F314103

General Info

Members Datasets Scaffolds Average Seq Length
205 138 411 156

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0135422|Ga0316584_0135422_789_1355
Length 188
Sequence VETAERDPRREHVRRDRFSEPSILDNSDVGTHISYSVKLSNKGRYGVRAIFDIAFHSGGKPTQIKDISRRQAIPPRFLEQIFQDLKRAGLVTSKRGPRGGYALAMDPDDVRLGDIVRALEGPIVLGSGDRNGNAEGDETSRVVTENAFSELSDSIEACFDAITIQDLCDRGDAHGVRRAPPRRYVYSI

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
92 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
93 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
94 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
95 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
96 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
97 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
98 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
99 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
100 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
101 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
102 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
113 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
114 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
115 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
122 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
123 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.39
Nodule 0
Rhizoplane 5.37
Rhizosphere 77.07
Stem 0
Stem Tuber 0
Unclassified 16.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0135422 3300036712 Bacteria 1839
2 rootH1_10052978 3300003316 Unclassified 1295
3 rootH2_10151076 3300003320 Bacteria 1592
4 rootL2_10203368 3300003322 Bacteria 1099
5 rootH1_10055867 3300003323 Bacteria 2375
6 rootH1_10081082 3300003323 Bacteria 9368
7 rootH1_10095066 3300003316 Bacteria 2261
8 rootH1_10095066 3300003323 Unclassified 1882
9 rootH1_10095067 3300003323 Bacteria 2839
10 Ga0070683_100220671 3300005329 Bacteria 1802
11 Ga0070682_100012027 3300005337 Bacteria 4952
12 Ga0070682_100013107 3300005337 Bacteria 4761
13 Ga0070668_100138532 3300005347 Bacteria 1959
14 Ga0070675_100130510 3300005354 Bacteria 2141
15 Ga0070674_101335422 3300005356 Bacteria 640
16 Ga0070688_100608922 3300005365 Bacteria 837
17 Ga0070709_10050422 3300005434 Unclassified 2608
18 Ga0070701_10183660 3300005438 Bacteria 1226
19 Ga0070701_10229979 3300005438 Bacteria 1110
20 Ga0070705_100118631 3300005440 Unclassified 1704
21 Ga0070700_100233604 3300005441 Bacteria 1310
22 Ga0070700_100651765 3300005441 Bacteria 831
23 Ga0070678_100126372 3300005456 Bacteria 2025
24 Ga0070678_100656940 3300005456 Bacteria 941
25 Ga0068867_100066505 3300005459 Bacteria 2685
26 Ga0070685_10148597 3300005466 Bacteria 1483
27 Ga0070685_10184548 3300005466 Bacteria 1345
28 Ga0070706_100101505 3300005467 Bacteria 2674
29 Ga0070707_100194801 3300005468 Bacteria 1976
30 Ga0068853_100277633 3300005539 Bacteria 1544
31 Ga0070672_100000389 3300005543 Bacteria 25459
32 Ga0070695_100239163 3300005545 Unclassified 1316
33 Ga0070693_100802360 3300005547 Unclassified 698
34 Ga0070665_100254992 3300005548 Unclassified 1755
35 Ga0068855_100000013 3300005563 Bacteria 234207
36 Ga0068855_100002254 3300005563 Bacteria 23824
37 Ga0068856_100008014 3300005614 Bacteria 10313
38 Ga0070702_100097443 3300005615 Bacteria 1797
39 Ga0068859_100161075 3300005617 Bacteria 2323
40 Ga0068861_100010182 3300005719 Bacteria 6524
41 Ga0068870_10424851 3300005840 Bacteria 870
42 Ga0068863_100826527 3300005841 Unclassified 925
43 Ga0081455_10031211 3300005937 Bacteria 4825
44 Ga0081455_10081307 3300005937 Bacteria 2653
45 Ga0070716_100039068 3300006173 Unclassified 2631
46 Ga0075366_10027437 3300006195 Bacteria 3341
47 Ga0075366_10172192 3300006195 Bacteria 1314
48 Ga0075366_10398630 3300006195 Bacteria 847
49 Ga0097621_100525064 3300006237 Bacteria 1075
50 Ga0097621_100902260 3300006237 Bacteria 823
51 Ga0075430_100262606 3300006846 Bacteria 1430
52 Ga0075430_100387265 3300006846 Bacteria 1154
53 Ga0075431_100572036 3300006847 Bacteria 1116
54 Ga0075431_101543149 3300006847 Bacteria 622
55 Ga0075429_100015449 3300006880 Bacteria 6616
56 Ga0075429_100296331 3300006880 Bacteria 1416
57 Ga0075429_100468333 3300006880 Bacteria 1104
58 Ga0075429_100625714 3300006880 Bacteria 943
59 Ga0075436_100008754 3300006914 Bacteria 6922
60 Ga0097620_100161082 3300006931 Bacteria 2323
61 Ga0111539_10006392 3300009094 Bacteria 15198
62 Ga0111539_10238554 3300009094 Bacteria 2116
63 Ga0111539_10712715 3300009094 Bacteria 1168
64 Ga0111539_12690124 3300009094 Unclassified 577
65 Ga0105245_10011584 3300009098 Bacteria 7682
66 Ga0105245_10097224 3300009098 Bacteria 2719
67 Ga0114129_10710593 3300009147 Bacteria 1291
68 Ga0105237_10662310 3300009545 Bacteria 1051
69 Ga0105249_10159485 3300009553 Unclassified 2178
70 Ga0163163_10043212 3300014325 Bacteria 4418
71 Ga0163163_12043963 3300014325 Bacteria 633
72 Ga0157380_10137802 3300014326 Bacteria 2091
73 Ga0157380_10289933 3300014326 Bacteria 1502
74 Ga0157376_10060995 3300014969 Unclassified 3169
75 Ga0157376_10801226 3300014969 Bacteria 955
76 Ga0207643_10151736 3300025908 Bacteria 1389
77 Ga0207687_10006415 3300025927 Bacteria 7770
78 Ga0207687_10065115 3300025927 Bacteria 2587
79 Ga0207704_11191613 3300025938 Bacteria 649
80 Ga0207691_10002384 3300025940 Bacteria 18380
81 Ga0207661_10946708 3300025944 Bacteria 793
82 Ga0207667_10000227 3300025949 Bacteria 79027
83 Ga0207668_10124279 3300025972 Bacteria 1959
84 Ga0207677_10138230 3300026023 Bacteria 1861
85 Ga0207708_10160596 3300026075 Bacteria 1774
86 Ga0207702_10021071 3300026078 Bacteria 5394
87 Ga0207702_11869556 3300026078 Bacteria 592
88 Ga0207648_10237300 3300026089 Bacteria 1623
89 Ga0207675_100018989 3300026118 Bacteria 6418
90 Ga0207698_11993723 3300026142 Bacteria 595
91 Ga0207428_10393704 3300027907 Bacteria 1015
92 Ga0265318_10053323 3300028577 Bacteria 1517
93 Ga0307515_10107296 3300028794 Bacteria 3303
94 Ga0265332_10015461 3300031238 Bacteria 3369
95 Ga0265339_10000083 3300031249 Bacteria 81771
96 Ga0265327_10060761 3300031251 Bacteria 1931
97 Ga0265316_10000493 3300031344 Bacteria 44621
98 Ga0307513_10051504 3300031456 Bacteria 4441
99 Ga0307513_10258367 3300031456 Bacteria 1533
100 Ga0307509_10360045 3300031507 Bacteria 1175
101 Ga0307408_100929577 3300031548 Bacteria 798
102 Ga0307508_10005822 3300031616 Bacteria 11644
103 Ga0307508_10045388 3300031616 Bacteria 3927
104 Ga0307508_10157271 3300031616 Bacteria 1877
105 Ga0265314_10000001 3300031711 Bacteria 3792860
106 Ga0265314_10041599 3300031711 Bacteria 3287
107 Ga0316576_10210142 3300031727 Unclassified 1465
108 Ga0316578_10036596 3300031728 Unclassified 2825
109 Ga0307516_10009663 3300031730 Bacteria 10722
110 Ga0307406_11699157 3300031901 Bacteria 559
111 Ga0307407_11190449 3300031903 Bacteria 595
112 Ga0307409_100157224 3300031995 Bacteria 1983
113 Ga0307409_100172681 3300031995 Bacteria 1904
114 Ga0307416_100573409 3300032002 Bacteria 1205
115 Ga0307411_10012549 3300032005 Bacteria 4631
116 Ga0307415_100098888 3300032126 Bacteria 2134
117 Ga0307415_101744185 3300032126 Unclassified 601
118 Ga0373959_0060723 3300034820 Bacteria 836
119 Ga0373956_0164715 3300035119 Bacteria 1045
120 Ga0373946_0513194 3300035171 Unclassified 616
121 Ga0316574_0107690 3300035398 Bacteria 1786
122 Ga0316574_0168541 3300035398 Bacteria 1410
123 Ga0316574_0530560 3300035398 Bacteria 732
124 Ga0373933_0071859 3300035724 Bacteria 2107
125 Ga0373937_0025362 3300036401 Bacteria 5352
126 Ga0373937_0781012 3300036401 Bacteria 903
127 Ga0373937_1262321 3300036401 Bacteria 687
128 Ga0316582_0250392 3300036647 Bacteria 1214
129 Ga0400489_48118 3300039093 Unclassified 1458
130 Ga0451791_0311468 3300041451 Bacteria 1057
131 Ga0451791_0826197 3300041451 Bacteria 955
132 Ga0451791_1216623 3300041451 Unclassified 525
133 Ga0451791_1335009 3300041451 Bacteria 1692
134 Ga0451797_0774417 3300041453 Bacteria 1489
135 Ga0451800_1265336 3300041459 Unclassified 629
136 Ga0451802_1343154 3300041460 Bacteria 765
137 Ga0451807_0137115 3300041486 Unclassified 862
138 Ga0451807_0157155 3300041486 Bacteria 3825
139 Ga0451807_0412768 3300041486 Bacteria 4010
140 Ga0451807_1262238 3300041486 Bacteria 1053
141 Ga0451835_0024002 3300041492 Unclassified 1052
142 Ga0451841_0420199 3300041498 Bacteria 948
143 Ga0451845_0562145 3300041501 Bacteria 1319
144 Ga0451849_0150330 3300041505 Bacteria 2950
145 Ga0451849_0404308 3300041505 Bacteria 962
146 Ga0451851_0627960 3300041507 Unclassified 922
147 Ga0451851_0835885 3300041507 Bacteria 2714
148 Ga0451855_0330433 3300041511 Bacteria 727
149 Ga0451853_0346293 3300041512 Bacteria 28573
150 Ga0451853_0667926 3300041512 Bacteria 653
151 Ga0451853_1503860 3300041512 Unclassified 1524
152 Ga0439445_0144437 3300042004 Bacteria 691
153 Ga0451577_0072656 3300042876 Bacteria 3069
154 Ga0451577_0081562 3300042876 Bacteria 2885
155 Ga0451577_0191908 3300042876 Bacteria 1843
156 Ga0453683_0396150 3300044673 Unclassified 890
157 Ga0453683_0498468 3300044673 Bacteria 790
158 Ga0453684_0014285 3300044712 Bacteria 12731
159 Ga0453684_0039113 3300044712 Bacteria 6470
160 Ga0453684_0718659 3300044712 Bacteria 1084
161 Ga0466968_0131618 3300044735 Bacteria 1139
162 Ga0466957_0880775 3300044842 Unclassified 639
163 Ga0466960_0084505 3300044901 Bacteria 1606
164 Ga0466960_0116783 3300044901 Bacteria 1393
165 Ga0451576_0000453 3300045051 Bacteria 93077
166 Ga0451576_0002972 3300045051 Bacteria 24016
167 Ga0451576_0284994 3300045051 Bacteria 1727
168 Ga0451576_0375095 3300045051 Bacteria 1491
169 Ga0451576_1613792 3300045051 Bacteria 673
170 Ga0451576_2567591 3300045051 Unclassified 520
171 Ga0495617_066930 3300046452 Bacteria 1183
172 Ga0495647_0339936 3300046681 Unclassified 682
173 Ga0495589_0076142 3300046794 Bacteria 1636
174 Ga0501290_035505 3300049513 Unclassified 730
175 Ga0501047_0135454 3300049581 Bacteria 2343
176 Ga0501071_0107392 3300049587 Bacteria 2061
177 Ga0501073_0054981 3300049589 Bacteria 2786
178 Ga0501074_0128083 3300049590 Bacteria 1816
179 Ga0501075_0030337 3300049591 Bacteria 4005
180 Ga0501235_146555 3300049669 Bacteria 608
181 Ga0501242_042620 3300049674 Unclassified 646
182 Ga0501249_043142 3300049679 Unclassified 1026
183 Ga0501080_0350527 3300049742 Bacteria 1333
184 Ga0501080_0505876 3300049742 Bacteria 1079
185 Ga0501080_0688821 3300049742 Unclassified 902
186 Ga0501083_0000288 3300049744 Bacteria 31900
187 Ga0501263_043770 3300049760 Bacteria 664
188 Ga0501035_0478021 3300049822 Bacteria 1028
189 nmdc:mga0k408_160065_c1 3300050493 Bacteria 1341
190 nmdc:mga0k408_174420_c1 3300050493 Bacteria 1282
191 nmdc:mga0k408_390118_c1 3300050493 Bacteria 829
192 nmdc:mga09592_275835_c1 3300050508 Unclassified 1458
193 nmdc:mga09592_452166_c1 3300050508 Bacteria 1108
194 nmdc:mga09592_59797_c1 3300050508 Bacteria 3221
195 nmdc:mga0qj67_114886_c1 3300050509 Bacteria 2174
196 nmdc:mga06r32_422594_c1 3300050510 Bacteria 1314
197 nmdc:mga08y16_191995_c1 3300050511 Bacteria 2118
198 nmdc:mga08y16_598888_c1 3300050511 Bacteria 1111
199 nmdc:mga08y16_95630_c1 3300050511 Bacteria 3094
200 nmdc:mga08x19_27706_c1 3300050514 Unclassified 3545
201 Ga0500644_0010454 3300053088 Bacteria 2513
202 Ga0500555_122328 3300053103 Unclassified 649
203 Ga0500616_0213563 3300053153 Bacteria 846
204 Ga0501084_0007318 3300054114 Bacteria 9092
205 Ga0501084_0061103 3300054114 Bacteria 3155
206 Ga0501082_0034917 3300060353 Bacteria 4334
207 Ga0316584_0135422
208 rootH1_10052978
209 rootH2_10151076
210 rootL2_10203368
211 rootH1_10055867
212 rootH1_10081082
213 rootH1_10095066
214 rootH1_10095067
215 Ga0070683_100220671
216 Ga0070682_100012027
217 Ga0070682_100013107
218 Ga0070668_100138532
219 Ga0070675_100130510
220 Ga0070674_101335422
221 Ga0070688_100608922
222 Ga0070709_10050422
223 Ga0070701_10183660
224 Ga0070701_10229979
225 Ga0070705_100118631
226 Ga0070700_100233604
227 Ga0070700_100651765
228 Ga0070678_100126372
229 Ga0070678_100656940
230 Ga0068867_100066505
231 Ga0070685_10148597
232 Ga0070685_10184548
233 Ga0070706_100101505
234 Ga0070707_100194801
235 Ga0068853_100277633
236 Ga0070672_100000389
237 Ga0070695_100239163
238 Ga0070693_100802360
239 Ga0070665_100254992
240 Ga0068855_100000013
241 Ga0068855_100002254
242 Ga0068856_100008014
243 Ga0070702_100097443
244 Ga0068859_100161075
245 Ga0068861_100010182
246 Ga0068870_10424851
247 Ga0068863_100826527
248 Ga0081455_10031211
249 Ga0081455_10081307
250 Ga0070716_100039068
251 Ga0075366_10027437
252 Ga0075366_10172192
253 Ga0075366_10398630
254 Ga0097621_100525064
255 Ga0097621_100902260
256 Ga0075430_100262606
257 Ga0075430_100387265
258 Ga0075431_100572036
259 Ga0075431_101543149
260 Ga0075429_100015449
261 Ga0075429_100296331
262 Ga0075429_100468333
263 Ga0075429_100625714
264 Ga0075436_100008754
265 Ga0097620_100161082
266 Ga0111539_10006392
267 Ga0111539_10238554
268 Ga0111539_10712715
269 Ga0111539_12690124
270 Ga0105245_10011584
271 Ga0105245_10097224
272 Ga0114129_10710593
273 Ga0105237_10662310
274 Ga0105249_10159485
275 Ga0163163_10043212
276 Ga0163163_12043963
277 Ga0157380_10137802
278 Ga0157380_10289933
279 Ga0157376_10060995
280 Ga0157376_10801226
281 Ga0207643_10151736
282 Ga0207687_10006415
283 Ga0207687_10065115
284 Ga0207704_11191613
285 Ga0207691_10002384
286 Ga0207661_10946708
287 Ga0207667_10000227
288 Ga0207668_10124279
289 Ga0207677_10138230
290 Ga0207708_10160596
291 Ga0207702_10021071
292 Ga0207702_11869556
293 Ga0207648_10237300
294 Ga0207675_100018989
295 Ga0207698_11993723
296 Ga0207428_10393704
297 Ga0265318_10053323
298 Ga0307515_10107296
299 Ga0265332_10015461
300 Ga0265339_10000083
301 Ga0265327_10060761
302 Ga0265316_10000493
303 Ga0307513_10051504
304 Ga0307513_10258367
305 Ga0307509_10360045
306 Ga0307408_100929577
307 Ga0307508_10005822
308 Ga0307508_10045388
309 Ga0307508_10157271
310 Ga0265314_10000001
311 Ga0265314_10041599
312 Ga0316576_10210142
313 Ga0316578_10036596
314 Ga0307516_10009663
315 Ga0307406_11699157
316 Ga0307407_11190449
317 Ga0307409_100157224
318 Ga0307409_100172681
319 Ga0307416_100573409
320 Ga0307411_10012549
321 Ga0307415_100098888
322 Ga0307415_101744185
323 Ga0373959_0060723
324 Ga0373956_0164715
325 Ga0373946_0513194
326 Ga0316574_0107690
327 Ga0316574_0168541
328 Ga0316574_0530560
329 Ga0373933_0071859
330 Ga0373937_0025362
331 Ga0373937_0781012
332 Ga0373937_1262321
333 Ga0316582_0250392
334 Ga0400489_48118
335 Ga0451791_0311468
336 Ga0451791_0826197
337 Ga0451791_1216623
338 Ga0451791_1335009
339 Ga0451797_0774417
340 Ga0451800_1265336
341 Ga0451802_1343154
342 Ga0451807_0137115
343 Ga0451807_0157155
344 Ga0451807_0412768
345 Ga0451807_1262238
346 Ga0451835_0024002
347 Ga0451841_0420199
348 Ga0451845_0562145
349 Ga0451849_0150330
350 Ga0451849_0404308
351 Ga0451851_0627960
352 Ga0451851_0835885
353 Ga0451855_0330433
354 Ga0451853_0346293
355 Ga0451853_0667926
356 Ga0451853_1503860
357 Ga0439445_0144437
358 Ga0451577_0072656
359 Ga0451577_0081562
360 Ga0451577_0191908
361 Ga0453683_0396150
362 Ga0453683_0498468
363 Ga0453684_0014285
364 Ga0453684_0039113
365 Ga0453684_0718659
366 Ga0466968_0131618
367 Ga0466957_0880775
368 Ga0466960_0084505
369 Ga0466960_0116783
370 Ga0451576_0000453
371 Ga0451576_0002972
372 Ga0451576_0284994
373 Ga0451576_0375095
374 Ga0451576_1613792
375 Ga0451576_2567591
376 Ga0495617_066930
377 Ga0495647_0339936
378 Ga0495589_0076142
379 Ga0501290_035505
380 Ga0501047_0135454
381 Ga0501071_0107392
382 Ga0501073_0054981
383 Ga0501074_0128083
384 Ga0501075_0030337
385 Ga0501235_146555
386 Ga0501242_042620
387 Ga0501249_043142
388 Ga0501080_0350527
389 Ga0501080_0505876
390 Ga0501080_0688821
391 Ga0501083_0000288
392 Ga0501263_043770
393 Ga0501035_0478021
394 nmdc:mga0k408_160065_c1
395 nmdc:mga0k408_174420_c1
396 nmdc:mga0k408_390118_c1
397 nmdc:mga09592_275835_c1
398 nmdc:mga09592_452166_c1
399 nmdc:mga09592_59797_c1
400 nmdc:mga0qj67_114886_c1
401 nmdc:mga06r32_422594_c1
402 nmdc:mga08y16_191995_c1
403 nmdc:mga08y16_598888_c1
404 nmdc:mga08y16_95630_c1
405 nmdc:mga08x19_27706_c1
406 Ga0500644_0010454
407 Ga0500555_122328
408 Ga0500616_0213563
409 Ga0501084_0007318
410 Ga0501084_0061103
411 Ga0501082_0034917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

39

170

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9147 9 67
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9129 26 67
4hf2-assembly1.cif.gz_A crystal structure of e43a iscr mutant bound to its promoter 0.9054 1 134
5zup-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9022 26 67
4hf1-assembly1.cif.gz_A crystal structure of iscr bound to its promoter 0.8938 1 135
ID Description Score Start End Superfamily
af_Q57693_7_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9349 11 69 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9147 9 67 1.10.10.10
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9129 26 67 1.10.10.10
4hf2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9054 1 134 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8937 4 69 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C4V503-F1-model_v4 Rrf2 family transcriptional regulator 0.9219 1 134 GO:0003700
GO:0005829
AF-A0A7C4CAV4-F1-model_v4 Rrf2 family transcriptional regulator 0.9206 1 137 GO:0003700
GO:0005829
AF-A0A2F0ARW9-F1-model_v4 Rrf2 family transcriptional regulator 0.9143 1 153 GO:0003700
GO:0005829
AF-A0A2F0ARW9-F1-model_v4 Rrf2 family transcriptional regulator 0.9086 1 153 GO:0003700
GO:0005829
AF-A0A3D1EZY6-F1-model_v4 Rrf2 family transcriptional regulator 0.9081 1 133 GO:0003700
GO:0005829

Map