F314296

General Info

Members Datasets Scaffolds Average Seq Length
205 105 410 204

Family's Representative Sequence

Representative Sequence 3300046665|Ga0495661_0002589|Ga0495661_0002589_6572_7249
Length 225
Sequence MRSPPASASRAVSNIEEHEVTTKALKGLYLVTPDWTDTGRLLAATQRALEGGAALVQYRNKTASEALREEQAAALLALCRRHDVPLLINDHVDLCLRLDADGVHVGGTDAPVAAVRAALGPDRIVGASCYGRFPLALAAQAAGASYVAFGGFYPSKVKVYEVSTAPDIVVGASARLGVPVVVIGGMTAENARPLVARGADMVAAISSVYLAEDPAAAVREFADLF

Samples

Sample ID Description Type Environment
1 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
7 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
8 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
9 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
10 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
11 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
12 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
13 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
14 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
15 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
16 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
17 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
18 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
19 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
20 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
21 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
22 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
23 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
24 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
25 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
26 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
27 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
28 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
29 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
30 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
31 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
32 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
33 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
34 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
35 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
36 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
37 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
38 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
39 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
40 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
41 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
42 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
43 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
44 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
45 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
46 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
47 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
48 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
49 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
50 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
51 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
52 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
53 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
54 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
55 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
56 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
57 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
58 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
59 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
60 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
61 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
62 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
63 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
64 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
65 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
66 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
67 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
68 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
69 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
70 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
71 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
72 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
73 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
74 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
75 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
76 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
77 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
78 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
79 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
80 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
81 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
82 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
83 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
86 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
87 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
96 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
97 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
100 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
101 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
102 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
103 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
104 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
105 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 4.39
Rhizosphere 87.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495661_0002589 3300046665 Bacteria 13872
2 JGI25154J39366_1002082 3300002738 Bacteria 5665
3 Ga0055529_1000027 3300003763 Bacteria 292744
4 Ga0065165_1000379 3300005262 Bacteria 72513
5 Ga0070682_100398371 3300005337 Bacteria 1040
6 Ga0070717_10229475 3300006028 Bacteria 1634
7 Ga0157376_10056250 3300014969 Bacteria 3285
8 Ga0163161_10473244 3300017792 Bacteria 1016
9 Ga0213872_10000450 3300021361 Bacteria 33492
10 Ga0209646_1000148 3300025246 Bacteria 101083
11 Ga0209233_1056009 3300025261 Bacteria 780
12 Ga0209455_1000033 3300025272 Bacteria 504606
13 Ga0209564_1000154 3300025295 Bacteria 166849
14 Ga0316182_1109814 3300030745 Bacteria 4126
15 Ga0307518_10027465 3300031838 Bacteria 4105
16 Ga0395899_0007473 3300037312 Bacteria 8439
17 Ga0395900_0029571 3300037418 Bacteria 5620
18 Ga0395900_0052149 3300037418 Bacteria 4211
19 Ga0395898_0036314 3300037466 Bacteria 4892
20 Ga0395905_0029817 3300037471 Bacteria 5142
21 Ga0395905_0079108 3300037471 Bacteria 3081
22 Ga0395901_0004762 3300038443 Bacteria 13695
23 Ga0395901_0008631 3300038443 Bacteria 10297
24 Ga0436361_0259873 3300039447 Bacteria 2474
25 Ga0436361_0719937 3300039447 Bacteria 34414
26 Ga0436361_0900144 3300039447 Bacteria 143515
27 Ga0436361_0997488 3300039447 Bacteria 5238
28 Ga0466972_0015605 3300044658 Bacteria 3798
29 Ga0466972_0240145 3300044658 Bacteria 848
30 Ga0466965_0012735 3300044683 Bacteria 3960
31 Ga0466964_0007839 3300044706 Bacteria 3997
32 Ga0466964_0024716 3300044706 Bacteria 2342
33 Ga0466964_0081939 3300044706 Bacteria 1386
34 Ga0466968_0016202 3300044735 Bacteria 2965
35 Ga0466968_0026105 3300044735 Bacteria 2395
36 Ga0466957_0036408 3300044842 Bacteria 2958
37 Ga0495617_004769 3300046452 Bacteria 4895
38 Ga0495617_019546 3300046452 Bacteria 2291
39 Ga0495627_033869 3300046453 Bacteria 1599
40 Ga0495592_0123990 3300046454 Bacteria 1814
41 Ga0495590_0000053 3300046457 Bacteria 103329
42 Ga0495591_000500 3300046458 Bacteria 30952
43 Ga0495638_0069946 3300046460 Bacteria 2150
44 Ga0495651_0030481 3300046462 Bacteria 4206
45 Ga0495651_0053748 3300046462 Bacteria 3099
46 Ga0495653_0019152 3300046463 Bacteria 5552
47 Ga0495650_0000582 3300046471 Bacteria 51082
48 Ga0495605_0005956 3300046474 Bacteria 7051
49 Ga0495605_0012089 3300046474 Bacteria 4797
50 Ga0495605_0028130 3300046474 Bacteria 2904
51 Ga0495605_0178882 3300046474 Bacteria 934
52 Ga0495605_0192645 3300046474 Bacteria 891
53 Ga0495605_0194439 3300046474 Bacteria 886
54 Ga0495584_0000700 3300046491 Bacteria 22162
55 Ga0495584_0000713 3300046491 Bacteria 21919
56 Ga0495584_0021171 3300046491 Bacteria 3302
57 Ga0495584_0023050 3300046491 Bacteria 3157
58 Ga0495584_0034159 3300046491 Bacteria 2573
59 Ga0495585_0010157 3300046492 Bacteria 5622
60 Ga0495585_0026788 3300046492 Bacteria 3291
61 Ga0495596_0002417 3300046500 Bacteria 10075
62 Ga0495596_0010674 3300046500 Bacteria 3991
63 Ga0495596_0086272 3300046500 Bacteria 1218
64 Ga0495596_0123170 3300046500 Bacteria 1006
65 Ga0495596_0131933 3300046500 Bacteria 969
66 Ga0495607_0005539 3300046501 Bacteria 9009
67 Ga0495607_0008995 3300046501 Bacteria 6794
68 Ga0495583_0002349 3300046506 Bacteria 16382
69 Ga0495583_0030684 3300046506 Bacteria 2614
70 Ga0495606_0001705 3300046507 Bacteria 28358
71 Ga0495606_0008630 3300046507 Bacteria 8804
72 Ga0495606_0062321 3300046507 Bacteria 2381
73 Ga0495608_0003969 3300046511 Bacteria 10626
74 Ga0495608_0022983 3300046511 Bacteria 4275
75 Ga0495610_0001136 3300046512 Bacteria 24193
76 Ga0495616_0000333 3300046513 Bacteria 37273
77 Ga0495616_0066163 3300046513 Bacteria 1758
78 Ga0495618_0029884 3300046514 Bacteria 3401
79 Ga0495628_0001866 3300046516 Bacteria 19122
80 Ga0495628_0006103 3300046516 Bacteria 10537
81 Ga0495630_0062709 3300046517 Bacteria 2792
82 Ga0495631_0016128 3300046518 Bacteria 3568
83 Ga0495631_0017610 3300046518 Bacteria 3376
84 Ga0495631_0033536 3300046518 Bacteria 2305
85 Ga0495632_0000789 3300046519 Bacteria 28200
86 Ga0495632_0016764 3300046519 Bacteria 4063
87 Ga0495637_0000053 3300046520 Bacteria 99739
88 Ga0495637_0008036 3300046520 Bacteria 5194
89 Ga0495643_0000450 3300046522 Bacteria 52786
90 Ga0495643_0021140 3300046522 Bacteria 3739
91 Ga0495643_0033190 3300046522 Bacteria 2858
92 Ga0495643_0122220 3300046522 Bacteria 1314
93 Ga0495643_0172112 3300046522 Bacteria 1058
94 Ga0495644_0004927 3300046523 Bacteria 5240
95 Ga0495644_0159899 3300046523 Bacteria 863
96 Ga0495648_0018137 3300046524 Bacteria 5000
97 Ga0495648_0020082 3300046524 Bacteria 4673
98 Ga0495642_0000441 3300046528 Bacteria 21882
99 Ga0495642_0016433 3300046528 Bacteria 2883
100 Ga0495642_0033874 3300046528 Bacteria 2055
101 Ga0495642_0057097 3300046528 Bacteria 1613
102 Ga0495642_0131874 3300046528 Bacteria 1076
103 Ga0495652_0006302 3300046529 Bacteria 11050
104 Ga0495652_0047614 3300046529 Bacteria 3676
105 Ga0495654_0025652 3300046530 Bacteria 3035
106 Ga0495654_0029459 3300046530 Bacteria 2799
107 Ga0495654_0278382 3300046530 Bacteria 689
108 Ga0495609_0008355 3300046538 Bacteria 5074
109 Ga0495609_0012712 3300046538 Bacteria 3990
110 Ga0495609_0013380 3300046538 Bacteria 3876
111 Ga0495609_0022317 3300046538 Bacteria 2915
112 Ga0495609_0025074 3300046538 Bacteria 2735
113 Ga0495597_0001089 3300046542 Bacteria 20605
114 Ga0495597_0001719 3300046542 Bacteria 15127
115 Ga0495597_0008412 3300046542 Bacteria 5172
116 Ga0495645_0291523 3300046543 Bacteria 1069
117 Ga0495633_0002489 3300046558 Bacteria 12983
118 Ga0495633_0004979 3300046558 Bacteria 8288
119 Ga0495668_0001492 3300046616 Bacteria 22413
120 Ga0495668_0008204 3300046616 Bacteria 6557
121 Ga0495668_0170490 3300046616 Bacteria 1192
122 Ga0495668_0171680 3300046616 Bacteria 1188
123 Ga0495611_0000271 3300046648 Bacteria 35492
124 Ga0495625_0059248 3300046660 Bacteria 2717
125 Ga0495625_0164631 3300046660 Bacteria 1484
126 Ga0495625_0191976 3300046660 Bacteria 1352
127 Ga0495635_0040247 3300046663 Bacteria 3230
128 Ga0495661_0000549 3300046665 Bacteria 38859
129 Ga0495661_0003556 3300046665 Bacteria 11481
130 Ga0495661_0005964 3300046665 Bacteria 8598
131 Ga0495661_0044089 3300046665 Bacteria 2736
132 Ga0495661_0071082 3300046665 Bacteria 2034
133 Ga0495661_0119904 3300046665 Bacteria 1454
134 Ga0495588_0027034 3300046674 Bacteria 2866
135 Ga0495588_0199143 3300046674 Bacteria 1058
136 Ga0495657_0040791 3300046675 Bacteria 3181
137 Ga0495657_0579613 3300046675 Bacteria 650
138 Ga0495599_0002151 3300046678 Bacteria 11458
139 Ga0495623_0018230 3300046679 Bacteria 4533
140 Ga0495646_0000331 3300046680 Bacteria 24355
141 Ga0495646_0065842 3300046680 Bacteria 2144
142 Ga0495669_0007903 3300046684 Bacteria 4465
143 Ga0495624_0031021 3300046690 Bacteria 3479
144 Ga0495670_0030143 3300046691 Bacteria 2694
145 Ga0495649_0000291 3300046694 Bacteria 44106
146 Ga0495649_0002838 3300046694 Bacteria 12027
147 Ga0495649_0021596 3300046694 Bacteria 3606
148 Ga0495649_0079125 3300046694 Bacteria 1758
149 Ga0495589_0000310 3300046794 Bacteria 38833
150 Ga0495589_0028271 3300046794 Bacteria 2830
151 Ga0495589_0031521 3300046794 Bacteria 2667
152 Ga0495589_0036011 3300046794 Bacteria 2481
153 Ga0495589_0037422 3300046794 Bacteria 2431
154 Ga0495589_0052645 3300046794 Bacteria 2011
155 Ga0495600_0013625 3300046809 Bacteria 5114
156 Ga0495604_0011114 3300047317 Bacteria 7147
157 Ga0495672_0000135 3300047320 Bacteria 110114
158 Ga0495672_0000340 3300047320 Bacteria 59814
159 Ga0495672_0002905 3300047320 Bacteria 15162
160 Ga0495672_0015430 3300047320 Bacteria 5187
161 Ga0495683_0001222 3300047323 Bacteria 17501
162 Ga0495683_0015691 3300047323 Bacteria 3935
163 Ga0495683_0106390 3300047323 Bacteria 1344
164 Ga0495677_0000387 3300047445 Bacteria 18876
165 Ga0495677_0001488 3300047445 Bacteria 9415
166 Ga0495677_0025608 3300047445 Bacteria 2140
167 Ga0495677_0055269 3300047445 Bacteria 1465
168 Ga0495685_005130 3300047447 Bacteria 4265
169 Ga0495673_0000074 3300047469 Bacteria 210788
170 Ga0495681_0026059 3300047470 Bacteria 3053
171 Ga0495686_0000802 3300047472 Bacteria 40756
172 Ga0495686_0009745 3300047472 Bacteria 6893
173 Ga0495602_0001510 3300048088 Bacteria 23177
174 Ga0495602_0017748 3300048088 Bacteria 7124
175 Ga0495626_0026114 3300048091 Bacteria 2849
176 Ga0495626_0027231 3300048091 Bacteria 2780
177 Ga0495626_0081383 3300048091 Bacteria 1438
178 Ga0496100_0022430 3300048903 Bacteria 3821
179 Ga0496100_0074065 3300048903 Bacteria 2280
180 Ga0496101_0057940 3300048904 Bacteria 2803
181 Ga0496103_0313500 3300048906 Bacteria 1009
182 Ga0496104_0413584 3300048907 Bacteria 1261
183 Ga0496105_0348696 3300048908 Bacteria 1183
184 Ga0496108_0106311 3300048911 Bacteria 2396
185 Ga0496111_0126409 3300048914 Bacteria 1890
186 Ga0496113_0328591 3300048916 Bacteria 1226
187 Ga0496122_0004067 3300048925 Bacteria 18560
188 Ga0496122_0056816 3300048925 Bacteria 2913
189 Ga0496123_0015149 3300048926 Bacteria 6344
190 Ga0496123_0023108 3300048926 Bacteria 4769
191 Ga0496123_0059036 3300048926 Bacteria 2484
192 Ga0496125_0004092 3300048928 Bacteria 17061
193 Ga0496125_0092984 3300048928 Bacteria 2252
194 Ga0496126_0184133 3300048929 Bacteria 1772
195 Ga0495678_000546 3300049459 Bacteria 36290
196 Ga0495678_000831 3300049459 Bacteria 27649
197 Ga0495678_023493 3300049459 Bacteria 2678
198 Ga0495682_0018621 3300049460 Bacteria 2615
199 Ga0495682_0029447 3300049460 Bacteria 2033
200 Ga0495682_0134325 3300049460 Bacteria 884
201 Ga0501230_000797 3300049667 Bacteria 3459
202 Ga0501225_0054752 3300049705 Bacteria 1116
203 Ga0495601_0004204 3300053077 Bacteria 8304
204 2644028009 2643221603 Bacteria 6147767
205 2809145795 2808606418 Bacteria 6724496
206 Ga0495661_0002589
207 JGI25154J39366_1002082
208 Ga0055529_1000027
209 Ga0065165_1000379
210 Ga0070682_100398371
211 Ga0070717_10229475
212 Ga0157376_10056250
213 Ga0163161_10473244
214 Ga0213872_10000450
215 Ga0209646_1000148
216 Ga0209233_1056009
217 Ga0209455_1000033
218 Ga0209564_1000154
219 Ga0316182_1109814
220 Ga0307518_10027465
221 Ga0395899_0007473
222 Ga0395900_0029571
223 Ga0395900_0052149
224 Ga0395898_0036314
225 Ga0395905_0029817
226 Ga0395905_0079108
227 Ga0395901_0004762
228 Ga0395901_0008631
229 Ga0436361_0259873
230 Ga0436361_0719937
231 Ga0436361_0900144
232 Ga0436361_0997488
233 Ga0466972_0015605
234 Ga0466972_0240145
235 Ga0466965_0012735
236 Ga0466964_0007839
237 Ga0466964_0024716
238 Ga0466964_0081939
239 Ga0466968_0016202
240 Ga0466968_0026105
241 Ga0466957_0036408
242 Ga0495617_004769
243 Ga0495617_019546
244 Ga0495627_033869
245 Ga0495592_0123990
246 Ga0495590_0000053
247 Ga0495591_000500
248 Ga0495638_0069946
249 Ga0495651_0030481
250 Ga0495651_0053748
251 Ga0495653_0019152
252 Ga0495650_0000582
253 Ga0495605_0005956
254 Ga0495605_0012089
255 Ga0495605_0028130
256 Ga0495605_0178882
257 Ga0495605_0192645
258 Ga0495605_0194439
259 Ga0495584_0000700
260 Ga0495584_0000713
261 Ga0495584_0021171
262 Ga0495584_0023050
263 Ga0495584_0034159
264 Ga0495585_0010157
265 Ga0495585_0026788
266 Ga0495596_0002417
267 Ga0495596_0010674
268 Ga0495596_0086272
269 Ga0495596_0123170
270 Ga0495596_0131933
271 Ga0495607_0005539
272 Ga0495607_0008995
273 Ga0495583_0002349
274 Ga0495583_0030684
275 Ga0495606_0001705
276 Ga0495606_0008630
277 Ga0495606_0062321
278 Ga0495608_0003969
279 Ga0495608_0022983
280 Ga0495610_0001136
281 Ga0495616_0000333
282 Ga0495616_0066163
283 Ga0495618_0029884
284 Ga0495628_0001866
285 Ga0495628_0006103
286 Ga0495630_0062709
287 Ga0495631_0016128
288 Ga0495631_0017610
289 Ga0495631_0033536
290 Ga0495632_0000789
291 Ga0495632_0016764
292 Ga0495637_0000053
293 Ga0495637_0008036
294 Ga0495643_0000450
295 Ga0495643_0021140
296 Ga0495643_0033190
297 Ga0495643_0122220
298 Ga0495643_0172112
299 Ga0495644_0004927
300 Ga0495644_0159899
301 Ga0495648_0018137
302 Ga0495648_0020082
303 Ga0495642_0000441
304 Ga0495642_0016433
305 Ga0495642_0033874
306 Ga0495642_0057097
307 Ga0495642_0131874
308 Ga0495652_0006302
309 Ga0495652_0047614
310 Ga0495654_0025652
311 Ga0495654_0029459
312 Ga0495654_0278382
313 Ga0495609_0008355
314 Ga0495609_0012712
315 Ga0495609_0013380
316 Ga0495609_0022317
317 Ga0495609_0025074
318 Ga0495597_0001089
319 Ga0495597_0001719
320 Ga0495597_0008412
321 Ga0495645_0291523
322 Ga0495633_0002489
323 Ga0495633_0004979
324 Ga0495668_0001492
325 Ga0495668_0008204
326 Ga0495668_0170490
327 Ga0495668_0171680
328 Ga0495611_0000271
329 Ga0495625_0059248
330 Ga0495625_0164631
331 Ga0495625_0191976
332 Ga0495635_0040247
333 Ga0495661_0000549
334 Ga0495661_0003556
335 Ga0495661_0005964
336 Ga0495661_0044089
337 Ga0495661_0071082
338 Ga0495661_0119904
339 Ga0495588_0027034
340 Ga0495588_0199143
341 Ga0495657_0040791
342 Ga0495657_0579613
343 Ga0495599_0002151
344 Ga0495623_0018230
345 Ga0495646_0000331
346 Ga0495646_0065842
347 Ga0495669_0007903
348 Ga0495624_0031021
349 Ga0495670_0030143
350 Ga0495649_0000291
351 Ga0495649_0002838
352 Ga0495649_0021596
353 Ga0495649_0079125
354 Ga0495589_0000310
355 Ga0495589_0028271
356 Ga0495589_0031521
357 Ga0495589_0036011
358 Ga0495589_0037422
359 Ga0495589_0052645
360 Ga0495600_0013625
361 Ga0495604_0011114
362 Ga0495672_0000135
363 Ga0495672_0000340
364 Ga0495672_0002905
365 Ga0495672_0015430
366 Ga0495683_0001222
367 Ga0495683_0015691
368 Ga0495683_0106390
369 Ga0495677_0000387
370 Ga0495677_0001488
371 Ga0495677_0025608
372 Ga0495677_0055269
373 Ga0495685_005130
374 Ga0495673_0000074
375 Ga0495681_0026059
376 Ga0495686_0000802
377 Ga0495686_0009745
378 Ga0495602_0001510
379 Ga0495602_0017748
380 Ga0495626_0026114
381 Ga0495626_0027231
382 Ga0495626_0081383
383 Ga0496100_0022430
384 Ga0496100_0074065
385 Ga0496101_0057940
386 Ga0496103_0313500
387 Ga0496104_0413584
388 Ga0496105_0348696
389 Ga0496108_0106311
390 Ga0496111_0126409
391 Ga0496113_0328591
392 Ga0496122_0004067
393 Ga0496122_0056816
394 Ga0496123_0015149
395 Ga0496123_0023108
396 Ga0496123_0059036
397 Ga0496125_0004092
398 Ga0496125_0092984
399 Ga0496126_0184133
400 Ga0495678_000546
401 Ga0495678_000831
402 Ga0495678_023493
403 Ga0495682_0018621
404 Ga0495682_0029447
405 Ga0495682_0134325
406 Ga0501230_000797
407 Ga0501225_0054752
408 Ga0495601_0004204
409 2644028009
410 2809145795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02581

TMP-TENI

Thiamine monophosphate synthase

28

208

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g67-assembly1.cif.gz_A thiamin phosphate synthase 0.8973 2 199
1g4p-assembly1.cif.gz_A thiamin phosphate synthase 0.8805 2 199
1g4e-assembly2.cif.gz_B thiamin phosphate synthase 0.8757 2 199
1g4p-assembly2.cif.gz_B thiamin phosphate synthase 0.8737 2 199
1g67-assembly1.cif.gz_A thiamin phosphate synthase 0.8717 2 199
ID Description Score Start End Superfamily
af_P40386_1_220_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8739 2 197 3.20.20.70
1yadC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8708 1 199 3.20.20.70
1xi3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8685 2 199 3.20.20.70
af_Q2FWG3_1_212_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8655 2 199 3.20.20.70
3o16A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8633 2 199 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6B1J2K7-F1-model_v4 deleted 0.9915 1 199
AF-A0A031GUN3-F1-model_v4 deleted 0.9876 1 199
AF-A0A4P8HXT0-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9868 1 199 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229
AF-A0A0Q6SCN2-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9849 1 199 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229
AF-A0A1M5RNT8-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9843 1 199 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229

Map