F313824

General Info

Members Datasets Scaffolds Average Seq Length
205 103 410 293

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10030454|Ga0157370_100304545
Length 344
Sequence MRIVPESLAAHLASGATTLCRCWRVTRHDAVVQGFTDHDEDVVFDDTTFYAGTGFEGTEIEAQLGFAITGTELHGALSSETLSEDDLAAGRYDDAKIELFLVDWSNPENRLLLRAGNLGEVKREDSAFSAEVRGIASRLDEEKGRIFAAGCDADLGDQRCTIDLGNPAFRGEGVIFAVEGASIFTASGLDGFADGWFTQGRLQWTSGANAGLAIEIKEHRIGGGVHLSLWQTMPEPLAIGDTFVVTAGCDKRFETCTSKFANALNFRGFPHLPGNDFVVAYAVPGEPGNDGTPVRERRRQVHYDLVMAGLVPAIHALPSPRRTKAWMHSNSGLPEFDSLIAQVG

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
9 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
12 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
13 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
14 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
17 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
18 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
19 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
24 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
25 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
26 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
27 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
28 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
29 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
30 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
31 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
32 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
33 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
34 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
35 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
36 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
37 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
38 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
39 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
40 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
41 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
42 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
43 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
44 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
45 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
46 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
47 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
48 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
49 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
50 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
51 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
52 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
54 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
55 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
56 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
57 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
58 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
59 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
60 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
61 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
62 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
63 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
65 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
66 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
67 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
68 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
69 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
70 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
71 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
72 2534681786 Brucella suis 92/29 Isolate Unclassified
73 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
74 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
75 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
76 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
77 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
78 2751185800 Brucella pituitosa AA2 Isolate Unclassified
79 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
80 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
81 2773857925 Microvirga vignae BR3299 Isolate Unclassified
82 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
83 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
84 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
85 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
86 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
87 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
88 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
89 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
90 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
91 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
92 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
93 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
94 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
95 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
96 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
97 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
98 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
99 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
100 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
101 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
102 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
103 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.44
Metatranscriptomes 0
Isolates 17.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.93
Nodule 1.46
Rhizoplane 0.49
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10030454 3300013104 Bacteria 5287
2 JGI25406J46586_10037505 3300003203 Bacteria 1746
3 JGI25406J46586_10050205 3300003203 Bacteria 1402
4 rootH2_10258495 3300003320 Bacteria 1707
5 Ga0070680_100044439 3300005336 Bacteria 3610
6 Ga0070680_100169654 3300005336 Bacteria 1836
7 Ga0070682_100161865 3300005337 Bacteria 1546
8 Ga0070681_10527781 3300005458 Bacteria 1094
9 Ga0070679_100138480 3300005530 Bacteria 2415
10 Ga0068860_100487460 3300005843 Viruses 1229
11 Ga0081540_1104887 3300005983 Bacteria 1208
12 Ga0081539_10006838 3300005985 Bacteria 10666
13 Ga0075365_10224815 3300006038 Bacteria 1317
14 Ga0105241_10156923 3300009174 Bacteria 1867
15 Ga0105239_10880466 3300010375 Bacteria 1027
16 Ga0163162_10328013 3300013306 Bacteria 1663
17 Ga0157372_10056025 3300013307 Bacteria 4404
18 Ga0157380_10034444 3300014326 Bacteria 3907
19 Ga0213876_10008337 3300021384 Bacteria 5609
20 Ga0209025_1028785 3300025294 Bacteria 2710
21 Ga0207643_10111327 3300025908 Bacteria 1613
22 Ga0207707_10238621 3300025912 Bacteria 1581
23 Ga0207660_10109248 3300025917 Bacteria 2078
24 Ga0207660_10148087 3300025917 Bacteria 1801
25 Ga0207652_10434057 3300025921 Bacteria 1184
26 Ga0265328_10000310 3300031239 Bacteria 22678
27 Ga0265328_10000616 3300031239 Bacteria 16530
28 Ga0265328_10001252 3300031239 Bacteria 11745
29 Ga0265328_10020481 3300031239 Bacteria 2531
30 Ga0265331_10000061 3300031250 Bacteria 168963
31 Ga0265331_10054204 3300031250 Bacteria 1910
32 Ga0265313_10002494 3300031595 Bacteria 15858
33 Ga0307416_100125826 3300032002 Bacteria 2295
34 Ga0307414_10120537 3300032004 Bacteria 2016
35 Ga0373939_0013402 3300035114 Bacteria 2109
36 Ga0373941_0079608 3300035115 Unclassified 1104
37 Ga0373960_0003303 3300035121 Unclassified 3650
38 Ga0373962_0011851 3300035242 Viruses 2190
39 Ga0373931_0040534 3300035691 Viruses 2444
40 Ga0400483_164970 3300039062 Viruses 2751
41 Ga0436365_0424240 3300039437 Bacteria 14058
42 Ga0466972_0015007 3300044658 Bacteria 3875
43 Ga0495672_0000749 3300047320 Bacteria 35521
44 Ga0496119_0009163 3300048922 Bacteria 8551
45 Ga0496122_0073308 3300048925 Bacteria 2428
46 Ga0496122_0078808 3300048925 Bacteria 2306
47 Ga0496123_0048177 3300048926 Bacteria 2869
48 Ga0496125_0079355 3300048928 Bacteria 2518
49 Ga0496125_0276336 3300048928 Bacteria 1043
50 Ga0501031_0004069 3300049568 Bacteria 9433
51 Ga0501031_0010485 3300049568 Bacteria 6037
52 Ga0501031_0072637 3300049568 Bacteria 2240
53 Ga0501032_0000082 3300049569 Bacteria 82284
54 Ga0501032_0000703 3300049569 Bacteria 27246
55 Ga0501032_0021533 3300049569 Bacteria 4480
56 Ga0501032_0031574 3300049569 Bacteria 3632
57 Ga0501032_0031660 3300049569 Bacteria 3626
58 Ga0501032_0109388 3300049569 Bacteria 1830
59 Ga0501032_0147797 3300049569 Bacteria 1546
60 Ga0501033_0000070 3300049570 Bacteria 97795
61 Ga0501033_0001794 3300049570 Bacteria 18728
62 Ga0501033_0007674 3300049570 Bacteria 8371
63 Ga0501033_0007917 3300049570 Bacteria 8231
64 Ga0501033_0010949 3300049570 Bacteria 6951
65 Ga0501033_0026474 3300049570 Bacteria 4364
66 Ga0501033_0035184 3300049570 Bacteria 3756
67 Ga0501033_0104738 3300049570 Bacteria 2062
68 Ga0501033_0167811 3300049570 Bacteria 1577
69 Ga0501033_0344961 3300049570 Bacteria 1044
70 Ga0501034_0000087 3300049571 Bacteria 166714
71 Ga0501034_0003097 3300049571 Bacteria 19167
72 Ga0501034_0006468 3300049571 Bacteria 12618
73 Ga0501034_0019321 3300049571 Bacteria 6972
74 Ga0501034_0069945 3300049571 Bacteria 3521
75 Ga0501034_0078111 3300049571 Bacteria 3315
76 Ga0501034_0090660 3300049571 Bacteria 3054
77 Ga0501034_0107181 3300049571 Bacteria 2787
78 Ga0501034_0110304 3300049571 Bacteria 2743
79 Ga0501034_0120452 3300049571 Bacteria 2611
80 Ga0501034_0134702 3300049571 Bacteria 2452
81 Ga0501034_0192998 3300049571 Bacteria 1998
82 Ga0501034_0410647 3300049571 Bacteria 1276
83 Ga0501034_0479128 3300049571 Bacteria 1160
84 Ga0501036_0000256 3300049572 Bacteria 36120
85 Ga0501036_0026982 3300049572 Bacteria 4854
86 Ga0501037_0000014 3300049573 Bacteria 171015
87 Ga0501037_0000900 3300049573 Bacteria 22173
88 Ga0501037_0019193 3300049573 Bacteria 5039
89 Ga0501037_0031585 3300049573 Bacteria 3910
90 Ga0501038_0000023 3300049574 Bacteria 151469
91 Ga0501038_0009943 3300049574 Bacteria 8711
92 Ga0501039_0000044 3300049575 Bacteria 108828
93 Ga0501039_0046098 3300049575 Bacteria 3368
94 Ga0501039_0058645 3300049575 Bacteria 2982
95 Ga0501039_0138720 3300049575 Bacteria 1910
96 Ga0501043_0000022 3300049579 Bacteria 154467
97 Ga0501043_0000088 3300049579 Bacteria 82282
98 Ga0501043_0058875 3300049579 Bacteria 3015
99 Ga0501043_0120521 3300049579 Bacteria 2057
100 Ga0501043_0209405 3300049579 Bacteria 1511
101 Ga0501046_0051971 3300049580 Bacteria 3232
102 Ga0501047_0000807 3300049581 Bacteria 32647
103 Ga0501047_0001977 3300049581 Bacteria 19664
104 Ga0501047_0004589 3300049581 Bacteria 12991
105 Ga0501047_0055675 3300049581 Bacteria 3824
106 Ga0501047_0069283 3300049581 Bacteria 3397
107 Ga0501047_0093193 3300049581 Bacteria 2891
108 Ga0501047_0181325 3300049581 Bacteria 1972
109 Ga0501047_0202632 3300049581 Bacteria 1845
110 Ga0501047_0203002 3300049581 Bacteria 1843
111 Ga0501047_0380643 3300049581 Bacteria 1245
112 Ga0501048_0038730 3300049582 Bacteria 3421
113 Ga0501068_0003221 3300049584 Bacteria 8743
114 Ga0501069_0000012 3300049585 Bacteria 148453
115 Ga0501069_0006702 3300049585 Bacteria 6031
116 Ga0501070_0000692 3300049586 Bacteria 30900
117 Ga0501070_0001122 3300049586 Bacteria 24014
118 Ga0501070_0007523 3300049586 Bacteria 9256
119 Ga0501070_0045095 3300049586 Bacteria 3667
120 Ga0501070_0182513 3300049586 Bacteria 1727
121 Ga0501070_0188698 3300049586 Bacteria 1695
122 Ga0501070_0346319 3300049586 Bacteria 1206
123 Ga0501071_0017946 3300049587 Bacteria 4893
124 Ga0501072_0070833 3300049588 Viruses 2754
125 Ga0501072_0396241 3300049588 Bacteria 1095
126 Ga0501073_0015758 3300049589 Bacteria 5478
127 Ga0501073_0170769 3300049589 Bacteria 1505
128 Ga0501073_0180422 3300049589 Bacteria 1461
129 Ga0501074_0000021 3300049590 Bacteria 71950
130 Ga0501074_0030170 3300049590 Bacteria 3930
131 Ga0501074_0049181 3300049590 Bacteria 3044
132 Ga0501074_0222781 3300049590 Bacteria 1343
133 Ga0501238_016469 3300049671 Bacteria 1025
134 Ga0501080_0000335 3300049742 Bacteria 36045
135 Ga0501080_0000451 3300049742 Bacteria 31990
136 Ga0501080_0000905 3300049742 Bacteria 24287
137 Ga0501080_0386968 3300049742 Bacteria 1259
138 Ga0501083_0000114 3300049744 Bacteria 55139
139 Ga0501083_0001685 3300049744 Bacteria 15068
140 Ga0501083_0005188 3300049744 Bacteria 9217
141 Ga0501083_0187051 3300049744 Bacteria 1352
142 Ga0501035_0000039 3300049822 Bacteria 156824
143 Ga0501035_0000047 3300049822 Bacteria 146497
144 Ga0501035_0001418 3300049822 Bacteria 24567
145 Ga0501035_0002760 3300049822 Bacteria 17025
146 Ga0501035_0003306 3300049822 Bacteria 15451
147 Ga0501035_0040521 3300049822 Bacteria 4208
148 Ga0501035_0047341 3300049822 Bacteria 3860
149 Ga0501035_0059811 3300049822 Bacteria 3393
150 Ga0501035_0104513 3300049822 Bacteria 2483
151 Ga0501044_0000047 3300049823 Bacteria 146449
152 Ga0501044_0013928 3300049823 Bacteria 8689
153 Ga0501044_0014467 3300049823 Bacteria 8516
154 Ga0501044_0014893 3300049823 Bacteria 8384
155 Ga0501044_0026230 3300049823 Bacteria 6170
156 Ga0501044_0039084 3300049823 Bacteria 4952
157 Ga0501044_0084992 3300049823 Bacteria 3197
158 Ga0501044_0158182 3300049823 Bacteria 2244
159 Ga0501044_0548759 3300049823 Bacteria 1053
160 nmdc:mga0yw44_293523_c1 3300050492 Unclassified 1088
161 Ga0500556_0000941 3300053104 Bacteria 15742
162 Ga0500652_000062 3300053131 Bacteria 47514
163 Ga0500559_0022601 3300053136 Bacteria 2667
164 Ga0501082_0009480 3300060353 Bacteria 8383
165 Ga0501082_0009972 3300060353 Bacteria 8189
166 Ga0501082_0020487 3300060353 Bacteria 5703
167 Ga0501082_0034271 3300060353 Bacteria 4379
168 Ga0501082_0075660 3300060353 Bacteria 2900
169 Ga0501082_0247601 3300060353 Bacteria 1551
170 2509079553 2508501114 Bacteria 7082538
171 2511391598 2511231027 Bacteria 5013807
172 2535484354 2534681786 Bacteria 3308809
173 2643757067 2643221547 Bacteria 4740017
174 2643774825 2643221551 Bacteria 3750538
175 2643776387 2643221551 Bacteria 3750538
176 2643793269 2643221555 Bacteria 3749717
177 2643794834 2643221555 Bacteria 3749717
178 2738745841 2738541281 Bacteria 5112672
179 2739355071 2738543032 Bacteria 5115625
180 2753358921 2751185800 Bacteria 5467370
181 2758641156 2758568016 Bacteria 5645291
182 2765468396 2765235802 Bacteria 5618596
183 2774871173 2773857925 Bacteria 6472445
184 2776261379 2775506901 Bacteria 9631051
185 2828306981 2828305725 Bacteria 4916900
186 2835314646 2835312727 Bacteria 7413381
187 2839994662 2839993093 Bacteria 5512535
188 2840765857 2840764183 Bacteria 6358399
189 2842701960 2842698319 Bacteria 5190321
190 2842876091 2842871566 Bacteria 4827117
191 2882457737 2882456835 Bacteria 6863978
192 2884300767 2884298095 Bacteria 3823049
193 2891090579 2891088606 Bacteria 4762464
194 2894239133 2894232714 Bacteria 8834183
195 2894655037 2894652903 Bacteria 4587256
196 2894819510 2894817345 Bacteria 4892941
197 2904581179 2904578770 Bacteria 5302906
198 2915651424 2915650412 Bacteria 4288180
199 2917558741 2917554339 Bacteria 4987857
200 2919122423 2919119836 Bacteria 5208557
201 2928526094 2928521798 Bacteria 4960112
202 2937846665 2937843397 Bacteria 5256375
203 2939670085 2939669807 Bacteria 5028511
204 2996340194 2996336353 Bacteria 5511628
205 3003932540 3003930520 Bacteria 5667563
206 Ga0157370_10030454
207 JGI25406J46586_10037505
208 JGI25406J46586_10050205
209 rootH2_10258495
210 Ga0070680_100044439
211 Ga0070680_100169654
212 Ga0070682_100161865
213 Ga0070681_10527781
214 Ga0070679_100138480
215 Ga0068860_100487460
216 Ga0081540_1104887
217 Ga0081539_10006838
218 Ga0075365_10224815
219 Ga0105241_10156923
220 Ga0105239_10880466
221 Ga0163162_10328013
222 Ga0157372_10056025
223 Ga0157380_10034444
224 Ga0213876_10008337
225 Ga0209025_1028785
226 Ga0207643_10111327
227 Ga0207707_10238621
228 Ga0207660_10109248
229 Ga0207660_10148087
230 Ga0207652_10434057
231 Ga0265328_10000310
232 Ga0265328_10000616
233 Ga0265328_10001252
234 Ga0265328_10020481
235 Ga0265331_10000061
236 Ga0265331_10054204
237 Ga0265313_10002494
238 Ga0307416_100125826
239 Ga0307414_10120537
240 Ga0373939_0013402
241 Ga0373941_0079608
242 Ga0373960_0003303
243 Ga0373962_0011851
244 Ga0373931_0040534
245 Ga0400483_164970
246 Ga0436365_0424240
247 Ga0466972_0015007
248 Ga0495672_0000749
249 Ga0496119_0009163
250 Ga0496122_0073308
251 Ga0496122_0078808
252 Ga0496123_0048177
253 Ga0496125_0079355
254 Ga0496125_0276336
255 Ga0501031_0004069
256 Ga0501031_0010485
257 Ga0501031_0072637
258 Ga0501032_0000082
259 Ga0501032_0000703
260 Ga0501032_0021533
261 Ga0501032_0031574
262 Ga0501032_0031660
263 Ga0501032_0109388
264 Ga0501032_0147797
265 Ga0501033_0000070
266 Ga0501033_0001794
267 Ga0501033_0007674
268 Ga0501033_0007917
269 Ga0501033_0010949
270 Ga0501033_0026474
271 Ga0501033_0035184
272 Ga0501033_0104738
273 Ga0501033_0167811
274 Ga0501033_0344961
275 Ga0501034_0000087
276 Ga0501034_0003097
277 Ga0501034_0006468
278 Ga0501034_0019321
279 Ga0501034_0069945
280 Ga0501034_0078111
281 Ga0501034_0090660
282 Ga0501034_0107181
283 Ga0501034_0110304
284 Ga0501034_0120452
285 Ga0501034_0134702
286 Ga0501034_0192998
287 Ga0501034_0410647
288 Ga0501034_0479128
289 Ga0501036_0000256
290 Ga0501036_0026982
291 Ga0501037_0000014
292 Ga0501037_0000900
293 Ga0501037_0019193
294 Ga0501037_0031585
295 Ga0501038_0000023
296 Ga0501038_0009943
297 Ga0501039_0000044
298 Ga0501039_0046098
299 Ga0501039_0058645
300 Ga0501039_0138720
301 Ga0501043_0000022
302 Ga0501043_0000088
303 Ga0501043_0058875
304 Ga0501043_0120521
305 Ga0501043_0209405
306 Ga0501046_0051971
307 Ga0501047_0000807
308 Ga0501047_0001977
309 Ga0501047_0004589
310 Ga0501047_0055675
311 Ga0501047_0069283
312 Ga0501047_0093193
313 Ga0501047_0181325
314 Ga0501047_0202632
315 Ga0501047_0203002
316 Ga0501047_0380643
317 Ga0501048_0038730
318 Ga0501068_0003221
319 Ga0501069_0000012
320 Ga0501069_0006702
321 Ga0501070_0000692
322 Ga0501070_0001122
323 Ga0501070_0007523
324 Ga0501070_0045095
325 Ga0501070_0182513
326 Ga0501070_0188698
327 Ga0501070_0346319
328 Ga0501071_0017946
329 Ga0501072_0070833
330 Ga0501072_0396241
331 Ga0501073_0015758
332 Ga0501073_0170769
333 Ga0501073_0180422
334 Ga0501074_0000021
335 Ga0501074_0030170
336 Ga0501074_0049181
337 Ga0501074_0222781
338 Ga0501238_016469
339 Ga0501080_0000335
340 Ga0501080_0000451
341 Ga0501080_0000905
342 Ga0501080_0386968
343 Ga0501083_0000114
344 Ga0501083_0001685
345 Ga0501083_0005188
346 Ga0501083_0187051
347 Ga0501035_0000039
348 Ga0501035_0000047
349 Ga0501035_0001418
350 Ga0501035_0002760
351 Ga0501035_0003306
352 Ga0501035_0040521
353 Ga0501035_0047341
354 Ga0501035_0059811
355 Ga0501035_0104513
356 Ga0501044_0000047
357 Ga0501044_0013928
358 Ga0501044_0014467
359 Ga0501044_0014893
360 Ga0501044_0026230
361 Ga0501044_0039084
362 Ga0501044_0084992
363 Ga0501044_0158182
364 Ga0501044_0548759
365 nmdc:mga0yw44_293523_c1
366 Ga0500556_0000941
367 Ga0500652_000062
368 Ga0500559_0022601
369 Ga0501082_0009480
370 Ga0501082_0009972
371 Ga0501082_0020487
372 Ga0501082_0034271
373 Ga0501082_0075660
374 Ga0501082_0247601
375 2509079553
376 2511391598
377 2535484354
378 2643757067
379 2643774825
380 2643776387
381 2643793269
382 2643794834
383 2738745841
384 2739355071
385 2753358921
386 2758641156
387 2765468396
388 2774871173
389 2776261379
390 2828306981
391 2835314646
392 2839994662
393 2840765857
394 2842701960
395 2842876091
396 2882457737
397 2884300767
398 2891090579
399 2894239133
400 2894655037
401 2894819510
402 2904581179
403 2915651424
404 2917558741
405 2919122423
406 2928526094
407 2937846665
408 2939670085
409 2996340194
410 3003932540

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09931

DUF2163

Uncharacterized conserved protein (DUF2163)

1

163

1

PF09356

Phage_BR0599

Phage conserved hypothetical protein BR0599

195

276

0.99

Map