F314254

General Info

Members Datasets Scaffolds Average Seq Length
205 165 410 164

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0000340|Ga0495580_0000340_31836_32393
Length 185
Sequence LGCSWDGIFFSSRKSNEENSMSNTLKLEAHGDREIVMTRAFDAPRQLVFEAFTRPDLLRQWLLGPPGWTMPVCEVDLRVGGRYRYVWRNEKGVGMTAGGTYREIVVPERIVATETFEPPWYPGECTNTLLMREEGGRTILTQTLRYESNAAREMVIKSPMESGVAISYDRLEQMLAAQNAAGQKK

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
97 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
98 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
155 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
156 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
157 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
158 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
159 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
160 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
161 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
164 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
165 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 0
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.78
Nodule 0
Rhizoplane 1.46
Rhizosphere 84.88
Stem 0
Stem Tuber 0
Unclassified 16.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0000340 3300046472 Bacteria 38108
2 rootL2_10057190 3300003322 Bacteria 2721
3 Ga0070683_100000589 3300005329 Bacteria 25967
4 Ga0070690_100363831 3300005330 Bacteria 1053
5 Ga0068868_100228198 3300005338 Bacteria 1561
6 Ga0070687_100183660 3300005343 Bacteria 1255
7 Ga0070661_100364436 3300005344 Unclassified 1136
8 Ga0070674_100455883 3300005356 Unclassified 1056
9 Ga0070673_101159165 3300005364 Unclassified 723
10 Ga0070709_10100830 3300005434 Bacteria 1923
11 Ga0070709_10627268 3300005434 Bacteria 830
12 Ga0070713_100375149 3300005436 Bacteria 1324
13 Ga0070711_100055989 3300005439 Bacteria 2726
14 Ga0070708_101171219 3300005445 Unclassified 719
15 Ga0070684_100072375 3300005535 Bacteria 3035
16 Ga0070697_100012462 3300005536 Bacteria 6662
17 Ga0068853_100171697 3300005539 Bacteria 1962
18 Ga0068853_101031521 3300005539 Bacteria 792
19 Ga0070665_100000112 3300005548 Bacteria 151497
20 Ga0070665_100028546 3300005548 Bacteria 5620
21 Ga0070664_100297395 3300005564 Unclassified 1458
22 Ga0068852_100100073 3300005616 Unclassified 2614
23 Ga0068852_101019402 3300005616 Unclassified 847
24 Ga0068864_101899261 3300005618 Unclassified 601
25 Ga0068858_100708258 3300005842 Bacteria 980
26 Ga0068860_100200827 3300005843 Bacteria 1932
27 Ga0068860_101203833 3300005843 Bacteria 778
28 Ga0068862_101831950 3300005844 Bacteria 616
29 Ga0081455_10143315 3300005937 Bacteria 1852
30 Ga0081538_10023471 3300005981 Bacteria 4433
31 Ga0075365_10002797 3300006038 Bacteria 8732
32 Ga0075363_100006440 3300006048 Bacteria 5333
33 Ga0075364_10320321 3300006051 Bacteria 1056
34 Ga0070716_100000345 3300006173 Bacteria 18865
35 Ga0070712_100001029 3300006175 Bacteria 16833
36 Ga0075367_10200150 3300006178 Bacteria 1248
37 Ga0075366_10672354 3300006195 Bacteria 643
38 Ga0075370_10014367 3300006353 Bacteria 4222
39 Ga0068871_100307350 3300006358 Bacteria 1393
40 Ga0075428_100094071 3300006844 Bacteria 3267
41 Ga0075428_100120902 3300006844 Bacteria 2852
42 Ga0075430_100332509 3300006846 Bacteria 1255
43 Ga0075431_100142518 3300006847 Bacteria 2470
44 Ga0075431_100403566 3300006847 Bacteria 1368
45 Ga0075431_101157825 3300006847 Bacteria 737
46 Ga0075433_10430678 3300006852 Bacteria 1163
47 Ga0075434_100781894 3300006871 Bacteria 971
48 Ga0075429_100005010 3300006880 Bacteria 11403
49 Ga0075429_100104577 3300006880 Bacteria 2473
50 Ga0099794_10000672 3300007265 Bacteria 11440
51 Ga0105240_10148294 3300009093 Bacteria 2796
52 Ga0111539_12421322 3300009094 Unclassified 609
53 Ga0114129_10005708 3300009147 Bacteria 17632
54 Ga0114129_10131789 3300009147 Bacteria 3432
55 Ga0114129_10649593 3300009147 Bacteria 1362
56 Ga0114129_11307062 3300009147 Bacteria 898
57 Ga0114129_12331618 3300009147 Unclassified 642
58 Ga0105248_10794027 3300009177 Bacteria 1068
59 Ga0105248_10854369 3300009177 Unclassified 1027
60 Ga0105238_10052919 3300009551 Bacteria 4081
61 Ga0105238_10390719 3300009551 Bacteria 1383
62 Ga0105249_10565931 3300009553 Unclassified 1188
63 Ga0157371_10233900 3300013102 Unclassified 1321
64 Ga0157370_10308114 3300013104 Bacteria 1461
65 Ga0163162_10006696 3300013306 Bacteria 11169
66 Ga0157372_10079255 3300013307 Bacteria 3714
67 Ga0157379_10808922 3300014968 Unclassified 885
68 Ga0213873_10249587 3300021358 Unclassified 562
69 Ga0207642_10859205 3300025899 Bacteria 580
70 Ga0207680_10269859 3300025903 Bacteria 1180
71 Ga0207685_10007373 3300025905 Bacteria 3061
72 Ga0207699_10098122 3300025906 Unclassified 1853
73 Ga0207695_10241572 3300025913 Bacteria 1707
74 Ga0207693_10008428 3300025915 Bacteria 8433
75 Ga0207663_10062629 3300025916 Bacteria 2365
76 Ga0207662_10055252 3300025918 Bacteria 2369
77 Ga0207649_10271180 3300025920 Unclassified 1230
78 Ga0207652_10640276 3300025921 Unclassified 951
79 Ga0207694_10132159 3300025924 Unclassified 2001
80 Ga0207700_10411839 3300025928 Bacteria 1186
81 Ga0207669_10413741 3300025937 Unclassified 1059
82 Ga0207665_10000147 3300025939 Bacteria 47628
83 Ga0207711_10099219 3300025941 Bacteria 2574
84 Ga0207711_10699532 3300025941 Bacteria 945
85 Ga0207689_10024054 3300025942 Bacteria 5110
86 Ga0207661_10003157 3300025944 Bacteria 11427
87 Ga0207640_10621397 3300025981 Bacteria 917
88 Ga0207677_10167387 3300026023 Bacteria 1715
89 Ga0207639_10188248 3300026041 Bacteria 1761
90 Ga0207675_101092871 3300026118 Unclassified 817
91 Ga0207683_10064405 3300026121 Bacteria 3230
92 Ga0207698_10185438 3300026142 Unclassified 1848
93 Ga0209588_1012511 3300027671 Bacteria 2577
94 Ga0209813_10108209 3300027866 Bacteria 954
95 Ga0268266_10000222 3300028379 Bacteria 98723
96 Ga0268266_10163230 3300028379 Bacteria 2017
97 Ga0268264_10261096 3300028381 Bacteria 1613
98 Ga0265332_10079890 3300031238 Bacteria 1388
99 Ga0265328_10101805 3300031239 Bacteria 1064
100 Ga0307513_10033415 3300031456 Bacteria 5782
101 Ga0307513_10284159 3300031456 Bacteria 1430
102 Ga0307408_100041613 3300031548 Bacteria 3258
103 Ga0307516_10523701 3300031730 Unclassified 839
104 Ga0307518_10000423 3300031838 Bacteria 32539
105 Ga0307406_10161740 3300031901 Bacteria 1610
106 Ga0307412_10159275 3300031911 Bacteria 1675
107 Ga0307416_100315363 3300032002 Bacteria 1563
108 Ga0307416_101037225 3300032002 Bacteria 924
109 Ga0307411_11936779 3300032005 Unclassified 549
110 Ga0373936_0000012 3300035113 Bacteria 228915
111 Ga0373937_0117718 3300036401 Bacteria 2475
112 Ga0373937_0720873 3300036401 Bacteria 944
113 Ga0395905_0006745 3300037471 Bacteria 11499
114 Ga0395905_0167726 3300037471 Bacteria 2063
115 Ga0436361_0097726 3300039447 Bacteria 653
116 Ga0436362_1247076 3300039453 Unclassified 823
117 Ga0439465_0024260 3300041413 Bacteria 1911
118 Ga0451793_0011142 3300041452 Bacteria 1605
119 Ga0451800_0710658 3300041459 Unclassified 620
120 Ga0451807_2582574 3300041486 Unclassified 1104
121 Ga0466963_0530248 3300044694 Bacteria 831
122 Ga0466957_0992062 3300044842 Bacteria 603
123 Ga0451576_1111043 3300045051 Bacteria 827
124 Ga0466967_0005326 3300045976 Bacteria 8890
125 Ga0466967_0773272 3300045976 Bacteria 953
126 Ga0495638_0006892 3300046460 Bacteria 8203
127 Ga0495638_0056740 3300046460 Bacteria 2430
128 Ga0495580_0091042 3300046472 Bacteria 2123
129 Ga0495580_0523320 3300046472 Bacteria 790
130 Ga0495662_0004804 3300046476 Bacteria 6770
131 Ga0495618_0242421 3300046514 Unclassified 1133
132 Ga0495628_0000775 3300046516 Bacteria 29403
133 Ga0495628_0189274 3300046516 Bacteria 1554
134 Ga0495630_0000001 3300046517 Bacteria 1687293
135 Ga0495632_0296141 3300046519 Bacteria 718
136 Ga0495666_0071881 3300046526 Unclassified 1644
137 Ga0495640_0034508 3300046533 Bacteria 3587
138 Ga0495640_0233215 3300046533 Bacteria 1157
139 Ga0495668_0660118 3300046616 Bacteria 578
140 Ga0495657_0421516 3300046675 Bacteria 784
141 Ga0495599_0110337 3300046678 Bacteria 1714
142 Ga0495684_0046931 3300047471 Bacteria 3304
143 Ga0495684_0421452 3300047471 Bacteria 933
144 Ga0496126_0125856 3300048929 Bacteria 2218
145 Ga0496126_0803608 3300048929 Unclassified 721
146 Ga0501036_0206268 3300049572 Bacteria 1652
147 Ga0501036_0777896 3300049572 Bacteria 789
148 Ga0501037_0469321 3300049573 Bacteria 857
149 Ga0501038_0003235 3300049574 Bacteria 15179
150 Ga0501039_0026761 3300049575 Bacteria 4432
151 Ga0501040_0118784 3300049576 Bacteria 1854
152 Ga0501041_0000590 3300049577 Bacteria 18968
153 Ga0501042_0046861 3300049578 Bacteria 3082
154 Ga0501043_0150746 3300049579 Bacteria 1820
155 Ga0501046_0025442 3300049580 Bacteria 4844
156 Ga0501047_0137793 3300049581 Unclassified 2320
157 Ga0501047_0139229 3300049581 Bacteria 2306
158 Ga0501048_0050555 3300049582 Bacteria 2960
159 Ga0501067_0174907 3300049583 Bacteria 1195
160 Ga0501068_0022403 3300049584 Bacteria 3694
161 Ga0501068_0674041 3300049584 Bacteria 676
162 Ga0501071_0226039 3300049587 Bacteria 1409
163 Ga0501072_0006061 3300049588 Bacteria 9228
164 Ga0501073_0497736 3300049589 Bacteria 843
165 Ga0501073_1267805 3300049589 Bacteria 505
166 Ga0501074_0160419 3300049590 Bacteria 1606
167 Ga0501075_0000868 3300049591 Bacteria 19100
168 Ga0501075_0530586 3300049591 Bacteria 898
169 Ga0501076_0172417 3300049592 Bacteria 1763
170 Ga0501077_0002578 3300049593 Bacteria 10868
171 Ga0501080_0137179 3300049742 Bacteria 2263
172 Ga0501081_0032650 3300049743 Bacteria 3532
173 Ga0501035_0372935 3300049822 Bacteria 1191
174 Ga0501035_1328666 3300049822 Bacteria 553
175 Ga0501044_0101656 3300049823 Bacteria 2892
176 Ga0501045_0228830 3300049824 Bacteria 1384
177 nmdc:mga03683_216074_c1 3300050489 Bacteria 883
178 nmdc:mga03n38_1178_c1 3300050490 Bacteria 7287
179 nmdc:mga00v17_427043_c1 3300050491 Unclassified 861
180 nmdc:mga06z11_170043_c1 3300050494 Bacteria 1251
181 nmdc:mga07m45_1587_c1 3300050496 Bacteria 10470
182 nmdc:mga05p37_1235422_c1 3300050507 Bacteria 768
183 nmdc:mga05p37_3814_c1 3300050507 Bacteria 17632
184 nmdc:mga09592_1331_c1 3300050508 Bacteria 19786
185 nmdc:mga09592_173304_c1 3300050508 Bacteria 1866
186 nmdc:mga0qj67_326907_c1 3300050509 Bacteria 1241
187 nmdc:mga06r32_435212_c1 3300050510 Unclassified 1292
188 nmdc:mga06r32_846209_c1 3300050510 Bacteria 873
189 nmdc:mga08y16_695275_c1 3300050511 Bacteria 1017
190 nmdc:mga0a205_16406_c1 3300050515 Bacteria 6937
191 Ga0495601_0504866 3300053077 Bacteria 780
192 Ga0495619_0194874 3300053085 Bacteria 1403
193 Ga0495619_0919438 3300053085 Bacteria 588
194 Ga0500651_0720828 3300053093 Bacteria 532
195 Ga0500650_0097363 3300053098 Bacteria 1378
196 Ga0500658_0214550 3300053134 Bacteria 882
197 Ga0500568_0069685 3300053139 Bacteria 1348
198 Ga0500603_105566 3300053150 Bacteria 841
199 Ga0500636_0135314 3300053177 Bacteria 1369
200 Ga0590075_028153 3300059424 Bacteria 1419
201 Ga0501082_0196193 3300060353 Bacteria 1756
202 Ga0501082_1379172 3300060353 Bacteria 616
203 2586058229 2585427649 Bacteria 9053857
204 2809592914 2808606522 Bacteria 9488490
205 2915768179 2915768154 Bacteria 8424322
206 Ga0495580_0000340
207 rootL2_10057190
208 Ga0070683_100000589
209 Ga0070690_100363831
210 Ga0068868_100228198
211 Ga0070687_100183660
212 Ga0070661_100364436
213 Ga0070674_100455883
214 Ga0070673_101159165
215 Ga0070709_10100830
216 Ga0070709_10627268
217 Ga0070713_100375149
218 Ga0070711_100055989
219 Ga0070708_101171219
220 Ga0070684_100072375
221 Ga0070697_100012462
222 Ga0068853_100171697
223 Ga0068853_101031521
224 Ga0070665_100000112
225 Ga0070665_100028546
226 Ga0070664_100297395
227 Ga0068852_100100073
228 Ga0068852_101019402
229 Ga0068864_101899261
230 Ga0068858_100708258
231 Ga0068860_100200827
232 Ga0068860_101203833
233 Ga0068862_101831950
234 Ga0081455_10143315
235 Ga0081538_10023471
236 Ga0075365_10002797
237 Ga0075363_100006440
238 Ga0075364_10320321
239 Ga0070716_100000345
240 Ga0070712_100001029
241 Ga0075367_10200150
242 Ga0075366_10672354
243 Ga0075370_10014367
244 Ga0068871_100307350
245 Ga0075428_100094071
246 Ga0075428_100120902
247 Ga0075430_100332509
248 Ga0075431_100142518
249 Ga0075431_100403566
250 Ga0075431_101157825
251 Ga0075433_10430678
252 Ga0075434_100781894
253 Ga0075429_100005010
254 Ga0075429_100104577
255 Ga0099794_10000672
256 Ga0105240_10148294
257 Ga0111539_12421322
258 Ga0114129_10005708
259 Ga0114129_10131789
260 Ga0114129_10649593
261 Ga0114129_11307062
262 Ga0114129_12331618
263 Ga0105248_10794027
264 Ga0105248_10854369
265 Ga0105238_10052919
266 Ga0105238_10390719
267 Ga0105249_10565931
268 Ga0157371_10233900
269 Ga0157370_10308114
270 Ga0163162_10006696
271 Ga0157372_10079255
272 Ga0157379_10808922
273 Ga0213873_10249587
274 Ga0207642_10859205
275 Ga0207680_10269859
276 Ga0207685_10007373
277 Ga0207699_10098122
278 Ga0207695_10241572
279 Ga0207693_10008428
280 Ga0207663_10062629
281 Ga0207662_10055252
282 Ga0207649_10271180
283 Ga0207652_10640276
284 Ga0207694_10132159
285 Ga0207700_10411839
286 Ga0207669_10413741
287 Ga0207665_10000147
288 Ga0207711_10099219
289 Ga0207711_10699532
290 Ga0207689_10024054
291 Ga0207661_10003157
292 Ga0207640_10621397
293 Ga0207677_10167387
294 Ga0207639_10188248
295 Ga0207675_101092871
296 Ga0207683_10064405
297 Ga0207698_10185438
298 Ga0209588_1012511
299 Ga0209813_10108209
300 Ga0268266_10000222
301 Ga0268266_10163230
302 Ga0268264_10261096
303 Ga0265332_10079890
304 Ga0265328_10101805
305 Ga0307513_10033415
306 Ga0307513_10284159
307 Ga0307408_100041613
308 Ga0307516_10523701
309 Ga0307518_10000423
310 Ga0307406_10161740
311 Ga0307412_10159275
312 Ga0307416_100315363
313 Ga0307416_101037225
314 Ga0307411_11936779
315 Ga0373936_0000012
316 Ga0373937_0117718
317 Ga0373937_0720873
318 Ga0395905_0006745
319 Ga0395905_0167726
320 Ga0436361_0097726
321 Ga0436362_1247076
322 Ga0439465_0024260
323 Ga0451793_0011142
324 Ga0451800_0710658
325 Ga0451807_2582574
326 Ga0466963_0530248
327 Ga0466957_0992062
328 Ga0451576_1111043
329 Ga0466967_0005326
330 Ga0466967_0773272
331 Ga0495638_0006892
332 Ga0495638_0056740
333 Ga0495580_0091042
334 Ga0495580_0523320
335 Ga0495662_0004804
336 Ga0495618_0242421
337 Ga0495628_0000775
338 Ga0495628_0189274
339 Ga0495630_0000001
340 Ga0495632_0296141
341 Ga0495666_0071881
342 Ga0495640_0034508
343 Ga0495640_0233215
344 Ga0495668_0660118
345 Ga0495657_0421516
346 Ga0495599_0110337
347 Ga0495684_0046931
348 Ga0495684_0421452
349 Ga0496126_0125856
350 Ga0496126_0803608
351 Ga0501036_0206268
352 Ga0501036_0777896
353 Ga0501037_0469321
354 Ga0501038_0003235
355 Ga0501039_0026761
356 Ga0501040_0118784
357 Ga0501041_0000590
358 Ga0501042_0046861
359 Ga0501043_0150746
360 Ga0501046_0025442
361 Ga0501047_0137793
362 Ga0501047_0139229
363 Ga0501048_0050555
364 Ga0501067_0174907
365 Ga0501068_0022403
366 Ga0501068_0674041
367 Ga0501071_0226039
368 Ga0501072_0006061
369 Ga0501073_0497736
370 Ga0501073_1267805
371 Ga0501074_0160419
372 Ga0501075_0000868
373 Ga0501075_0530586
374 Ga0501076_0172417
375 Ga0501077_0002578
376 Ga0501080_0137179
377 Ga0501081_0032650
378 Ga0501035_0372935
379 Ga0501035_1328666
380 Ga0501044_0101656
381 Ga0501045_0228830
382 nmdc:mga03683_216074_c1
383 nmdc:mga03n38_1178_c1
384 nmdc:mga00v17_427043_c1
385 nmdc:mga06z11_170043_c1
386 nmdc:mga07m45_1587_c1
387 nmdc:mga05p37_1235422_c1
388 nmdc:mga05p37_3814_c1
389 nmdc:mga09592_1331_c1
390 nmdc:mga09592_173304_c1
391 nmdc:mga0qj67_326907_c1
392 nmdc:mga06r32_435212_c1
393 nmdc:mga06r32_846209_c1
394 nmdc:mga08y16_695275_c1
395 nmdc:mga0a205_16406_c1
396 Ga0495601_0504866
397 Ga0495619_0194874
398 Ga0495619_0919438
399 Ga0500651_0720828
400 Ga0500650_0097363
401 Ga0500658_0214550
402 Ga0500568_0069685
403 Ga0500603_105566
404 Ga0500636_0135314
405 Ga0590075_028153
406 Ga0501082_0196193
407 Ga0501082_1379172
408 2586058229
409 2809592914
410 2915768179

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

42

176

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pu2-assembly2.cif.gz_B crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9445 8 162
3pu2-assembly1.cif.gz_A crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.941 8 162
3pu2-assembly8.cif.gz_H crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9385 8 166
3pu2-assembly4.cif.gz_D crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.937 8 162
3pu2-assembly7.cif.gz_G crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9344 10 166
ID Description Score Start End Superfamily
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8678 8 165 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8621 8 165 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8528 10 162 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8511 10 162 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8491 18 162 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A348PDH4-F1-model_v4 ATPase 0.9649 1 162
AF-A0A554FUH4-F1-model_v4 ATPase 0.9622 1 163
AF-A0A2T7UR62-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9536 9 166
AF-A0A7S6MG92-F1-model_v4 SRPBCC family protein 0.9535 8 165
AF-A0A0Q3BP60-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9475 5 162

Map