacteria 1857
87 Ga0207679_10318620 3300025945 Bacteria 1346
88 Ga0207667_10085264 3300025949 Bacteria 3270
89 Ga0207703_10077478 3300026035 Bacteria 2760
90 Ga0207639_10058430 3300026041 Bacteria 2967
91 Ga0207708_10018084 3300026075 Bacteria 5304
92 Ga0207641_10449114 3300026088 Bacteria 1246
93 Ga0207648_10350852 3300026089 Bacteria 1330
94 Ga0207676_10118279 3300026095 Bacteria 2230
95 Ga0207676_10828655 3300026095 Bacteria 904
96 Ga0207675_100002779 3300026118 Bacteria 17193
97 Ga0207675_100017612 3300026118 Bacteria 6663
98 Ga0209983_1011511 3300027665 Bacteria 1811
99 Ga0209971_1002061 3300027682 Bacteria 4892
100 Ga0209998_10006084 3300027717 Bacteria 2509
101 Ga0207428_10062562 3300027907 Bacteria 2942
102 Ga0268266_10431701 3300028379 Bacteria 1250
103 Ga0268265_10014360 3300028380 Bacteria 5395
104 Ga0268265_10648308 3300028380 Bacteria 1015
105 Ga0268264_10338365 3300028381 Bacteria 1429
106 Ga0268264_10633780 3300028381 Bacteria 1056
107 Ga0265338_10012397 3300028800 Bacteria 9719
108 Ga0265332_10006310 3300031238 Bacteria 5389
109 Ga0265329_10011700 3300031242 Bacteria 3182
110 Ga0265314_10005757 3300031711 Bacteria 11118
111 Ga0265314_10100868 3300031711 Bacteria 1856
112 Ga0307411_10058252 3300032005 Bacteria 2556
113 Ga0373932_0006185 3300035112 Bacteria 2827
114 Ga0373939_0039569 3300035114 Unclassified 1412
115 Ga0373941_0118187 3300035115 Unclassified 942
116 Ga0373956_0030485 3300035119 Bacteria 2358
117 Ga0373960_0041288 3300035121 Bacteria 1335
118 Ga0373942_0067729 3300035207 Unclassified 1036
119 Ga0373961_0061649 3300035241 Unclassified 1140
120 Ga0373931_0001438 3300035691 Bacteria 10212
121 Ga0373933_0379073 3300035724 Bacteria 921
122 Ga0373937_0068060 3300036401 Bacteria 3282
123 Ga0373937_0351349 3300036401 Bacteria 1396
124 Ga0395899_0023510 3300037312 Bacteria 4667
125 Ga0395900_0010088 3300037418 Bacteria 9661
126 Ga0395898_0004536 3300037466 Bacteria 15161
127 Ga0395901_0120699 3300038443 Bacteria 2754
128 Ga0395901_0398153 3300038443 Bacteria 1415
129 Ga0451577_0019007 3300042876 Bacteria 6324
130 Ga0451577_0446656 3300042876 Bacteria 1174
131 Ga0451577_0449001 3300042876 Unclassified 1171
132 Ga0451576_0002616 3300045051 Bacteria 26343
133 Ga0451576_0055766 3300045051 Bacteria 4133
134 Ga0451576_0073858 3300045051 Bacteria 3549
135 Ga0495629_0080759 3300046459 Bacteria 2270
136 Ga0495669_0006417 3300046684 Bacteria 4910
137 Ga0496108_0084480 3300048911 Bacteria 2694
138 Ga0496109_0158488 3300048912 Bacteria 2120
139 Ga0501033_0003351 3300049570 Bacteria 13225
140 Ga0501034_0286426 3300049571 Bacteria 1586
141 Ga0501036_0002392 3300049572 Bacteria 14670
142 Ga0501036_0147050 3300049572 Bacteria 1988
143 Ga0501037_0250485 3300049573 Bacteria 1239
144 Ga0501039_0002349 3300049575 Bacteria 14081
145 Ga0501040_0000920 3300049576 Bacteria 18469
146 Ga0501041_0001042 3300049577 Bacteria 15192
147 Ga0501042_0000535 3300049578 Bacteria 19891
148 Ga0501042_0052676 3300049578 Bacteria 2903
149 Ga0501043_0038883 3300049579 Bacteria 3741
150 Ga0501043_0205455 3300049579 Bacteria 1527
151 Ga0501046_0197575 3300049580 Bacteria 1497
152 Ga0501047_0059822 3300049581 Bacteria 3678
153 Ga0501048_0000792 3300049582 Bacteria 23178
154 Ga0501048_0124489 3300049582 Bacteria 1823
155 Ga0501068_0004514 3300049584 Bacteria 7575
156 Ga0501071_0000655 3300049587 Bacteria 18045
157 Ga0501071_0012469 3300049587 Bacteria 5766
158 Ga0501071_0020886 3300049587 Bacteria 4555
159 Ga0501072_0002310 3300049588 Bacteria 14287
160 Ga0501073_0093443 3300049589 Bacteria 2090
161 Ga0501074_0012967 3300049590 Bacteria 6059
162 Ga0501074_0149010 3300049590 Bacteria 1673
163 Ga0501075_0000385 3300049591 Bacteria 25441
164 Ga0501075_0019321 3300049591 Bacteria 4940
165 Ga0501075_0021648 3300049591 Bacteria 4689
166 Ga0501076_0000684 3300049592 Bacteria 21801
167 Ga0501076_0017678 3300049592 Bacteria 5420
168 Ga0501076_0019197 3300049592 Bacteria 5221
169 Ga0501076_0453112 3300049592 Bacteria 1056
170 Ga0501077_0007503 3300049593 Bacteria 6728
171 Ga0501077_0392373 3300049593 Bacteria 887
172 Ga0501079_0039867 3300049741 Bacteria 3623
173 Ga0501079_0084770 3300049741 Bacteria 2451
174 Ga0501079_0089909 3300049741 Bacteria 2378
175 Ga0501079_0135534 3300049741 Bacteria 1917
176 Ga0501080_0003020 3300049742 Bacteria 14835
177 Ga0501080_0012279 3300049742 Bacteria 7847
178 Ga0501080_0169858 3300049742 Bacteria 2011
179 Ga0501081_0000492 3300049743 Bacteria 22041
180 Ga0501081_0168044 3300049743 Bacteria 1583
181 Ga0501035_0009184 3300049822 Bacteria 9193
182 Ga0501035_0174822 3300049822 Bacteria 1853
183 Ga0501044_0065055 3300049823 Bacteria 3719
184 Ga0501045_0001033 3300049824 Bacteria 18285
185 Ga0501045_0012380 3300049824 Bacteria 6009
186 nmdc:mga0k408_171981_c1 3300050493 Bacteria 1291
187 nmdc:mga05p37_1533_c1 3300050507 Bacteria 26864
188 nmdc:mga09592_3238_c1 3300050508 Bacteria 13173
189 nmdc:mga09592_8848_c1 3300050508 Bacteria 8189
190 nmdc:mga06r32_151135_c2 3300050510 Bacteria 1608
191 nmdc:mga08y16_2113_c1 3300050511 Bacteria 20371
192 nmdc:mga08y16_2230_c1 3300050511 Bacteria 19858
193 nmdc:mga0n895_19762_c1 3300050512 Bacteria 6267
194 nmdc:mga0n895_85648_c1 3300050512 Bacteria 3147
195 nmdc:mga0rr50_651988_c1 3300050513 Unclassified 898
196 nmdc:mga0rr50_800982_c1 3300050513 Unclassified 804
197 nmdc:mga0rr50_8105_c1 3300050513 Bacteria 6521
198 nmdc:mga08x19_15533_c1 3300050514 Bacteria 4634
199 nmdc:mga0a205_41598_c1 3300050515 Bacteria 3200
200 Ga0501084_0001803 3300054114 Bacteria 17071
201 Ga0501084_0142825 3300054114 Bacteria 2016
202 Ga0501082_0000654 3300060353 Bacteria 30565
203 Ga0501082_0068867 3300060353 Bacteria 3047
204 Ga0530510_0000699 3300061734 Bacteria 21743
205 Ga0530510_0043378 3300061734 Bacteria 3249
206 nmdc:mga06r32_499063_c1
207 Ga0065707_10191530
208 Ga0070670_100028325
209 Ga0068868_100097994
210 Ga0070689_100004327
211 Ga0070692_10104996
212 Ga0070688_100061758
213 Ga0070688_100142832
214 Ga0070667_100109161
215 Ga0070714_100072896
216 Ga0070710_10038478
217 Ga0070701_10017816
218 Ga0070694_100050070
219 Ga0068867_100129353
220 Ga0068867_100616064
221 Ga0070679_101013916
222 Ga0068853_100236218
223 Ga0070672_100694991
224 Ga0070686_100044348
225 Ga0070696_100092142
226 Ga0070696_100147532
227 Ga0068855_100015533
228 Ga0070664_100223091
229 Ga0068854_100508660
230 Ga0068854_100814535
231 Ga0070702_100028095
232 Ga0068859_100071564
233 Ga0068859_100421976
234 Ga0068864_100043891
235 Ga0068861_100010218
236 Ga0068861_100065449
237 Ga0068863_100068461
238 Ga0068858_100076829
239 Ga0068858_100231108
240 Ga0068860_100989042
241 Ga0075366_10122858
242 Ga0068871_100514530
243 Ga0075428_100005816
244 Ga0075428_100075057
245 Ga0075433_10072149
246 Ga0075433_10419695
247 Ga0075434_100000030
248 Ga0075434_100030885
249 Ga0075434_100206286
250 Ga0075434_100574280
251 Ga0075429_100001306
252 Ga0075429_100010182
253 Ga0075436_100000680
254 Ga0097620_100071559
255 Ga0097620_100421989
256 Ga0075435_100002432
257 Ga0075435_100051008
258 Ga0075435_100072617
259 Ga0075435_100695929
260 Ga0105240_10015194
261 Ga0105240_10107001
262 Ga0105240_10684639
263 Ga0111539_10004562
264 Ga0111539_10013124
265 Ga0114129_10001453
266 Ga0114129_10759079
267 Ga0105242_10419521
268 Ga0105248_10277864
269 Ga0105248_11350954
270 Ga0105238_10079630
271 Ga0157378_10005529
272 Ga0163162_10892893
273 Ga0163163_10055601
274 Ga0157379_10222448
275 Ga0209051_1049873
276 Ga0207642_10362525
277 Ga0207705_10097800
278 Ga0207684_10075544
279 Ga0207707_10220987
280 Ga0207695_10062630
281 Ga0207695_10152518
282 Ga0207663_10138085
283 Ga0207657_10038747
284 Ga0207652_10010039
285 Ga0207694_10227542
286 Ga0207650_10065448
287 Ga0207664_10218622
288 Ga0207670_10001278
289 Ga0207704_10388068
290 Ga0207691_10678358
291 Ga0207711_10192936
292 Ga0207679_10318620
293 Ga0207667_10085264
294 Ga0207703_10077478
295 Ga0207639_10058430
296 Ga0207708_10018084
297 Ga0207641_10449114
298 Ga0207648_10350852
299 Ga0207676_10118279
300 Ga0207676_10828655
301 Ga0207675_100002779
302 Ga0207675_100017612
303 Ga0209983_1011511
304 Ga0209971_1002061
305 Ga0209998_10006084
306 Ga0207428_10062562
307 Ga0268266_10431701
308 Ga0268265_10014360
309 Ga0268265_10648308
310 Ga0268264_10338365
311 Ga0268264_10633780
312 Ga0265338_10012397
313 Ga0265332_10006310
314 Ga0265329_10011700
315 Ga0265314_10005757
316 Ga0265314_10100868
317 Ga0307411_10058252
318 Ga0373932_0006185
319 Ga0373939_0039569
320 Ga0373941_0118187
321 Ga0373956_0030485
322 Ga0373960_0041288
323 Ga0373942_0067729
324 Ga0373961_0061649
325 Ga0373931_0001438
326 Ga0373933_0379073
327 Ga0373937_0068060
328 Ga0373937_0351349
329 Ga0395899_0023510
330 Ga0395900_0010088
331 Ga0395898_0004536
332 Ga0395901_0120699
333 Ga0395901_0398153
334 Ga0451577_0019007
335 Ga0451577_0446656
336 Ga0451577_0449001
337 Ga0451576_0002616
338 Ga0451576_0055766
339 Ga0451576_0073858
340 Ga0495629_0080759
341 Ga0495669_0006417
342 Ga0496108_0084480
343 Ga0496109_0158488
344 Ga0501033_0003351
345 Ga0501034_0286426
346 Ga0501036_0002392
347 Ga0501036_0147050
348 Ga0501037_0250485
349 Ga0501039_0002349
350 Ga0501040_0000920
351 Ga0501041_0001042
352 Ga0501042_0000535
353 Ga0501042_0052676
354 Ga0501043_0038883
355 Ga0501043_0205455
356 Ga0501046_0197575
357 Ga0501047_0059822
358 Ga0501048_0000792
359 Ga0501048_0124489
360 Ga0501068_0004514
361 Ga0501071_0000655
362 Ga0501071_0012469
363 Ga0501071_0020886
364 Ga0501072_0002310
365 Ga0501073_0093443
366 Ga0501074_0012967
367 Ga0501074_0149010
368 Ga0501075_0000385
369 Ga0501075_0019321
370 Ga0501075_0021648
371 Ga0501076_0000684
372 Ga0501076_0017678
373 Ga0501076_0019197
374 Ga0501076_0453112
375 Ga0501077_0007503
376 Ga0501077_0392373
377 Ga0501079_0039867
378 Ga0501079_0084770
379 Ga0501079_0089909
380 Ga0501079_0135534
381 Ga0501080_0003020
382 Ga0501080_0012279
383 Ga0501080_0169858
384 Ga0501081_0000492
385 Ga0501081_0168044
386 Ga0501035_0009184
387 Ga0501035_0174822
388 Ga0501044_0065055
389 Ga0501045_0001033
390 Ga0501045_0012380
391 nmdc:mga0k408_171981_c1
392 nmdc:mga05p37_1533_c1
393 nmdc:mga09592_3238_c1
394 nmdc:mga09592_8848_c1
395 nmdc:mga06r32_151135_c2
396 nmdc:mga08y16_2113_c1
397 nmdc:mga08y16_2230_c1
398 nmdc:mga0n895_19762_c1
399 nmdc:mga0n895_85648_c1
400 nmdc:mga0rr50_651988_c1
401 nmdc:mga0rr50_800982_c1
402 nmdc:mga0rr50_8105_c1
403 nmdc:mga08x19_15533_c1
404 nmdc:mga0a205_41598_c1
405 Ga0501084_0001803
406 Ga0501084_0142825
407 Ga0501082_0000654
408 Ga0501082_0068867
409 Ga0530510_0000699
410 Ga0530510_0043378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

112

208

0.95

PF08241

Methyltransf_11

Methyltransferase domain

113

212

0.92

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

84

226

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wzg-assembly1.cif.gz_F cypemycin n-terminal methyltransferase cypm 0.8372 50 169
5wwq-assembly1.cif.gz_A crystal structure of human nsun6 0.8269 51 168
4hh4-assembly1.cif.gz_C structure of the ccbj methyltransferase from streptomyces caelestis 0.8207 50 170
4hgy-assembly1.cif.gz_E structure of the ccbj methyltransferase from streptomyces caelestis 0.796 50 170
3kkz-assembly1.cif.gz_A crystal structure of the q5les9_bacfn protein from bacteroides fragilis. northeast structural genomics consortium target bfr250. 0.7779 51 192
ID Description Score Start End Superfamily
af_Q9P3E7_8_144_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8481 62 176 3.40.50.150
af_C7J169_1_82_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.844 40 106 3.40.50.150
af_F4J554_15_194_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8414 63 135 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8255 55 174 3.40.50.150
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8182 49 176 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1Y2K5B6-F1-model_v4 Putative type 11 methyltransferase 0.9794 11 231 GO:0008168
GO:0032259
AF-A0A7X6WQS4-F1-model_v4 deleted 0.9749 11 230
AF-A0A1Y2K5B6-F1-model_v4 Putative type 11 methyltransferase 0.9665 11 231 GO:0008168
GO:0032259
AF-A0A7C1R281-F1-model_v4 deleted 0.9531 14 230
AF-A0A084XWJ5-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9436 1 231 GO:0032259
GO:0043770

Map