F314268

General Info

Members Datasets Scaffolds Average Seq Length
205 146 410 79

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0162203|Ga0495583_0162203_358_597
Length 79
Sequence MPQKQLLHLVIGGELKAIEGPAEFKDLKKVDLVGAYANYQEALTAWRAKAQSTVDNALMRYFIIHAHKLMNPDEDHDHH

Samples

Sample ID Description Type Environment
1 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
48 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
79 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
95 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
133 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
134 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
135 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
136 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
137 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
138 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
139 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
140 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
141 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
145 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
146 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 0.49
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.34
Nodule 0
Rhizoplane 0
Rhizosphere 83.41
Stem 0
Stem Tuber 0
Unclassified 1.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495583_0162203 3300046506 Bacteria 922
2 rootH2_10010179 3300003320 Bacteria 6088
3 rootH2_10024530 3300003320 Bacteria 2340
4 rootH2_10074326 3300003320 Unclassified 1832
5 rootL2_10059046 3300003322 Bacteria 2871
6 rootL2_10066996 3300003322 Bacteria 1203
7 rootL2_10141115 3300003322 Bacteria 1962
8 rootH1_10154346 3300003323 Bacteria 1105
9 Ga0070670_100040826 3300005331 Bacteria 3988
10 Ga0068869_100555346 3300005334 Bacteria 965
11 Ga0070666_10224718 3300005335 Bacteria 1325
12 Ga0070682_101433854 3300005337 Bacteria 591
13 Ga0070687_100856618 3300005343 Bacteria 648
14 Ga0070661_100204459 3300005344 Bacteria 1510
15 Ga0070668_100034002 3300005347 Bacteria 3885
16 Ga0070668_100039924 3300005347 Bacteria 3590
17 Ga0070668_102077408 3300005347 Unclassified 524
18 Ga0070669_100202645 3300005353 Bacteria 1562
19 Ga0070669_101350373 3300005353 Bacteria 618
20 Ga0070671_100018336 3300005355 Bacteria 5684
21 Ga0070659_100011844 3300005366 Bacteria 6455
22 Ga0070667_100020013 3300005367 Bacteria 5555
23 Ga0070667_100070057 3300005367 Bacteria 2985
24 Ga0070667_100496000 3300005367 Bacteria 1119
25 Ga0070667_100796802 3300005367 Bacteria 877
26 Ga0068853_100103034 3300005539 Bacteria 2526
27 Ga0068853_100632465 3300005539 Bacteria 1018
28 Ga0070665_100033476 3300005548 Bacteria 5170
29 Ga0070665_102017732 3300005548 Bacteria 582
30 Ga0070664_100822668 3300005564 Bacteria 869
31 Ga0068854_100504996 3300005578 Bacteria 1019
32 Ga0068859_100070930 3300005617 Bacteria 3519
33 Ga0068863_100000726 3300005841 Bacteria 33034
34 Ga0068858_100001315 3300005842 Bacteria 25647
35 Ga0068860_100040461 3300005843 Bacteria 4454
36 Ga0068860_100646289 3300005843 Bacteria 1065
37 Ga0068860_102841584 3300005843 Bacteria 502
38 Ga0068862_100011626 3300005844 Bacteria 7263
39 Ga0068862_100024543 3300005844 Bacteria 5060
40 Ga0068862_100306731 3300005844 Bacteria 1462
41 Ga0075366_10586638 3300006195 Bacteria 691
42 Ga0068871_102079064 3300006358 Bacteria 541
43 Ga0068865_100686023 3300006881 Bacteria 874
44 Ga0097620_100070927 3300006931 Bacteria 3519
45 Ga0105240_10320580 3300009093 Bacteria 1767
46 Ga0105247_10560069 3300009101 Bacteria 842
47 Ga0105241_10536347 3300009174 Bacteria 1048
48 Ga0105248_10148105 3300009177 Bacteria 2649
49 Ga0105248_10496514 3300009177 Bacteria 1376
50 Ga0105248_10679571 3300009177 Bacteria 1161
51 Ga0105248_10730086 3300009177 Bacteria 1117
52 Ga0105248_13175830 3300009177 Bacteria 523
53 Ga0105249_10313000 3300009553 Bacteria 1579
54 Ga0105249_11383481 3300009553 Bacteria 776
55 Ga0105239_13632771 3300010375 Bacteria 501
56 Ga0157373_10000643 3300013100 Bacteria 27439
57 Ga0157373_10000835 3300013100 Bacteria 23934
58 Ga0157370_10168726 3300013104 Bacteria 2035
59 Ga0163162_10080936 3300013306 Bacteria 3317
60 Ga0163162_10528628 3300013306 Bacteria 1309
61 Ga0157372_12163077 3300013307 Bacteria 639
62 Ga0163163_10003095 3300014325 Bacteria 14107
63 Ga0163163_10330885 3300014325 Bacteria 1578
64 Ga0157379_10023288 3300014968 Bacteria 5494
65 Ga0157379_11286852 3300014968 Bacteria 706
66 Ga0157376_10457869 3300014969 Bacteria 1246
67 Ga0182007_10403127 3300015262 Bacteria 521
68 Ga0183365_10003 3300015684 Bacteria 414944
69 Ga0213872_10014722 3300021361 Bacteria 3645
70 Ga0213872_10102180 3300021361 Bacteria 1277
71 Ga0213876_10323456 3300021384 Bacteria 820
72 Ga0213875_10284345 3300021388 Bacteria 781
73 Ga0209026_1050747 3300025250 Bacteria 590
74 Ga0207697_10447413 3300025315 Bacteria 573
75 Ga0207710_10408490 3300025900 Bacteria 697
76 Ga0207680_10299155 3300025903 Bacteria 1121
77 Ga0207654_11218602 3300025911 Bacteria 549
78 Ga0207695_10752759 3300025913 Bacteria 854
79 Ga0207662_10707510 3300025918 Bacteria 706
80 Ga0207649_10074148 3300025920 Bacteria 2183
81 Ga0207681_10243614 3300025923 Bacteria 1400
82 Ga0207681_11404715 3300025923 Bacteria 586
83 Ga0207650_10031308 3300025925 Bacteria 3840
84 Ga0207644_10038284 3300025931 Bacteria 3377
85 Ga0207690_10011620 3300025932 Bacteria 5262
86 Ga0207690_11127190 3300025932 Bacteria 654
87 Ga0207711_10096059 3300025941 Bacteria 2615
88 Ga0207711_10434409 3300025941 Bacteria 1222
89 Ga0207711_11995763 3300025941 Bacteria 523
90 Ga0207689_10537503 3300025942 Bacteria 981
91 Ga0207679_10070857 3300025945 Bacteria 2628
92 Ga0207712_10236090 3300025961 Bacteria 1470
93 Ga0207668_10004166 3300025972 Bacteria 8480
94 Ga0207668_10034376 3300025972 Bacteria 3366
95 Ga0207668_11800565 3300025972 Unclassified 552
96 Ga0207640_10186610 3300025981 Bacteria 1560
97 Ga0207658_10007678 3300025986 Bacteria 7345
98 Ga0207658_10036703 3300025986 Bacteria 3516
99 Ga0207658_10524865 3300025986 Bacteria 1057
100 Ga0207658_11122637 3300025986 Bacteria 718
101 Ga0207703_10001867 3300026035 Bacteria 18733
102 Ga0207639_10075617 3300026041 Bacteria 2649
103 Ga0207639_10688307 3300026041 Bacteria 948
104 Ga0207639_11281425 3300026041 Bacteria 688
105 Ga0207641_10040001 3300026088 Bacteria 3922
106 Ga0207676_10359611 3300026095 Bacteria 1349
107 Ga0207676_12528414 3300026095 Bacteria 510
108 Ga0209981_1000586 3300027378 Bacteria 4587
109 Ga0210000_1005342 3300027462 Bacteria 1864
110 Ga0209999_1004138 3300027543 Bacteria 2610
111 Ga0209970_1060127 3300027614 Bacteria 696
112 Ga0209983_1032001 3300027665 Bacteria 1123
113 Ga0268266_10288600 3300028379 Bacteria 1527
114 Ga0268266_11778374 3300028379 Bacteria 591
115 Ga0268265_10004124 3300028380 Bacteria 10203
116 Ga0268265_10058832 3300028380 Bacteria 2937
117 Ga0268265_10086793 3300028380 Bacteria 2488
118 Ga0268264_10091110 3300028381 Bacteria 2629
119 Ga0268264_10459003 3300028381 Bacteria 1236
120 Ga0265337_1011053 3300028556 Bacteria 3126
121 Ga0265326_10081151 3300028558 Bacteria 917
122 Ga0265334_10007542 3300028573 Bacteria 4662
123 Ga0265334_10109141 3300028573 Bacteria 996
124 Ga0307517_10496166 3300028786 Bacteria 622
125 Ga0265338_10057679 3300028800 Bacteria 3433
126 Ga0265338_10117326 3300028800 Bacteria 2130
127 Ga0265338_10141473 3300028800 Bacteria 1884
128 Ga0265338_10190301 3300028800 Bacteria 1556
129 Ga0265338_10213864 3300028800 Bacteria 1445
130 Ga0265338_10265769 3300028800 Bacteria 1259
131 Ga0265340_10033099 3300031247 Bacteria 2576
132 Ga0265327_10000875 3300031251 Bacteria 44465
133 Ga0265327_10218986 3300031251 Bacteria 856
134 Ga0307513_10003803 3300031456 Bacteria 20342
135 Ga0265314_10058905 3300031711 Bacteria 2630
136 Ga0307405_10282678 3300031731 Bacteria 1250
137 Ga0307413_10692672 3300031824 Bacteria 845
138 Ga0307410_11938163 3300031852 Bacteria 525
139 Ga0307412_11361349 3300031911 Bacteria 641
140 Ga0307414_10307102 3300032004 Bacteria 1345
141 Ga0307415_101222159 3300032126 Bacteria 709
142 Ga0307510_10098480 3300033180 Bacteria 2728
143 Ga0307510_10320123 3300033180 Bacteria 1008
144 Ga0373948_0191040 3300034817 Bacteria 530
145 Ga0373944_0187899 3300035089 Unclassified 743
146 Ga0373943_0203299 3300035170 Bacteria 1097
147 Ga0373946_0015302 3300035171 Bacteria 2906
148 Ga0373931_0689472 3300035691 Bacteria 674
149 Ga0373927_0005705 3300035695 Bacteria 8547
150 Ga0373937_0525769 3300036401 Bacteria 1124
151 Ga0373925_0001027 3300037068 Bacteria 25268
152 Ga0395905_0027514 3300037471 Bacteria 5362
153 Ga0436364_0340920 3300037853 Bacteria 810
154 Ga0436365_1303364 3300039437 Bacteria 1081
155 Ga0436360_0893468 3300039438 Bacteria 805
156 Ga0436361_0569329 3300039447 Bacteria 4642
157 Ga0436361_0807578 3300039447 Bacteria 6457
158 Ga0436361_0861409 3300039447 Bacteria 1755
159 Ga0436361_0952950 3300039447 Bacteria 904
160 Ga0451853_0237523 3300041512 Bacteria 511
161 Ga0451853_4034207 3300041512 Bacteria 617
162 Ga0450890_042879 3300042127 Bacteria 674
163 Ga0466969_0201954 3300044656 Bacteria 907
164 Ga0466972_0097026 3300044658 Bacteria 1396
165 Ga0466961_0808441 3300044693 Bacteria 559
166 Ga0466963_0601085 3300044694 Bacteria 777
167 Ga0466959_0028373 3300045049 Bacteria 4151
168 Ga0495642_0015142 3300046528 Bacteria 2993
169 Ga0495621_0396434 3300046539 Bacteria 585
170 Ga0495645_0109070 3300046543 Bacteria 1960
171 Ga0495674_0093538 3300047319 Bacteria 2565
172 Ga0495672_0020178 3300047320 Bacteria 4375
173 Ga0495677_0077200 3300047445 Bacteria 1246
174 Ga0501033_0003034 3300049570 Bacteria 13973
175 Ga0501033_0285236 3300049570 Bacteria 1165
176 Ga0501034_0013077 3300049571 Bacteria 8553
177 Ga0501034_0061048 3300049571 Bacteria 3787
178 Ga0501034_0062933 3300049571 Bacteria 3725
179 Ga0501034_0884303 3300049571 Bacteria 782
180 Ga0501036_0443646 3300049572 Bacteria 1081
181 Ga0501037_0060069 3300049573 Bacteria 2773
182 Ga0501038_0133909 3300049574 Bacteria 2032
183 Ga0501038_0911558 3300049574 Bacteria 648
184 Ga0501039_1599657 3300049575 Bacteria 500
185 Ga0501043_0270537 3300049579 Bacteria 1304
186 Ga0501046_0942583 3300049580 Bacteria 601
187 Ga0501047_0535368 3300049581 Bacteria 996
188 Ga0501044_0000588 3300049823 Bacteria 44117
189 nmdc:mga0k408_28173_c1 3300050493 Bacteria 2901
190 nmdc:mga07m45_364900_c1 3300050496 Bacteria 839
191 Ga0495612_0453056 3300053078 Bacteria 586
192 Ga0500635_0000623 3300053080 Bacteria 9244
193 Ga0500643_006214 3300053087 Bacteria 5023
194 Ga0500644_0237478 3300053088 Bacteria 765
195 Ga0500566_0308951 3300053094 Bacteria 741
196 Ga0500555_004205 3300053103 Bacteria 4092
197 Ga0500557_117156 3300053105 Bacteria 884
198 Ga0500562_003167 3300053108 Bacteria 4106
199 Ga0500608_000036 3300053122 Bacteria 60734
200 Ga0500642_0227681 3300053130 Bacteria 862
201 Ga0500559_0160999 3300053136 Bacteria 1055
202 Ga0587106_042780 3300059605 Bacteria 775
203 2643997817 2643221598 Bacteria 4578346
204 2819243124 2818991272 Bacteria 4622173
205 8005247216 8005246636 Bacteria 4933972
206 Ga0495583_0162203
207 rootH2_10010179
208 rootH2_10024530
209 rootH2_10074326
210 rootL2_10059046
211 rootL2_10066996
212 rootL2_10141115
213 rootH1_10154346
214 Ga0070670_100040826
215 Ga0068869_100555346
216 Ga0070666_10224718
217 Ga0070682_101433854
218 Ga0070687_100856618
219 Ga0070661_100204459
220 Ga0070668_100034002
221 Ga0070668_100039924
222 Ga0070668_102077408
223 Ga0070669_100202645
224 Ga0070669_101350373
225 Ga0070671_100018336
226 Ga0070659_100011844
227 Ga0070667_100020013
228 Ga0070667_100070057
229 Ga0070667_100496000
230 Ga0070667_100796802
231 Ga0068853_100103034
232 Ga0068853_100632465
233 Ga0070665_100033476
234 Ga0070665_102017732
235 Ga0070664_100822668
236 Ga0068854_100504996
237 Ga0068859_100070930
238 Ga0068863_100000726
239 Ga0068858_100001315
240 Ga0068860_100040461
241 Ga0068860_100646289
242 Ga0068860_102841584
243 Ga0068862_100011626
244 Ga0068862_100024543
245 Ga0068862_100306731
246 Ga0075366_10586638
247 Ga0068871_102079064
248 Ga0068865_100686023
249 Ga0097620_100070927
250 Ga0105240_10320580
251 Ga0105247_10560069
252 Ga0105241_10536347
253 Ga0105248_10148105
254 Ga0105248_10496514
255 Ga0105248_10679571
256 Ga0105248_10730086
257 Ga0105248_13175830
258 Ga0105249_10313000
259 Ga0105249_11383481
260 Ga0105239_13632771
261 Ga0157373_10000643
262 Ga0157373_10000835
263 Ga0157370_10168726
264 Ga0163162_10080936
265 Ga0163162_10528628
266 Ga0157372_12163077
267 Ga0163163_10003095
268 Ga0163163_10330885
269 Ga0157379_10023288
270 Ga0157379_11286852
271 Ga0157376_10457869
272 Ga0182007_10403127
273 Ga0183365_10003
274 Ga0213872_10014722
275 Ga0213872_10102180
276 Ga0213876_10323456
277 Ga0213875_10284345
278 Ga0209026_1050747
279 Ga0207697_10447413
280 Ga0207710_10408490
281 Ga0207680_10299155
282 Ga0207654_11218602
283 Ga0207695_10752759
284 Ga0207662_10707510
285 Ga0207649_10074148
286 Ga0207681_10243614
287 Ga0207681_11404715
288 Ga0207650_10031308
289 Ga0207644_10038284
290 Ga0207690_10011620
291 Ga0207690_11127190
292 Ga0207711_10096059
293 Ga0207711_10434409
294 Ga0207711_11995763
295 Ga0207689_10537503
296 Ga0207679_10070857
297 Ga0207712_10236090
298 Ga0207668_10004166
299 Ga0207668_10034376
300 Ga0207668_11800565
301 Ga0207640_10186610
302 Ga0207658_10007678
303 Ga0207658_10036703
304 Ga0207658_10524865
305 Ga0207658_11122637
306 Ga0207703_10001867
307 Ga0207639_10075617
308 Ga0207639_10688307
309 Ga0207639_11281425
310 Ga0207641_10040001
311 Ga0207676_10359611
312 Ga0207676_12528414
313 Ga0209981_1000586
314 Ga0210000_1005342
315 Ga0209999_1004138
316 Ga0209970_1060127
317 Ga0209983_1032001
318 Ga0268266_10288600
319 Ga0268266_11778374
320 Ga0268265_10004124
321 Ga0268265_10058832
322 Ga0268265_10086793
323 Ga0268264_10091110
324 Ga0268264_10459003
325 Ga0265337_1011053
326 Ga0265326_10081151
327 Ga0265334_10007542
328 Ga0265334_10109141
329 Ga0307517_10496166
330 Ga0265338_10057679
331 Ga0265338_10117326
332 Ga0265338_10141473
333 Ga0265338_10190301
334 Ga0265338_10213864
335 Ga0265338_10265769
336 Ga0265340_10033099
337 Ga0265327_10000875
338 Ga0265327_10218986
339 Ga0307513_10003803
340 Ga0265314_10058905
341 Ga0307405_10282678
342 Ga0307413_10692672
343 Ga0307410_11938163
344 Ga0307412_11361349
345 Ga0307414_10307102
346 Ga0307415_101222159
347 Ga0307510_10098480
348 Ga0307510_10320123
349 Ga0373948_0191040
350 Ga0373944_0187899
351 Ga0373943_0203299
352 Ga0373946_0015302
353 Ga0373931_0689472
354 Ga0373927_0005705
355 Ga0373937_0525769
356 Ga0373925_0001027
357 Ga0395905_0027514
358 Ga0436364_0340920
359 Ga0436365_1303364
360 Ga0436360_0893468
361 Ga0436361_0569329
362 Ga0436361_0807578
363 Ga0436361_0861409
364 Ga0436361_0952950
365 Ga0451853_0237523
366 Ga0451853_4034207
367 Ga0450890_042879
368 Ga0466969_0201954
369 Ga0466972_0097026
370 Ga0466961_0808441
371 Ga0466963_0601085
372 Ga0466959_0028373
373 Ga0495642_0015142
374 Ga0495621_0396434
375 Ga0495645_0109070
376 Ga0495674_0093538
377 Ga0495672_0020178
378 Ga0495677_0077200
379 Ga0501033_0003034
380 Ga0501033_0285236
381 Ga0501034_0013077
382 Ga0501034_0061048
383 Ga0501034_0062933
384 Ga0501034_0884303
385 Ga0501036_0443646
386 Ga0501037_0060069
387 Ga0501038_0133909
388 Ga0501038_0911558
389 Ga0501039_1599657
390 Ga0501043_0270537
391 Ga0501046_0942583
392 Ga0501047_0535368
393 Ga0501044_0000588
394 nmdc:mga0k408_28173_c1
395 nmdc:mga07m45_364900_c1
396 Ga0495612_0453056
397 Ga0500635_0000623
398 Ga0500643_006214
399 Ga0500644_0237478
400 Ga0500566_0308951
401 Ga0500555_004205
402 Ga0500557_117156
403 Ga0500562_003167
404 Ga0500608_000036
405 Ga0500642_0227681
406 Ga0500559_0160999
407 Ga0587106_042780
408 2643997817
409 2819243124
410 8005247216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13773

DUF4170

Domain of unknown function (DUF4170)

6

66

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mhe-assembly1.cif.gz_B nmr structure of the protein np_419126.1 from caulobacter crescentus 0.7667 1 72
2mhe-assembly1.cif.gz_B nmr structure of the protein np_419126.1 from caulobacter crescentus 0.7419 1 72
3dfe-assembly1.cif.gz_F crystal structure of a putative pii-like signaling protein (yp_323533.1) from anabaena variabilis atcc 29413 at 2.35 a resolution 0.6416 5 66
3g3p-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6372 6 65
7wq5-assembly2.cif.gz_B crystal structure of arabidopsis transcriptional factor wrinkled1 with dsdna 0.6366 12 51
ID Description Score Start End Superfamily
af_K7UQ19_118_172_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.8456 26 54 3.30.730.10
af_K7KMY2_15_72_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.8018 27 57 3.30.730.10
af_B4FET9_33_90_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7758 28 57 3.30.730.10
2mheB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Uncharacterised protein PF13773, DUF4170 0.7667 1 72 3.30.70.2400
2mheB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Uncharacterised protein PF13773, DUF4170 0.7419 1 72 3.30.70.2400
ID Description Score Start End GO Terms
AF-A0A5M8P756-F1-model_v4 DUF4170 domain-containing protein 0.9942 6 64
AF-C6XHY3-F1-model_v4 DUF4170 domain-containing protein 0.9818 4 64
AF-A0A350LWG0-F1-model_v4 DUF4170 domain-containing protein 0.9546 7 54
AF-A0A258DDP0-F1-model_v4 Inositol monophosphatase 0.9497 1 65
AF-U6B3L5-F1-model_v4 Inositol monophosphatase 0.9489 1 66

Map