F313897

General Info

Members Datasets Scaffolds Average Seq Length
205 173 410 251

Family's Representative Sequence

Representative Sequence 3300025302|Ga0207426_1000760|Ga0207426_100076019
Length 280
Sequence MTEVTEVAEVTDMPCPGPGRDADMTVLVGTSGWQYKDWREVLYPQDRPQRLWLEEYARHFATVESNAAFYRLPEEKTFADWRDRTPDGFVMAVKASRYLTHIKRLRDPQEPVGRMMSRAAALGPRLGPVLLQLPPTLKADAGLLDDCLSCFPAGTRVAVEPRHPSWWTAEVRTVLERRGAALCWADRGSRPVTPLWRTTDWGYLRFHEGRAEPWPRYGRQALTTWARRIADTWPDRADVYTYFNNDPGGAAVRDATAFARAAAAAGRTVSRAPSGRGTAR

Samples

Sample ID Description Type Environment
1 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
44 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
45 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
85 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
86 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
87 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
88 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
89 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
90 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
91 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
92 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
93 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
94 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
112 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
117 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
118 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
121 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
122 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
123 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
152 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
153 2643221714 Streptomyces sp. Root264 Isolate Unclassified
154 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
155 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
156 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
157 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
158 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
159 2867475112 Streptomyces sp. TM32 Isolate Unclassified
160 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
161 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
162 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
163 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
164 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
165 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
166 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
167 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
168 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
169 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
170 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
171 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
172 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
173 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.27
Metatranscriptomes 0
Isolates 10.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.39
Nodule 0
Rhizoplane 2.93
Rhizosphere 86.83
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207426_1000760 3300025302 Bacteria 35891
2 Ga0070683_100014811 3300005329 Bacteria 6834
3 Ga0068869_100005343 3300005334 Bacteria 8076
4 Ga0068868_100055786 3300005338 Bacteria 3118
5 Ga0070660_100031360 3300005339 Bacteria 3991
6 Ga0070692_10022437 3300005345 Bacteria 3083
7 Ga0070675_100021372 3300005354 Bacteria 5171
8 Ga0070659_100011364 3300005366 Bacteria 6584
9 Ga0070709_10076584 3300005434 Bacteria 2173
10 Ga0070700_100050275 3300005441 Bacteria 2591
11 Ga0070662_100035801 3300005457 Bacteria 3508
12 Ga0070706_100000939 3300005467 Bacteria 31876
13 Ga0070684_100162742 3300005535 Bacteria 2025
14 Ga0068855_100417020 3300005563 Bacteria 1469
15 Ga0070664_100011158 3300005564 Bacteria 7287
16 Ga0070664_100471576 3300005564 Bacteria 1154
17 Ga0068857_100075785 3300005577 Bacteria 2999
18 Ga0068854_100083714 3300005578 Bacteria 2359
19 Ga0068856_100094411 3300005614 Bacteria 2978
20 Ga0070702_100067343 3300005615 Bacteria 2103
21 Ga0068852_100196412 3300005616 Bacteria 1907
22 Ga0068864_100612118 3300005618 Bacteria 1058
23 Ga0068861_100083400 3300005719 Bacteria 2507
24 Ga0068870_10015822 3300005840 Bacteria 3589
25 Ga0068863_100010170 3300005841 Bacteria 9151
26 Ga0068860_100070209 3300005843 Bacteria 3330
27 Ga0068862_100166091 3300005844 Bacteria 1973
28 Ga0075368_10004897 3300006042 Bacteria 4568
29 Ga0070712_100062617 3300006175 Bacteria 2631
30 Ga0075367_10000785 3300006178 Bacteria 12491
31 Ga0075430_100257820 3300006846 Bacteria 1444
32 Ga0075431_100286041 3300006847 Bacteria 1669
33 Ga0075429_100494920 3300006880 Bacteria 1071
34 Ga0068865_100561002 3300006881 Bacteria 960
35 Ga0111539_10001594 3300009094 Bacteria 30233
36 Ga0111539_10004442 3300009094 Bacteria 18324
37 Ga0111539_10040939 3300009094 Bacteria 5574
38 Ga0105245_10258945 3300009098 Bacteria 1692
39 Ga0114129_10018110 3300009147 Bacteria 10033
40 Ga0105241_10524328 3300009174 Bacteria 1060
41 Ga0105239_10321865 3300010375 Bacteria 1744
42 Ga0105246_10008010 3300011119 Bacteria 6486
43 Ga0163162_10499223 3300013306 Bacteria 1347
44 Ga0163163_10197922 3300014325 Bacteria 2057
45 Ga0163163_10291581 3300014325 Bacteria 1684
46 Ga0157377_10029401 3300014745 Bacteria 2967
47 Ga0157377_10444036 3300014745 Unclassified 894
48 Ga0183367_1010 3300015688 Bacteria 416164
49 Ga0224572_1002791 3300024225 Bacteria 2873
50 Ga0209758_1006079 3300025297 Bacteria 8885
51 Ga0207426_1007242 3300025302 Bacteria 4674
52 Ga0207426_1009588 3300025302 Bacteria 3818
53 Ga0207688_10018281 3300025901 Bacteria 3815
54 Ga0207685_10043166 3300025905 Bacteria 1697
55 Ga0207643_10041700 3300025908 Bacteria 2587
56 Ga0207693_10111958 3300025915 Bacteria 2141
57 Ga0207662_10205680 3300025918 Bacteria 1276
58 Ga0207659_10061446 3300025926 Bacteria 2708
59 Ga0207690_10015784 3300025932 Bacteria 4583
60 Ga0207706_10030999 3300025933 Bacteria 4765
61 Ga0207704_10500826 3300025938 Bacteria 979
62 Ga0207689_10046268 3300025942 Bacteria 3596
63 Ga0207679_10001499 3300025945 Bacteria 14629
64 Ga0207668_10129458 3300025972 Bacteria 1925
65 Ga0207677_10051343 3300026023 Bacteria 2796
66 Ga0207708_10148698 3300026075 Bacteria 1842
67 Ga0207702_10783084 3300026078 Bacteria 942
68 Ga0207676_10298490 3300026095 Bacteria 1470
69 Ga0207674_10011268 3300026116 Bacteria 10050
70 Ga0207675_100114220 3300026118 Bacteria 2550
71 Ga0207683_10246545 3300026121 Bacteria 1630
72 Ga0207698_10170811 3300026142 Bacteria 1914
73 Ga0209969_1005545 3300027360 Bacteria 1773
74 Ga0209983_1014521 3300027665 Unclassified 1623
75 Ga0209971_1002545 3300027682 Bacteria 4370
76 Ga0209998_10007810 3300027717 Bacteria 2220
77 Ga0209998_10021118 3300027717 Bacteria 1396
78 Ga0209813_10002058 3300027866 Bacteria 4568
79 Ga0209974_10001818 3300027876 Bacteria 7779
80 Ga0207428_10045119 3300027907 Bacteria 3553
81 Ga0268265_10006862 3300028380 Bacteria 7706
82 Ga0307512_10005563 3300030522 Bacteria 13093
83 Ga0307508_10011515 3300031616 Bacteria 8081
84 Ga0307516_10269366 3300031730 Bacteria 1390
85 Ga0307405_10128508 3300031731 Bacteria 1747
86 Ga0307405_10237321 3300031731 Bacteria 1348
87 Ga0307518_10228455 3300031838 Bacteria 1207
88 Ga0307409_100056664 3300031995 Bacteria 3032
89 Ga0307416_100274787 3300032002 Bacteria 1657
90 Ga0307507_10091689 3300033179 Bacteria 2599
91 Ga0395898_0010216 3300037466 Bacteria 9828
92 Ga0395905_0086453 3300037471 Bacteria 2939
93 Ga0439439_0004355 3300041406 Bacteria 3184
94 Ga0451853_1541184 3300041512 Bacteria 1368
95 Ga0439442_003368 3300042002 Bacteria 3158
96 Ga0439449_0002929 3300042007 Bacteria 6640
97 Ga0439449_0008651 3300042007 Bacteria 3863
98 Ga0439455_0000798 3300042012 Bacteria 4771
99 Ga0439457_001369 3300042014 Bacteria 7337
100 Ga0439457_003870 3300042014 Bacteria 4010
101 Ga0439462_0006345 3300042015 Bacteria 2936
102 Ga0439462_0019441 3300042015 Bacteria 1768
103 Ga0450894_001927 3300042131 Bacteria 2868
104 Ga0450895_003752 3300042132 Bacteria 1182
105 Ga0450898_000263 3300042134 Bacteria 5818
106 Ga0450908_002333 3300042184 Bacteria 3716
107 Ga0466969_0006794 3300044656 Bacteria 6088
108 Ga0466969_0019040 3300044656 Bacteria 3571
109 Ga0466969_0041098 3300044656 Bacteria 2315
110 Ga0466972_0014501 3300044658 Bacteria 3947
111 Ga0466965_0036827 3300044683 Bacteria 2401
112 Ga0466965_0043175 3300044683 Bacteria 2225
113 Ga0466966_0000145 3300044684 Bacteria 45112
114 Ga0466966_0001252 3300044684 Bacteria 16267
115 Ga0466966_0008105 3300044684 Bacteria 6965
116 Ga0466961_0003360 3300044693 Bacteria 9987
117 Ga0466961_0040233 3300044693 Bacteria 2997
118 Ga0466963_0000329 3300044694 Bacteria 21544
119 Ga0466964_0048843 3300044706 Bacteria 1731
120 Ga0466971_0000855 3300044719 Bacteria 12411
121 Ga0466971_0013255 3300044719 Bacteria 3617
122 Ga0466970_0000952 3300044765 Bacteria 13964
123 Ga0466970_0057461 3300044765 Bacteria 2080
124 Ga0466970_0177857 3300044765 Bacteria 1180
125 Ga0466957_0274910 3300044842 Bacteria 1126
126 Ga0466959_0002606 3300045049 Bacteria 11578
127 Ga0466959_0003724 3300045049 Bacteria 10070
128 Ga0466959_0009075 3300045049 Bacteria 7057
129 Ga0466959_0027128 3300045049 Bacteria 4249
130 Ga0466958_0006735 3300045836 Bacteria 6273
131 Ga0466967_0007316 3300045976 Bacteria 7950
132 Ga0466967_0028254 3300045976 Bacteria 4680
133 Ga0495603_0181784 3300046455 Bacteria 1216
134 Ga0495629_0040211 3300046459 Bacteria 3289
135 Ga0495585_0085573 3300046492 Bacteria 1703
136 Ga0495596_0158923 3300046500 Bacteria 878
137 Ga0495607_0041315 3300046501 Bacteria 2740
138 Ga0495606_0013093 3300046507 Bacteria 6588
139 Ga0495610_0035659 3300046512 Bacteria 2551
140 Ga0495616_0009753 3300046513 Bacteria 5594
141 Ga0495620_0107993 3300046515 Bacteria 1104
142 Ga0495631_0000896 3300046518 Bacteria 18620
143 Ga0495637_0018422 3300046520 Bacteria 3239
144 Ga0495648_0050412 3300046524 Bacteria 2543
145 Ga0495642_0011933 3300046528 Bacteria 3347
146 Ga0495654_0111489 3300046530 Bacteria 1248
147 Ga0495609_0034687 3300046538 Bacteria 2286
148 Ga0495597_0041649 3300046542 Bacteria 2050
149 Ga0495633_0088441 3300046558 Bacteria 1440
150 Ga0495668_0013992 3300046616 Bacteria 4716
151 Ga0495625_0114758 3300046660 Bacteria 1838
152 Ga0495589_0044258 3300046794 Bacteria 2214
153 Ga0495685_010820 3300047447 Bacteria 3065
154 Ga0495686_0038650 3300047472 Bacteria 3051
155 Ga0495626_0061499 3300048091 Bacteria 1707
156 Ga0496104_0271598 3300048907 Bacteria 1608
157 Ga0496105_0157670 3300048908 Bacteria 1864
158 Ga0496112_0006746 3300048915 Bacteria 10114
159 Ga0496112_0009098 3300048915 Bacteria 8925
160 Ga0496112_0409739 3300048915 Bacteria 1295
161 Ga0496113_0425147 3300048916 Bacteria 1067
162 Ga0495678_033712 3300049459 Bacteria 2112
163 Ga0501033_0016092 3300049570 Bacteria 5663
164 Ga0501070_0089138 3300049586 Bacteria 2553
165 Ga0501070_0178285 3300049586 Bacteria 1749
166 Ga0501073_0441058 3300049589 Bacteria 900
167 Ga0501074_0074380 3300049590 Bacteria 2440
168 Ga0501076_0236389 3300049592 Bacteria 1494
169 Ga0501080_0173789 3300049742 Bacteria 1986
170 Ga0501035_0148613 3300049822 Bacteria 2034
171 nmdc:mga06z11_17906_c1 3300050494 Bacteria 3226
172 nmdc:mga04h51_2230_c1 3300050495 Bacteria 4568
173 nmdc:mga05p37_3020_c1 3300050507 Bacteria 19531
174 nmdc:mga09592_313849_c1 3300050508 Bacteria 1358
175 nmdc:mga0qj67_261147_c1 3300050509 Bacteria 1405
176 nmdc:mga06r32_276539_c1 3300050510 Bacteria 1666
177 nmdc:mga06r32_292810_c1 3300050510 Bacteria 1614
178 nmdc:mga08y16_213758_c1 3300050511 Bacteria 1997
179 nmdc:mga08y16_40045_c1 3300050511 Bacteria 4914
180 Ga0466962_0000980 3300061719 Bacteria 12990
181 Ga0466962_0003771 3300061719 Bacteria 7237
182 Ga0466962_0021160 3300061719 Bacteria 3124
183 Ga0530510_0164447 3300061734 Bacteria 1642
184 2585315470 2582581314 Bacteria 11452267
185 2644629288 2643221714 Bacteria 9015452
186 2676475970 2675903058 Bacteria 6822861
187 2676484345 2675903059 Bacteria 8644972
188 2812360056 2811994879 Bacteria 9313447
189 2827630532 2827628540 Bacteria 6858585
190 2862289355 2862281513 Bacteria 9621493
191 2867476690 2867475112 Bacteria 6909112
192 2912725867 2912723979 Bacteria 8557534
193 2946065835 2946064051 Bacteria 8957905
194 2946074170 2946072368 Bacteria 8999607
195 2947231564 2947224130 Bacteria 9938529
196 2990062645 2990059506 Bacteria 9321252
197 2997453831 2997451912 Bacteria 8492419
198 2997600736 2997600082 Bacteria 9896405
199 3006490404 3006486233 Bacteria 8157040
200 8008580503 8008574985 Bacteria 7815457
201 8048412055 8048406513 Bacteria 8936924
202 8054165586 8054160619 Bacteria 7783213
203 8056447381 8056447290 Bacteria 7680491
204 8056672610 8056667051 Bacteria 6953971
205 8056835439 8056829672 Bacteria 9045328
206 Ga0207426_1000760
207 Ga0070683_100014811
208 Ga0068869_100005343
209 Ga0068868_100055786
210 Ga0070660_100031360
211 Ga0070692_10022437
212 Ga0070675_100021372
213 Ga0070659_100011364
214 Ga0070709_10076584
215 Ga0070700_100050275
216 Ga0070662_100035801
217 Ga0070706_100000939
218 Ga0070684_100162742
219 Ga0068855_100417020
220 Ga0070664_100011158
221 Ga0070664_100471576
222 Ga0068857_100075785
223 Ga0068854_100083714
224 Ga0068856_100094411
225 Ga0070702_100067343
226 Ga0068852_100196412
227 Ga0068864_100612118
228 Ga0068861_100083400
229 Ga0068870_10015822
230 Ga0068863_100010170
231 Ga0068860_100070209
232 Ga0068862_100166091
233 Ga0075368_10004897
234 Ga0070712_100062617
235 Ga0075367_10000785
236 Ga0075430_100257820
237 Ga0075431_100286041
238 Ga0075429_100494920
239 Ga0068865_100561002
240 Ga0111539_10001594
241 Ga0111539_10004442
242 Ga0111539_10040939
243 Ga0105245_10258945
244 Ga0114129_10018110
245 Ga0105241_10524328
246 Ga0105239_10321865
247 Ga0105246_10008010
248 Ga0163162_10499223
249 Ga0163163_10197922
250 Ga0163163_10291581
251 Ga0157377_10029401
252 Ga0157377_10444036
253 Ga0183367_1010
254 Ga0224572_1002791
255 Ga0209758_1006079
256 Ga0207426_1007242
257 Ga0207426_1009588
258 Ga0207688_10018281
259 Ga0207685_10043166
260 Ga0207643_10041700
261 Ga0207693_10111958
262 Ga0207662_10205680
263 Ga0207659_10061446
264 Ga0207690_10015784
265 Ga0207706_10030999
266 Ga0207704_10500826
267 Ga0207689_10046268
268 Ga0207679_10001499
269 Ga0207668_10129458
270 Ga0207677_10051343
271 Ga0207708_10148698
272 Ga0207702_10783084
273 Ga0207676_10298490
274 Ga0207674_10011268
275 Ga0207675_100114220
276 Ga0207683_10246545
277 Ga0207698_10170811
278 Ga0209969_1005545
279 Ga0209983_1014521
280 Ga0209971_1002545
281 Ga0209998_10007810
282 Ga0209998_10021118
283 Ga0209813_10002058
284 Ga0209974_10001818
285 Ga0207428_10045119
286 Ga0268265_10006862
287 Ga0307512_10005563
288 Ga0307508_10011515
289 Ga0307516_10269366
290 Ga0307405_10128508
291 Ga0307405_10237321
292 Ga0307518_10228455
293 Ga0307409_100056664
294 Ga0307416_100274787
295 Ga0307507_10091689
296 Ga0395898_0010216
297 Ga0395905_0086453
298 Ga0439439_0004355
299 Ga0451853_1541184
300 Ga0439442_003368
301 Ga0439449_0002929
302 Ga0439449_0008651
303 Ga0439455_0000798
304 Ga0439457_001369
305 Ga0439457_003870
306 Ga0439462_0006345
307 Ga0439462_0019441
308 Ga0450894_001927
309 Ga0450895_003752
310 Ga0450898_000263
311 Ga0450908_002333
312 Ga0466969_0006794
313 Ga0466969_0019040
314 Ga0466969_0041098
315 Ga0466972_0014501
316 Ga0466965_0036827
317 Ga0466965_0043175
318 Ga0466966_0000145
319 Ga0466966_0001252
320 Ga0466966_0008105
321 Ga0466961_0003360
322 Ga0466961_0040233
323 Ga0466963_0000329
324 Ga0466964_0048843
325 Ga0466971_0000855
326 Ga0466971_0013255
327 Ga0466970_0000952
328 Ga0466970_0057461
329 Ga0466970_0177857
330 Ga0466957_0274910
331 Ga0466959_0002606
332 Ga0466959_0003724
333 Ga0466959_0009075
334 Ga0466959_0027128
335 Ga0466958_0006735
336 Ga0466967_0007316
337 Ga0466967_0028254
338 Ga0495603_0181784
339 Ga0495629_0040211
340 Ga0495585_0085573
341 Ga0495596_0158923
342 Ga0495607_0041315
343 Ga0495606_0013093
344 Ga0495610_0035659
345 Ga0495616_0009753
346 Ga0495620_0107993
347 Ga0495631_0000896
348 Ga0495637_0018422
349 Ga0495648_0050412
350 Ga0495642_0011933
351 Ga0495654_0111489
352 Ga0495609_0034687
353 Ga0495597_0041649
354 Ga0495633_0088441
355 Ga0495668_0013992
356 Ga0495625_0114758
357 Ga0495589_0044258
358 Ga0495685_010820
359 Ga0495686_0038650
360 Ga0495626_0061499
361 Ga0496104_0271598
362 Ga0496105_0157670
363 Ga0496112_0006746
364 Ga0496112_0009098
365 Ga0496112_0409739
366 Ga0496113_0425147
367 Ga0495678_033712
368 Ga0501033_0016092
369 Ga0501070_0089138
370 Ga0501070_0178285
371 Ga0501073_0441058
372 Ga0501074_0074380
373 Ga0501076_0236389
374 Ga0501080_0173789
375 Ga0501035_0148613
376 nmdc:mga06z11_17906_c1
377 nmdc:mga04h51_2230_c1
378 nmdc:mga05p37_3020_c1
379 nmdc:mga09592_313849_c1
380 nmdc:mga0qj67_261147_c1
381 nmdc:mga06r32_276539_c1
382 nmdc:mga06r32_292810_c1
383 nmdc:mga08y16_213758_c1
384 nmdc:mga08y16_40045_c1
385 Ga0466962_0000980
386 Ga0466962_0003771
387 Ga0466962_0021160
388 Ga0530510_0164447
389 2585315470
390 2644629288
391 2676475970
392 2676484345
393 2812360056
394 2827630532
395 2862289355
396 2867476690
397 2912725867
398 2946065835
399 2946074170
400 2947231564
401 2990062645
402 2997453831
403 2997600736
404 3006490404
405 8008580503
406 8048412055
407 8054165586
408 8056447381
409 8056672610
410 8056835439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

43

261

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.8537 1 234
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.8501 1 237
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.8149 1 237
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.8082 1 234
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.7924 1 242
ID Description Score Start End Superfamily
af_Q4E4B4_140_369_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8615 65 239 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8537 1 234 3.20.20.410
1ztvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8423 1 237 3.20.20.410
af_Q2FZX7_1_282_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8412 1 237 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8082 1 234 3.20.20.410
ID Description Score Start End GO Terms
AF-A0A7W8BVV9-F1-model_v4 Uncharacterized protein YecE (DUF72 family) 0.9909 2 247
AF-A0A6H1N2I0-F1-model_v4 DUF72 domain-containing protein 0.9909 2 247
AF-A0A024YX61-F1-model_v4 deleted 0.9908 1 240
AF-A0A7Z9XIE1-F1-model_v4 DUF72 domain-containing protein 0.9898 1 113
AF-D0L621-F1-model_v4 DUF72 domain-containing protein 0.9897 1 149

Map