F314044

General Info

Members Datasets Scaffolds Average Seq Length
205 152 410 206

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10273463|Ga0307405_102734631
Length 222
Sequence MTAYQPSMFDLMSGPAATVTSLPGRLVRHTLTAGAWVDVLPGFVQGSDAVFETLLHEVDWRAERRQMYDGVVDVPRLLRWYGGDETLPHPALAEAKARLNAHYAEELGEEFVSAGMCLYRDGRDSVAWHGDTTGRSRTEDTMVAIVSFGSPRTLMLRPRVSGSPRRPEDQAPARDTLRFPLGHGDLIVMGGSCQRTWEHAIPKTARPVGPRVSVQFRPINVA

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
9 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
10 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
11 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
21 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
22 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
23 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
24 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
42 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
43 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
46 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
47 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
48 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
53 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
54 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
55 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
56 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
57 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
58 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
64 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
65 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
66 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
79 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
89 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
90 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
91 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
131 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
132 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
133 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
134 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
135 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
139 2643221615 Nocardioides sp. Root224 Isolate Unclassified
140 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
141 2643221692 Nocardia sp. Root136 Isolate Unclassified
142 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
143 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
144 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
145 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
146 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
147 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
148 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
149 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
150 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
151 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
152 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.17
Metatranscriptomes 0
Isolates 6.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.98
Bulb 0
Endosphere 3.41
Nodule 0
Rhizoplane 6.83
Rhizosphere 75.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10273463 3300031731 Bacteria 1268
2 Ga0070683_100165275 3300005329 Bacteria 2099
3 Ga0070683_100314242 3300005329 Bacteria 1491
4 Ga0070683_100794450 3300005329 Bacteria 907
5 Ga0070668_100028221 3300005347 Bacteria 4261
6 Ga0070659_100730020 3300005366 Bacteria 858
7 Ga0070667_100163462 3300005367 Bacteria 1962
8 Ga0070665_100920444 3300005548 Bacteria 887
9 Ga0068856_100882585 3300005614 Bacteria 913
10 Ga0070702_100051951 3300005615 Bacteria 2349
11 Ga0068861_100262973 3300005719 Bacteria 1478
12 Ga0068863_101283722 3300005841 Bacteria 739
13 Ga0068858_100203046 3300005842 Bacteria 1875
14 Ga0081539_10001138 3300005985 Bacteria 48256
15 Ga0081539_10004134 3300005985 Bacteria 16517
16 Ga0081539_10008910 3300005985 Bacteria 8561
17 Ga0081539_10024671 3300005985 Bacteria 3894
18 Ga0081539_10055958 3300005985 Bacteria 2192
19 Ga0070717_10386417 3300006028 Bacteria 1256
20 Ga0075367_10135048 3300006178 Bacteria 1526
21 Ga0075428_100189292 3300006844 Bacteria 2226
22 Ga0111539_10496917 3300009094 Bacteria 1421
23 Ga0105243_10227331 3300009148 Bacteria 1653
24 Ga0105242_11226003 3300009176 Bacteria 771
25 Ga0105242_11251271 3300009176 Bacteria 764
26 Ga0105248_10339561 3300009177 Bacteria 1691
27 Ga0157375_10064375 3300013308 Bacteria 3650
28 Ga0163163_10213156 3300014325 Bacteria 1980
29 Ga0163163_10531921 3300014325 Bacteria 1238
30 Ga0157380_10128091 3300014326 Bacteria 2161
31 Ga0157380_10650327 3300014326 Bacteria 1051
32 Ga0163161_10487349 3300017792 Bacteria 1002
33 Ga0207643_10141323 3300025908 Bacteria 1438
34 Ga0207652_10306321 3300025921 Bacteria 1434
35 Ga0207650_10538449 3300025925 Bacteria 978
36 Ga0207687_10313054 3300025927 Bacteria 1268
37 Ga0207711_10200494 3300025941 Bacteria 1821
38 Ga0207661_10163835 3300025944 Bacteria 1931
39 Ga0207661_10213952 3300025944 Bacteria 1700
40 Ga0207668_10001283 3300025972 Bacteria 14967
41 Ga0207668_10371573 3300025972 Bacteria 1201
42 Ga0207658_10048968 3300025986 Bacteria 3102
43 Ga0207703_10169850 3300026035 Bacteria 1917
44 Ga0207678_10030914 3300026067 Bacteria 4675
45 Ga0207702_11025078 3300026078 Bacteria 819
46 Ga0207641_11211328 3300026088 Bacteria 755
47 Ga0207676_10298184 3300026095 Bacteria 1471
48 Ga0207675_100306859 3300026118 Bacteria 1547
49 Ga0207675_100425098 3300026118 Bacteria 1313
50 Ga0268265_10101175 3300028380 Bacteria 2328
51 Ga0268265_11353412 3300028380 Bacteria 713
52 Ga0268264_10564541 3300028381 Bacteria 1118
53 Ga0307515_10002732 3300028794 Bacteria 37745
54 Ga0307515_10006422 3300028794 Bacteria 23524
55 Ga0307515_10015243 3300028794 Bacteria 14176
56 Ga0307512_10066900 3300030522 Bacteria 2710
57 Ga0307513_10003860 3300031456 Bacteria 20162
58 Ga0307513_10023709 3300031456 Bacteria 7163
59 Ga0307509_10189859 3300031507 Bacteria 1907
60 Ga0307509_10438464 3300031507 Bacteria 1003
61 Ga0307408_100902475 3300031548 Bacteria 809
62 Ga0307508_10002502 3300031616 Bacteria 19362
63 Ga0307516_10026560 3300031730 Bacteria 5878
64 Ga0307516_10074228 3300031730 Bacteria 3257
65 Ga0307516_10290126 3300031730 Bacteria 1315
66 Ga0307405_11029288 3300031731 Bacteria 704
67 Ga0326468_10000503 3300031889 Bacteria 4124
68 Ga0307407_10011599 3300031903 Bacteria 4203
69 Ga0307407_10557240 3300031903 Bacteria 848
70 Ga0307409_100039006 3300031995 Bacteria 3520
71 Ga0307409_100091324 3300031995 Bacteria 2495
72 Ga0307416_100046781 3300032002 Bacteria 3418
73 Ga0307416_100535318 3300032002 Bacteria 1242
74 Ga0307415_100022917 3300032126 Bacteria 3865
75 Ga0307415_100051520 3300032126 Bacteria 2794
76 Ga0307415_100052821 3300032126 Bacteria 2766
77 Ga0307415_100273797 3300032126 Bacteria 1384
78 Ga0307415_100382683 3300032126 Bacteria 1195
79 Ga0307415_100416386 3300032126 Bacteria 1152
80 Ga0307415_101113506 3300032126 Bacteria 740
81 Ga0307507_10026430 3300033179 Bacteria 6258
82 Ga0373938_0037845 3300034957 Bacteria 1061
83 Ga0373951_0000305 3300035091 Bacteria 15567
84 Ga0373939_0053887 3300035114 Bacteria 1258
85 Ga0373942_0000524 3300035207 Bacteria 10740
86 Ga0373962_0001452 3300035242 Bacteria 5608
87 Ga0373935_0006606 3300035692 Bacteria 6929
88 Ga0395900_0281357 3300037418 Bacteria 1655
89 Ga0395900_0360894 3300037418 Bacteria 1424
90 Ga0395898_0008812 3300037466 Bacteria 10631
91 Ga0395905_0013693 3300037471 Bacteria 7769
92 Ga0395901_0022985 3300038443 Bacteria 6391
93 Ga0395901_0035892 3300038443 Bacteria 5123
94 Ga0451791_0211785 3300041451 Bacteria 1468
95 Ga0451795_0650979 3300041456 Bacteria 724
96 Ga0451837_0605025 3300041494 Bacteria 901
97 Ga0451837_1088485 3300041494 Bacteria 1536
98 Ga0451853_2860712 3300041512 Bacteria 2870
99 Ga0466972_0044002 3300044658 Bacteria 2167
100 Ga0466965_0011549 3300044683 Bacteria 4143
101 Ga0466963_0363560 3300044694 Bacteria 1019
102 Ga0466970_0007634 3300044765 Bacteria 5421
103 Ga0466960_0000697 3300044901 Bacteria 11723
104 Ga0466960_0016311 3300044901 Bacteria 3219
105 Ga0466960_0086341 3300044901 Bacteria 1591
106 Ga0466960_0240253 3300044901 Bacteria 1003
107 Ga0466967_0124689 3300045976 Bacteria 2385
108 Ga0495592_0122598 3300046454 Bacteria 1826
109 Ga0495629_0278107 3300046459 Bacteria 1149
110 Ga0495662_0002228 3300046476 Bacteria 9787
111 Ga0495664_0018552 3300046477 Bacteria 3988
112 Ga0495628_0004329 3300046516 Bacteria 12595
113 Ga0495630_0046899 3300046517 Bacteria 3230
114 Ga0495632_0044402 3300046519 Bacteria 2218
115 Ga0495666_0002331 3300046526 Bacteria 9469
116 Ga0495652_0130984 3300046529 Bacteria 1985
117 Ga0495640_0002609 3300046533 Bacteria 14490
118 Ga0495586_0017859 3300046535 Bacteria 3773
119 Ga0495587_0008117 3300046536 Bacteria 6766
120 Ga0495645_0044899 3300046543 Bacteria 3222
121 Ga0495634_0088315 3300046642 Bacteria 2016
122 Ga0495635_0147329 3300046663 Bacteria 1602
123 Ga0495599_0036037 3300046678 Bacteria 3105
124 Ga0495646_0243909 3300046680 Bacteria 964
125 Ga0495600_0176714 3300046809 Bacteria 1376
126 Ga0495581_0002697 3300047315 Bacteria 10107
127 Ga0495604_0001669 3300047317 Bacteria 18259
128 Ga0495674_0048488 3300047319 Bacteria 3758
129 Ga0495675_0224761 3300047444 Bacteria 1134
130 Ga0495684_0525499 3300047471 Bacteria 809
131 Ga0495593_0007659 3300047673 Bacteria 6299
132 Ga0496104_0020367 3300048907 Bacteria 6080
133 Ga0496105_0062398 3300048908 Bacteria 3075
134 Ga0496107_0006790 3300048910 Bacteria 7880
135 Ga0496108_0000220 3300048911 Bacteria 51907
136 Ga0496108_0107634 3300048911 Bacteria 2381
137 Ga0496108_0207222 3300048911 Bacteria 1701
138 Ga0496109_0035925 3300048912 Bacteria 4473
139 Ga0496110_0035603 3300048913 Bacteria 4320
140 Ga0496110_0109621 3300048913 Bacteria 2480
141 Ga0496114_0007251 3300048917 Bacteria 8757
142 Ga0496114_0192000 3300048917 Bacteria 1787
143 Ga0496114_0796811 3300048917 Bacteria 823
144 Ga0501031_0004651 3300049568 Bacteria 8914
145 Ga0501031_0029621 3300049568 Bacteria 3571
146 Ga0501033_0016255 3300049570 Bacteria 5636
147 Ga0501034_1093957 3300049571 Bacteria 678
148 Ga0501036_0010634 3300049572 Bacteria 7603
149 Ga0501036_0340599 3300049572 Bacteria 1252
150 Ga0501037_0050765 3300049573 Bacteria 3035
151 Ga0501038_0019468 3300049574 Bacteria 6117
152 Ga0501038_0443431 3300049574 Bacteria 999
153 Ga0501039_0267324 3300049575 Bacteria 1344
154 Ga0501040_0008362 3300049576 Bacteria 6728
155 Ga0501041_0011255 3300049577 Bacteria 5287
156 Ga0501042_0036530 3300049578 Bacteria 3485
157 Ga0501043_0088937 3300049579 Bacteria 2427
158 Ga0501043_0226837 3300049579 Bacteria 1444
159 Ga0501043_0317738 3300049579 Bacteria 1188
160 Ga0501046_0000919 3300049580 Bacteria 28877
161 Ga0501048_0014498 3300049582 Bacteria 5835
162 Ga0501048_0104359 3300049582 Bacteria 2000
163 Ga0501067_0079046 3300049583 Bacteria 1823
164 Ga0501070_0327947 3300049586 Bacteria 1244
165 Ga0501071_0029614 3300049587 Bacteria 3866
166 Ga0501071_0034933 3300049587 Bacteria 3579
167 Ga0501073_0045287 3300049589 Bacteria 3098
168 Ga0501074_0602404 3300049590 Bacteria 777
169 Ga0501075_0176999 3300049591 Bacteria 1628
170 Ga0501075_0257290 3300049591 Bacteria 1330
171 Ga0501076_0028937 3300049592 Bacteria 4306
172 Ga0501076_0776653 3300049592 Bacteria 790
173 Ga0501077_0459361 3300049593 Bacteria 815
174 Ga0501079_0040793 3300049741 Bacteria 3582
175 Ga0501079_0250179 3300049741 Bacteria 1385
176 Ga0501081_0096497 3300049743 Bacteria 2085
177 Ga0501081_0753102 3300049743 Bacteria 732
178 Ga0501035_0035807 3300049822 Bacteria 4503
179 Ga0501035_0220424 3300049822 Bacteria 1620
180 Ga0501045_0076797 3300049824 Bacteria 2461
181 nmdc:mga05p37_687097_c1 3300050507 Bacteria 1139
182 Ga0495619_0017922 3300053085 Bacteria 4489
183 Ga0500562_052081 3300053108 Bacteria 1096
184 Ga0500569_005590 3300053109 Bacteria 2709
185 Ga0500594_0006537 3300053118 Bacteria 2623
186 Ga0500594_0105749 3300053118 Bacteria 871
187 Ga0500579_143240 3300053143 Bacteria 1071
188 Ga0500600_0020696 3300053149 Bacteria 3954
189 Ga0501084_0043909 3300054114 Bacteria 3740
190 Ga0501082_0021608 3300060353 Bacteria 5549
191 Ga0530510_0044399 3300061734 Bacteria 3212
192 2644091021 2643221615 Bacteria 5487866
193 2644320824 2643221657 Bacteria 5490246
194 2644512487 2643221692 Bacteria 7282860
195 2753270232 2751185782 Bacteria 11227053
196 2784472518 2784132109 Bacteria 3141763
197 2855390843 2855386786 Bacteria 4752232
198 2856861739 2856858025 Bacteria 7255264
199 2867318440 2867312974 Bacteria 7058875
200 2867320424 2867319477 Bacteria 7069771
201 2891969057 2891968417 Bacteria 5821697
202 2984579459 2984576629 Bacteria 4248407
203 2990257068 2990256926 Bacteria 4252839
204 3001891739 3001889506 Bacteria 2975194
205 649812341 649633069 Bacteria 6962533
206 Ga0307405_10273463
207 Ga0070683_100165275
208 Ga0070683_100314242
209 Ga0070683_100794450
210 Ga0070668_100028221
211 Ga0070659_100730020
212 Ga0070667_100163462
213 Ga0070665_100920444
214 Ga0068856_100882585
215 Ga0070702_100051951
216 Ga0068861_100262973
217 Ga0068863_101283722
218 Ga0068858_100203046
219 Ga0081539_10001138
220 Ga0081539_10004134
221 Ga0081539_10008910
222 Ga0081539_10024671
223 Ga0081539_10055958
224 Ga0070717_10386417
225 Ga0075367_10135048
226 Ga0075428_100189292
227 Ga0111539_10496917
228 Ga0105243_10227331
229 Ga0105242_11226003
230 Ga0105242_11251271
231 Ga0105248_10339561
232 Ga0157375_10064375
233 Ga0163163_10213156
234 Ga0163163_10531921
235 Ga0157380_10128091
236 Ga0157380_10650327
237 Ga0163161_10487349
238 Ga0207643_10141323
239 Ga0207652_10306321
240 Ga0207650_10538449
241 Ga0207687_10313054
242 Ga0207711_10200494
243 Ga0207661_10163835
244 Ga0207661_10213952
245 Ga0207668_10001283
246 Ga0207668_10371573
247 Ga0207658_10048968
248 Ga0207703_10169850
249 Ga0207678_10030914
250 Ga0207702_11025078
251 Ga0207641_11211328
252 Ga0207676_10298184
253 Ga0207675_100306859
254 Ga0207675_100425098
255 Ga0268265_10101175
256 Ga0268265_11353412
257 Ga0268264_10564541
258 Ga0307515_10002732
259 Ga0307515_10006422
260 Ga0307515_10015243
261 Ga0307512_10066900
262 Ga0307513_10003860
263 Ga0307513_10023709
264 Ga0307509_10189859
265 Ga0307509_10438464
266 Ga0307408_100902475
267 Ga0307508_10002502
268 Ga0307516_10026560
269 Ga0307516_10074228
270 Ga0307516_10290126
271 Ga0307405_11029288
272 Ga0326468_10000503
273 Ga0307407_10011599
274 Ga0307407_10557240
275 Ga0307409_100039006
276 Ga0307409_100091324
277 Ga0307416_100046781
278 Ga0307416_100535318
279 Ga0307415_100022917
280 Ga0307415_100051520
281 Ga0307415_100052821
282 Ga0307415_100273797
283 Ga0307415_100382683
284 Ga0307415_100416386
285 Ga0307415_101113506
286 Ga0307507_10026430
287 Ga0373938_0037845
288 Ga0373951_0000305
289 Ga0373939_0053887
290 Ga0373942_0000524
291 Ga0373962_0001452
292 Ga0373935_0006606
293 Ga0395900_0281357
294 Ga0395900_0360894
295 Ga0395898_0008812
296 Ga0395905_0013693
297 Ga0395901_0022985
298 Ga0395901_0035892
299 Ga0451791_0211785
300 Ga0451795_0650979
301 Ga0451837_0605025
302 Ga0451837_1088485
303 Ga0451853_2860712
304 Ga0466972_0044002
305 Ga0466965_0011549
306 Ga0466963_0363560
307 Ga0466970_0007634
308 Ga0466960_0000697
309 Ga0466960_0016311
310 Ga0466960_0086341
311 Ga0466960_0240253
312 Ga0466967_0124689
313 Ga0495592_0122598
314 Ga0495629_0278107
315 Ga0495662_0002228
316 Ga0495664_0018552
317 Ga0495628_0004329
318 Ga0495630_0046899
319 Ga0495632_0044402
320 Ga0495666_0002331
321 Ga0495652_0130984
322 Ga0495640_0002609
323 Ga0495586_0017859
324 Ga0495587_0008117
325 Ga0495645_0044899
326 Ga0495634_0088315
327 Ga0495635_0147329
328 Ga0495599_0036037
329 Ga0495646_0243909
330 Ga0495600_0176714
331 Ga0495581_0002697
332 Ga0495604_0001669
333 Ga0495674_0048488
334 Ga0495675_0224761
335 Ga0495684_0525499
336 Ga0495593_0007659
337 Ga0496104_0020367
338 Ga0496105_0062398
339 Ga0496107_0006790
340 Ga0496108_0000220
341 Ga0496108_0107634
342 Ga0496108_0207222
343 Ga0496109_0035925
344 Ga0496110_0035603
345 Ga0496110_0109621
346 Ga0496114_0007251
347 Ga0496114_0192000
348 Ga0496114_0796811
349 Ga0501031_0004651
350 Ga0501031_0029621
351 Ga0501033_0016255
352 Ga0501034_1093957
353 Ga0501036_0010634
354 Ga0501036_0340599
355 Ga0501037_0050765
356 Ga0501038_0019468
357 Ga0501038_0443431
358 Ga0501039_0267324
359 Ga0501040_0008362
360 Ga0501041_0011255
361 Ga0501042_0036530
362 Ga0501043_0088937
363 Ga0501043_0226837
364 Ga0501043_0317738
365 Ga0501046_0000919
366 Ga0501048_0014498
367 Ga0501048_0104359
368 Ga0501067_0079046
369 Ga0501070_0327947
370 Ga0501071_0029614
371 Ga0501071_0034933
372 Ga0501073_0045287
373 Ga0501074_0602404
374 Ga0501075_0176999
375 Ga0501075_0257290
376 Ga0501076_0028937
377 Ga0501076_0776653
378 Ga0501077_0459361
379 Ga0501079_0040793
380 Ga0501079_0250179
381 Ga0501081_0096497
382 Ga0501081_0753102
383 Ga0501035_0035807
384 Ga0501035_0220424
385 Ga0501045_0076797
386 nmdc:mga05p37_687097_c1
387 Ga0495619_0017922
388 Ga0500562_052081
389 Ga0500569_005590
390 Ga0500594_0006537
391 Ga0500594_0105749
392 Ga0500579_143240
393 Ga0500600_0020696
394 Ga0501084_0043909
395 Ga0501082_0021608
396 Ga0530510_0044399
397 2644091021
398 2644320824
399 2644512487
400 2753270232
401 2784472518
402 2855390843
403 2856861739
404 2867318440
405 2867320424
406 2891969057
407 2984579459
408 2990257068
409 3001891739
410 649812341

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13532

2OG-FeII_Oxy_2

2OG-Fe(II) oxygenase superfamily

38

217

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rzl-assembly2.cif.gz_D duplex interrogation by a direct dna repair protein in the search of damage 0.8389 29 209
3rzg-assembly1.cif.gz_A duplex interrogation by a direct dna repair protein in the search of damage 0.8305 29 209
3rzm-assembly1.cif.gz_A duplex interrogation by a direct dna repair protein in the search of damage 0.8199 29 209
3s5a-assembly1.cif.gz_A abh2 cross-linked to undamaged dsdna-2 with cofactors 0.8158 29 209
3buc-assembly1.cif.gz_A x-ray structure of human abh2 bound to dsdna with mn(ii) and 2kg 0.8074 29 209
ID Description Score Start End Superfamily
af_L7N6A4_38_203_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9781 47 210 2.60.120.590
af_L7N6A4_38_203_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9608 47 210 2.60.120.590
af_Q9SIE0_90_314_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8335 29 208 2.60.120.590
af_A0A0R0I0F2_21_185_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8189 117 208 2.60.120.10
3rzlA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.7994 26 209 2.60.120.590
ID Description Score Start End GO Terms
AF-A0A1M4EIB5-F1-model_v4 Alkylated DNA repair protein AlkB 0.9828 19 213 GO:0006307
GO:0051213
AF-A0A7K0X3I8-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9799 55 213 GO:0006307
GO:0051213
AF-A0A4Z0N4T5-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9782 45 213 GO:0006307
GO:0051213
AF-A0A3L7BRP2-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9761 17 213 GO:0006307
GO:0051213
AF-A0A1U1W8Z7-F1-model_v4 deleted 0.9727 95 213

Map