F313569

General Info

Members Datasets Scaffolds Average Seq Length
205 138 188 167

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100348585|Ga0068853_1003485852
Length 181
Sequence VTPTTHPAMRVIGLAGWSGAGKTTLVVRLVPELVRRGLSVSTMKHAHHDFDVDQPGKDSYRHRTAGATEVMVTSERRWALMHENRAQAEPTAAELMRRMTPVDLLIVEGFKREGHDKLEIHRRETGNPLLYPEDRHIVAVLSDEPLPDCPLPVIGIDDVGAIADFIMAHCGLGAVRAAAGG

Samples

Sample ID Description Type Environment
1 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
2 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
3 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
4 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
5 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
6 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
7 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
8 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
9 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
10 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
11 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
12 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
13 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
14 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
15 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
16 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
49 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
61 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
66 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
67 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
68 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
70 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
71 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
78 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
133 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
134 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
135 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.71
Metatranscriptomes 0
Isolates 8.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.59
Nodule 7.8
Rhizoplane 3.41
Rhizosphere 69.27
Stem 0
Stem Tuber 0
Unclassified 2.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10507436 3300005290 Bacteria 645
2 Ga0065715_10499465 3300005293 Bacteria 781
3 Ga0070661_100150157 3300005344 Bacteria 1761
4 Ga0070673_101233070 3300005364 Bacteria 701
5 Ga0070708_100288341 3300005445 Bacteria 1545
6 Ga0070707_100684939 3300005468 Bacteria 988
7 Ga0070698_100000298 3300005471 Bacteria 50665
8 Ga0070697_100513718 3300005536 Bacteria 1048
9 Ga0068853_100348585 3300005539 Bacteria 1377
10 Ga0070665_100037136 3300005548 Bacteria 4899
11 Ga0068857_100031488 3300005577 Bacteria 4687
12 Ga0068862_100202101 3300005844 Bacteria 1792
13 Ga0081455_10514017 3300005937 Bacteria 801
14 Ga0081539_10001761 3300005985 Bacteria 34524
15 Ga0075365_10127162 3300006038 Bacteria 1761
16 Ga0075365_10237558 3300006038 Bacteria 1280
17 Ga0075365_10369349 3300006038 Bacteria 1012
18 Ga0075368_10054541 3300006042 Bacteria 1593
19 Ga0075368_10096430 3300006042 Bacteria 1212
20 Ga0075363_100093202 3300006048 Bacteria 1660
21 Ga0075364_10257938 3300006051 Bacteria 1185
22 Ga0075362_10103198 3300006177 Bacteria 1335
23 Ga0075362_10238245 3300006177 Bacteria 893
24 Ga0075367_10001569 3300006178 Bacteria 9888
25 Ga0075367_10077720 3300006178 Bacteria 2004
26 Ga0075367_10163420 3300006178 Bacteria 1385
27 Ga0075369_10067231 3300006186 Bacteria 1573
28 Ga0075366_10009827 3300006195 Bacteria 5351
29 Ga0075366_10035209 3300006195 Bacteria 2952
30 Ga0075366_10281636 3300006195 Bacteria 1016
31 Ga0075428_100227913 3300006844 Bacteria 2011
32 Ga0075433_10320296 3300006852 Bacteria 1372
33 Ga0099794_10063555 3300007265 Bacteria 1797
34 Ga0105245_10435650 3300009098 Bacteria 1316
35 Ga0114129_10686220 3300009147 Bacteria 1318
36 Ga0157369_11127539 3300013105 Bacteria 801
37 Ga0157378_10668729 3300013297 Bacteria 1056
38 Ga0157379_10877365 3300014968 Unclassified 850
39 Ga0157379_11296714 3300014968 Bacteria 703
40 Ga0213875_10000145 3300021388 Bacteria 75194
41 Ga0213871_10001564 3300021441 Bacteria 3886
42 Ga0207656_10102105 3300025321 Bacteria 1316
43 Ga0207660_11256560 3300025917 Bacteria 602
44 Ga0207687_10320222 3300025927 Bacteria 1255
45 Ga0207669_11366161 3300025937 Bacteria 603
46 Ga0207651_11057264 3300025960 Bacteria 727
47 Ga0207648_10167298 3300026089 Bacteria 1943
48 Ga0207676_10319893 3300026095 Bacteria 1424
49 Ga0207674_10052741 3300026116 Bacteria 4147
50 Ga0268266_10047839 3300028379 Bacteria 3665
51 Ga0268265_10200577 3300028380 Bacteria 1731
52 Ga0268265_10625541 3300028380 Bacteria 1032
53 Ga0265334_10067407 3300028573 Bacteria 1337
54 Ga0265324_10074396 3300029957 Bacteria 1156
55 Ga0265332_10079098 3300031238 Bacteria 1395
56 Ga0265331_10101618 3300031250 Bacteria 1322
57 Ga0265327_10055933 3300031251 Bacteria 2035
58 Ga0307408_100122355 3300031548 Bacteria 2018
59 Ga0316578_10031681 3300031728 Bacteria 3015
60 Ga0373929_0178634 3300035085 Bacteria 584
61 Ga0373934_0060224 3300035086 Bacteria 1512
62 Ga0373923_0074099 3300035111 Bacteria 1467
63 Ga0373946_0118356 3300035171 Bacteria 1207
64 Ga0373946_0310288 3300035171 Bacteria 782
65 Ga0373961_0231594 3300035241 Bacteria 662
66 Ga0373924_0360776 3300035410 Bacteria 648
67 Ga0373931_0270483 3300035691 Bacteria 1040
68 Ga0373935_0687878 3300035692 Bacteria 752
69 Ga0373935_0750542 3300035692 Bacteria 719
70 Ga0373933_0320307 3300035724 Bacteria 1005
71 Ga0373947_0530313 3300035725 Bacteria 801
72 Ga0373937_0010696 3300036401 Bacteria 8026
73 Ga0373937_0117171 3300036401 Bacteria 2481
74 Ga0316582_0393062 3300036647 Bacteria 955
75 Ga0316584_0195515 3300036712 Bacteria 1494
76 Ga0373925_0164683 3300037068 Bacteria 1748
77 Ga0373925_0328956 3300037068 Bacteria 1238
78 Ga0395899_0176720 3300037312 Bacteria 1501
79 Ga0436364_0056880 3300037853 Bacteria 87492
80 Ga0436364_0492636 3300037853 Bacteria 14588
81 Ga0436365_1212192 3300039437 Bacteria 1129
82 Ga0436360_1192455 3300039438 Bacteria 8888
83 Ga0436361_0969267 3300039447 Bacteria 1684
84 Ga0451577_0041083 3300042876 Bacteria 4153
85 Ga0451577_0061526 3300042876 Bacteria 3348
86 Ga0451577_0380138 3300042876 Bacteria 1281
87 Ga0453683_0155171 3300044673 Bacteria 1447
88 Ga0453683_0327527 3300044673 Bacteria 982
89 Ga0453683_0367254 3300044673 Bacteria 925
90 Ga0453684_0001349 3300044712 Bacteria 71826
91 Ga0453684_0004419 3300044712 Bacteria 29717
92 Ga0453684_0606930 3300044712 Bacteria 1198
93 Ga0451576_0000446 3300045051 Bacteria 93958
94 Ga0451576_0014513 3300045051 Bacteria 8763
95 Ga0451576_0034047 3300045051 Bacteria 5412
96 Ga0451576_0124964 3300045051 Bacteria 2680
97 Ga0451576_0813918 3300045051 Bacteria 981
98 Ga0451576_0891120 3300045051 Bacteria 933
99 Ga0451576_1028604 3300045051 Bacteria 863
100 Ga0495651_0356791 3300046462 Bacteria 965
101 Ga0495580_0325948 3300046472 Bacteria 1043
102 Ga0495647_0073918 3300046681 Bacteria 1370
103 Ga0495672_0208626 3300047320 Bacteria 972
104 Ga0496109_0648628 3300048912 Bacteria 993
105 Ga0496110_0337430 3300048913 Bacteria 1373
106 Ga0496111_0568912 3300048914 Bacteria 831
107 Ga0496112_0286453 3300048915 Bacteria 1594
108 Ga0496112_0664001 3300048915 Bacteria 972
109 Ga0496112_1030321 3300048915 Bacteria 742
110 Ga0496115_0138928 3300048918 Bacteria 2004
111 Ga0496126_0160615 3300048929 Bacteria 1920
112 Ga0501031_0000478 3300049568 Bacteria 23335
113 Ga0501031_0013777 3300049568 Bacteria 5270
114 Ga0501031_0106675 3300049568 Bacteria 1828
115 Ga0501032_0000009 3300049569 Bacteria 228107
116 Ga0501032_0000033 3300049569 Bacteria 120909
117 Ga0501032_0403641 3300049569 Bacteria 878
118 Ga0501033_0000115 3300049570 Bacteria 76479
119 Ga0501033_0001086 3300049570 Bacteria 24612
120 Ga0501033_0007311 3300049570 Bacteria 8612
121 Ga0501034_0000044 3300049571 Bacteria 227982
122 Ga0501034_0000537 3300049571 Bacteria 60263
123 Ga0501034_0114368 3300049571 Bacteria 2687
124 Ga0501034_0119042 3300049571 Bacteria 2627
125 Ga0501034_0371466 3300049571 Bacteria 1356
126 Ga0501036_0000008 3300049572 Bacteria 228106
127 Ga0501036_0001415 3300049572 Bacteria 18434
128 Ga0501036_0022141 3300049572 Bacteria 5345
129 Ga0501037_0000067 3300049573 Bacteria 96388
130 Ga0501037_0000086 3300049573 Bacteria 85419
131 Ga0501037_0115770 3300049573 Bacteria 1929
132 Ga0501038_0000006 3300049574 Bacteria 228107
133 Ga0501038_0000013 3300049574 Bacteria 167219
134 Ga0501038_0156432 3300049574 Bacteria 1856
135 Ga0501039_0000010 3300049575 Bacteria 247832
136 Ga0501039_0000014 3300049575 Bacteria 228107
137 Ga0501039_0173878 3300049575 Bacteria 1693
138 Ga0501040_0001394 3300049576 Bacteria 15278
139 Ga0501041_0316972 3300049577 Bacteria 983
140 Ga0501042_0127784 3300049578 Bacteria 1831
141 Ga0501043_0000056 3300049579 Bacteria 104302
142 Ga0501043_0000399 3300049579 Bacteria 39006
143 Ga0501043_0087807 3300049579 Bacteria 2443
144 Ga0501043_0534440 3300049579 Bacteria 873
145 Ga0501046_0074349 3300049580 Bacteria 2636
146 Ga0501046_0083794 3300049580 Bacteria 2460
147 Ga0501047_0007497 3300049581 Bacteria 10267
148 Ga0501047_0119694 3300049581 Bacteria 2515
149 Ga0501048_0013505 3300049582 Bacteria 6060
150 Ga0501067_0434501 3300049583 Bacteria 733
151 Ga0501069_0016314 3300049585 Bacteria 3988
152 Ga0501070_0061039 3300049586 Bacteria 3124
153 Ga0501070_0101051 3300049586 Bacteria 2385
154 Ga0501076_0308433 3300049592 Bacteria 1298
155 Ga0501077_0138358 3300049593 Bacteria 1544
156 Ga0501080_0049907 3300049742 Bacteria 3895
157 Ga0501081_0194136 3300049743 Bacteria 1471
158 Ga0501083_0094833 3300049744 Bacteria 1970
159 Ga0501035_0000063 3300049822 Bacteria 131515
160 Ga0501035_0000151 3300049822 Bacteria 85429
161 Ga0501035_0037192 3300049822 Bacteria 4409
162 Ga0501035_0080303 3300049822 Bacteria 2880
163 Ga0501044_0000017 3300049823 Bacteria 228107
164 Ga0501044_0008677 3300049823 Bacteria 11126
165 Ga0501044_0118429 3300049823 Bacteria 2651
166 Ga0501045_0094283 3300049824 Bacteria 2214
167 Ga0501045_0306763 3300049824 Bacteria 1181
168 nmdc:mga03683_226954_c1 3300050489 Unclassified 863
169 nmdc:mga03683_8183_c1 3300050489 Bacteria 1526
170 nmdc:mga03683_85984_c1 3300050489 Bacteria 1365
171 nmdc:mga00v17_458573_c1 3300050491 Bacteria 827
172 nmdc:mga0yw44_111099_c1 3300050492 Bacteria 1756
173 nmdc:mga0yw44_1124672_c1 3300050492 Bacteria 530
174 nmdc:mga0yw44_161377_c1 3300050492 Bacteria 1467
175 nmdc:mga0yw44_178955_c1 3300050492 Bacteria 1395
176 nmdc:mga0yw44_250770_c1 3300050492 Bacteria 1178
177 nmdc:mga0yw44_78498_c1 3300050492 Bacteria 2065
178 nmdc:mga0yw44_813635_c1 3300050492 Bacteria 634
179 nmdc:mga0k408_135112_c1 3300050493 Bacteria 1465
180 nmdc:mga06z11_147687_c1 3300050494 Bacteria 1334
181 nmdc:mga07m45_135260_c1 3300050496 Bacteria 1427
182 nmdc:mga0a205_538437_c1 3300050515 Bacteria 1023
183 nmdc:mga0sz30_172692_c1 3300050516 Bacteria 958
184 Ga0500651_0210406 3300053093 Bacteria 1144
185 Ga0500641_0006905 3300053096 Bacteria 4037
186 Ga0500558_134245 3300053106 Bacteria 941
187 Ga0501084_0652038 3300054114 Bacteria 889
188 Ga0501082_0384502 3300060353 Bacteria 1225

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006042 Ga0075368_10096430 Ga0075368_100964301 149
2 3300006195 Ga0075366_10035209 Ga0075366_100352092 149
3 3300006042 Ga0075368_10054541 Ga0075368_100545412 156
4 3300006048 Ga0075363_100093202 Ga0075363_1000932022 156
5 3300006051 Ga0075364_10257938 Ga0075364_102579382 156
6 3300006177 Ga0075362_10103198 Ga0075362_101031982 156
7 3300006178 Ga0075367_10001569 Ga0075367_100015692 156
8 3300006178 Ga0075367_10077720 Ga0075367_100777202 156
9 3300006186 Ga0075369_10067231 Ga0075369_100672312 156
10 3300006195 Ga0075366_10009827 Ga0075366_100098272 156
11 3300031238 Ga0265332_10079098 Ga0265332_100790982 156
12 3300050489 nmdc:mga03683_8183_c1 nmdc:mga03683_8183_c1_631_1110 156
13 3300050489 nmdc:mga03683_85984_c1 nmdc:mga03683_85984_c1_98_574 156
14 3300050492 nmdc:mga0yw44_78498_c1 nmdc:mga0yw44_78498_c1_975_1451 156
15 3300050493 nmdc:mga0k408_135112_c1 nmdc:mga0k408_135112_c1_940_1416 156
16 3300050494 nmdc:mga06z11_147687_c1 nmdc:mga06z11_147687_c1_283_762 156
17 3300050516 nmdc:mga0sz30_172692_c1 nmdc:mga0sz30_172692_c1_249_725 156
18 3300060353 Ga0501082_0384502 Ga0501082_0384502_423_902 157
19 3300005937 Ga0081455_10514017 Ga0081455_105140172 158
20 3300035725 Ga0373947_0530313 Ga0373947_0530313_259_744 158
21 3300053096 Ga0500641_0006905 Ga0500641_0006905_2544_3029 158
22 3300006038 Ga0075365_10127162 Ga0075365_101271622 159
23 3300006038 Ga0075365_10369349 Ga0075365_103693492 159
24 3300021441 Ga0213871_10001564 Ga0213871_100015642 159
25 3300025321 Ga0207656_10102105 Ga0207656_101021052 159
26 3300031548 Ga0307408_100122355 Ga0307408_1001223554 159
27 3300035085 Ga0373929_0178634 Ga0373929_0178634_64_549 159
28 3300035086 Ga0373934_0060224 Ga0373934_0060224_258_743 159
29 3300035111 Ga0373923_0074099 Ga0373923_0074099_681_1166 159
30 3300035410 Ga0373924_0360776 Ga0373924_0360776_98_583 159
31 3300035691 Ga0373931_0270483 Ga0373931_0270483_208_693 159
32 3300036401 Ga0373937_0117171 Ga0373937_0117171_1020_1505 159
33 3300039438 Ga0436360_1192455 Ga0436360_1192455_3600_4085 159
34 3300039447 Ga0436361_0969267 Ga0436361_0969267_59_544 159
35 3300050492 nmdc:mga0yw44_161377_c1 nmdc:mga0yw44_161377_c1_919_1404 159
36 3300050492 nmdc:mga0yw44_250770_c1 nmdc:mga0yw44_250770_c1_166_651 159
37 3300005344 Ga0070661_100150157 Ga0070661_1001501572 160
38 3300005445 Ga0070708_100288341 Ga0070708_1002883412 160
39 3300005471 Ga0070698_100000298 Ga0070698_10000029848 160
40 3300006038 Ga0075365_10237558 Ga0075365_102375582 160
41 3300006177 Ga0075362_10238245 Ga0075362_102382452 160
42 3300006178 Ga0075367_10163420 Ga0075367_101634202 160
43 3300013297 Ga0157378_10668729 Ga0157378_106687292 160
44 3300028573 Ga0265334_10067407 Ga0265334_100674071 160
45 3300050491 nmdc:mga00v17_458573_c1 nmdc:mga00v17_458573_c1_212_703 160
46 3300050492 nmdc:mga0yw44_111099_c1 nmdc:mga0yw44_111099_c1_1236_1727 160
47 3300050492 nmdc:mga0yw44_1124672_c1 nmdc:mga0yw44_1124672_c1_19_507 160
48 3300050492 nmdc:mga0yw44_178955_c1 nmdc:mga0yw44_178955_c1_234_722 160
49 3300050492 nmdc:mga0yw44_813635_c1 nmdc:mga0yw44_813635_c1_104_595 160
50 3300053093 Ga0500651_0210406 Ga0500651_0210406_70_558 160
51 3300005468 Ga0070707_100684939 Ga0070707_1006849392 161
52 3300005985 Ga0081539_10001761 Ga0081539_1000176116 161
53 3300007265 Ga0099794_10063555 Ga0099794_100635552 161
54 3300048915 Ga0496112_0664001 Ga0496112_0664001_421_906 161
55 3300005577 Ga0068857_100031488 Ga0068857_1000314884 162
56 3300026116 Ga0207674_10052741 Ga0207674_100527415 162
57 3300053106 Ga0500558_134245 Ga0500558_134245_68_628 162
58 iso_pu_bacteria 2906354277 2906361271 162
59 3300006195 Ga0075366_10281636 Ga0075366_102816362 163
60 3300029957 Ga0265324_10074396 Ga0265324_100743962 163
61 3300031250 Ga0265331_10101618 Ga0265331_101016183 163
62 3300031251 Ga0265327_10055933 Ga0265327_100559332 163
63 3300042876 Ga0451577_0041083 Ga0451577_0041083_2381_2881 163
64 3300042876 Ga0451577_0061526 Ga0451577_0061526_16_507 163
65 3300042876 Ga0451577_0380138 Ga0451577_0380138_608_1099 163
66 3300044673 Ga0453683_0155171 Ga0453683_0155171_94_585 163
67 3300044673 Ga0453683_0367254 Ga0453683_0367254_208_708 163
68 3300044712 Ga0453684_0004419 Ga0453684_0004419_22447_22947 163
69 3300044712 Ga0453684_0606930 Ga0453684_0606930_310_801 163
70 3300045051 Ga0451576_0000446 Ga0451576_0000446_42836_43336 163
71 3300045051 Ga0451576_0034047 Ga0451576_0034047_1043_1534 163
72 3300045051 Ga0451576_0813918 Ga0451576_0813918_322_813 163
73 3300045051 Ga0451576_0891120 Ga0451576_0891120_133_624 163
74 iso_pu_bacteria 2643221564 2643837585 163
75 iso_pu_bacteria 2871488783 2871495170 163
76 iso_pu_bacteria 2878753008 2878758164 163
77 iso_pu_bacteria 2881845957 2881852956 163
78 iso_pu_bacteria 2881861095 2881864202 163
79 iso_pu_bacteria 2882912400 2882916516 163
80 iso_pu_bacteria 2885318864 2885323821 163
81 iso_pu_bacteria 2903492973 2903496104 163
82 iso_pu_bacteria 2924784321 2924785904 163
83 iso_pu_bacteria 2961170736 2961174795 163
84 iso_pu_bacteria 2967996073 2968000730 163
85 iso_pu_bacteria 2968003550 2968009898 163
86 iso_pu_bacteria 2970503327 2970507381 163
87 iso_pu_bacteria 2977821940 2977828762 163
88 iso_pu_bacteria 2979808191 2979812577 163
89 iso_pu_bacteria 8004374579 8004379676 163
90 3300021388 Ga0213875_10000145 Ga0213875_1000014530 164
91 3300031728 Ga0316578_10031681 Ga0316578_100316812 164
92 3300036647 Ga0316582_0393062 Ga0316582_0393062_86_580 164
93 3300036712 Ga0316584_0195515 Ga0316584_0195515_312_806 164
94 3300037312 Ga0395899_0176720 Ga0395899_0176720_625_1167 164
95 3300037853 Ga0436364_0056880 Ga0436364_0056880_32017_32511 164
96 3300037853 Ga0436364_0492636 Ga0436364_0492636_7950_8444 164
97 3300039437 Ga0436365_1212192 Ga0436365_1212192_409_903 164
98 3300044712 Ga0453684_0001349 Ga0453684_0001349_51316_51843 164
99 3300045051 Ga0451576_0014513 Ga0451576_0014513_4814_5341 164
100 3300045051 Ga0451576_0124964 Ga0451576_0124964_118_615 164
101 3300050489 nmdc:mga03683_226954_c1 nmdc:mga03683_226954_c1_73_567 164
102 3300025917 Ga0207660_11256560 Ga0207660_112565601 165
103 3300044673 Ga0453683_0327527 Ga0453683_0327527_41_541 165
104 3300045051 Ga0451576_1028604 Ga0451576_1028604_178_678 165
105 3300048918 Ga0496115_0138928 Ga0496115_0138928_1082_1621 165
106 3300048929 Ga0496126_0160615 Ga0496126_0160615_1021_1560 165
107 3300005364 Ga0070673_101233070 Ga0070673_1012330701 166
108 3300005548 Ga0070665_100037136 Ga0070665_1000371364 166
109 3300005844 Ga0068862_100202101 Ga0068862_1002021012 166
110 3300009098 Ga0105245_10435650 Ga0105245_104356502 166
111 3300013105 Ga0157369_11127539 Ga0157369_111275391 166
112 3300014968 Ga0157379_10877365 Ga0157379_108773652 166
113 3300014968 Ga0157379_11296714 Ga0157379_112967141 166
114 3300025927 Ga0207687_10320222 Ga0207687_103202222 166
115 3300025937 Ga0207669_11366161 Ga0207669_113661611 166
116 3300025960 Ga0207651_11057264 Ga0207651_110572642 166
117 3300026089 Ga0207648_10167298 Ga0207648_101672982 166
118 3300026095 Ga0207676_10319893 Ga0207676_103198932 166
119 3300028379 Ga0268266_10047839 Ga0268266_100478393 166
120 3300028380 Ga0268265_10200577 Ga0268265_102005773 166
121 3300028380 Ga0268265_10625541 Ga0268265_106255411 166
122 3300035171 Ga0373946_0118356 Ga0373946_0118356_18_539 166
123 3300035171 Ga0373946_0310288 Ga0373946_0310288_181_690 166
124 3300035692 Ga0373935_0687878 Ga0373935_0687878_130_648 166
125 3300035692 Ga0373935_0750542 Ga0373935_0750542_64_585 166
126 3300035724 Ga0373933_0320307 Ga0373933_0320307_64_585 166
127 3300036401 Ga0373937_0010696 Ga0373937_0010696_1222_1740 166
128 3300037068 Ga0373925_0164683 Ga0373925_0164683_822_1343 166
129 3300037068 Ga0373925_0328956 Ga0373925_0328956_269_790 166
130 3300046462 Ga0495651_0356791 Ga0495651_0356791_194_715 166
131 3300046472 Ga0495580_0325948 Ga0495580_0325948_103_624 166
132 3300046681 Ga0495647_0073918 Ga0495647_0073918_596_1117 166
133 3300047320 Ga0495672_0208626 Ga0495672_0208626_397_951 166
134 3300048913 Ga0496110_0337430 Ga0496110_0337430_400_918 166
135 3300048915 Ga0496112_0286453 Ga0496112_0286453_343_861 166
136 3300049568 Ga0501031_0000478 Ga0501031_0000478_16474_16986 166
137 3300049568 Ga0501031_0013777 Ga0501031_0013777_1490_1999 166
138 3300049568 Ga0501031_0106675 Ga0501031_0106675_1179_1688 166
139 3300049569 Ga0501032_0000009 Ga0501032_0000009_6350_6862 166
140 3300049569 Ga0501032_0000033 Ga0501032_0000033_48938_49447 166
141 3300049569 Ga0501032_0403641 Ga0501032_0403641_322_834 166
142 3300049570 Ga0501033_0000115 Ga0501033_0000115_46714_47223 166
143 3300049570 Ga0501033_0001086 Ga0501033_0001086_17773_18285 166
144 3300049570 Ga0501033_0007311 Ga0501033_0007311_4205_4717 166
145 3300049571 Ga0501034_0000044 Ga0501034_0000044_6350_6862 166
146 3300049571 Ga0501034_0000537 Ga0501034_0000537_10817_11326 166
147 3300049571 Ga0501034_0114368 Ga0501034_0114368_77_589 166
148 3300049571 Ga0501034_0119042 Ga0501034_0119042_1978_2487 166
149 3300049571 Ga0501034_0371466 Ga0501034_0371466_590_1117 166
150 3300049572 Ga0501036_0000008 Ga0501036_0000008_6350_6862 166
151 3300049572 Ga0501036_0001415 Ga0501036_0001415_494_1003 166
152 3300049572 Ga0501036_0022141 Ga0501036_0022141_2859_3368 166
153 3300049573 Ga0501037_0000067 Ga0501037_0000067_10634_11143 166
154 3300049573 Ga0501037_0000086 Ga0501037_0000086_78558_79070 166
155 3300049573 Ga0501037_0115770 Ga0501037_0115770_696_1205 166
156 3300049574 Ga0501038_0000006 Ga0501038_0000006_6350_6862 166
157 3300049574 Ga0501038_0000013 Ga0501038_0000013_94074_94583 166
158 3300049574 Ga0501038_0156432 Ga0501038_0156432_1084_1596 166
159 3300049575 Ga0501039_0000010 Ga0501039_0000010_213922_214431 166
160 3300049575 Ga0501039_0000014 Ga0501039_0000014_221246_221758 166
161 3300049575 Ga0501039_0173878 Ga0501039_0173878_152_661 166
162 3300049576 Ga0501040_0001394 Ga0501040_0001394_8453_8965 166
163 3300049577 Ga0501041_0316972 Ga0501041_0316972_273_782 166
164 3300049578 Ga0501042_0127784 Ga0501042_0127784_763_1266 166
165 3300049579 Ga0501043_0000056 Ga0501043_0000056_74746_75255 166
166 3300049579 Ga0501043_0000399 Ga0501043_0000399_1024_1536 166
167 3300049579 Ga0501043_0087807 Ga0501043_0087807_756_1265 166
168 3300049579 Ga0501043_0534440 Ga0501043_0534440_158_670 166
169 3300049580 Ga0501046_0074349 Ga0501046_0074349_720_1229 166
170 3300049580 Ga0501046_0083794 Ga0501046_0083794_1569_2078 166
171 3300049581 Ga0501047_0007497 Ga0501047_0007497_6202_6714 166
172 3300049581 Ga0501047_0119694 Ga0501047_0119694_828_1337 166
173 3300049582 Ga0501048_0013505 Ga0501048_0013505_3554_4063 166
174 3300049583 Ga0501067_0434501 Ga0501067_0434501_95_604 166
175 3300049585 Ga0501069_0016314 Ga0501069_0016314_1753_2280 166
176 3300049586 Ga0501070_0061039 Ga0501070_0061039_1978_2487 166
177 3300049586 Ga0501070_0101051 Ga0501070_0101051_87_599 166
178 3300049592 Ga0501076_0308433 Ga0501076_0308433_538_1053 166
179 3300049593 Ga0501077_0138358 Ga0501077_0138358_177_680 166
180 3300049742 Ga0501080_0049907 Ga0501080_0049907_2816_3343 166
181 3300049743 Ga0501081_0194136 Ga0501081_0194136_76_579 166
182 3300049744 Ga0501083_0094833 Ga0501083_0094833_954_1481 166
183 3300049822 Ga0501035_0000063 Ga0501035_0000063_111748_112257 166
184 3300049822 Ga0501035_0000151 Ga0501035_0000151_6350_6862 166
185 3300049822 Ga0501035_0037192 Ga0501035_0037192_3760_4269 166
186 3300049822 Ga0501035_0080303 Ga0501035_0080303_608_1120 166
187 3300049823 Ga0501044_0000017 Ga0501044_0000017_221246_221758 166
188 3300049823 Ga0501044_0008677 Ga0501044_0008677_141_650 166
189 3300049823 Ga0501044_0118429 Ga0501044_0118429_1502_2011 166
190 3300049824 Ga0501045_0094283 Ga0501045_0094283_1509_2018 166
191 3300049824 Ga0501045_0306763 Ga0501045_0306763_587_1099 166
192 3300050496 nmdc:mga07m45_135260_c1 nmdc:mga07m45_135260_c1_172_681 166
193 3300054114 Ga0501084_0652038 Ga0501084_0652038_57_560 166
194 3300005290 Ga0065712_10507436 Ga0065712_105074361 167
195 3300005293 Ga0065715_10499465 Ga0065715_104994651 167
196 3300005536 Ga0070697_100513718 Ga0070697_1005137182 167
197 3300005539 Ga0068853_100348585 Ga0068853_1003485852 167
198 3300006844 Ga0075428_100227913 Ga0075428_1002279133 167
199 3300006852 Ga0075433_10320296 Ga0075433_103202962 167
200 3300009147 Ga0114129_10686220 Ga0114129_106862202 167
201 3300035241 Ga0373961_0231594 Ga0373961_0231594_107_619 167
202 3300048912 Ga0496109_0648628 Ga0496109_0648628_14_517 167
203 3300048914 Ga0496111_0568912 Ga0496111_0568912_233_736 167
204 3300048915 Ga0496112_1030321 Ga0496112_1030321_58_561 167
205 3300050515 nmdc:mga0a205_538437_c1 nmdc:mga0a205_538437_c1_316_819 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03205

MobB

Molybdopterin guanine dinucleotide synthesis protein B

11

143

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6q93-assembly3.cif.gz_E mgadp-bound fe protein of vanadium nitrogenase from azotobacter vinelandii 0.9267 1 37
6q93-assembly1.cif.gz_B mgadp-bound fe protein of vanadium nitrogenase from azotobacter vinelandii 0.9235 1 37
1p9n-assembly1.cif.gz_B crystal structure of escherichia coli mobb. 0.9067 1 164
1np6-assembly1.cif.gz_A crystal structure of escherichia coli mobb 0.9066 1 164
6uyk-assembly2.cif.gz_C dark-operative protochlorophyllide oxidoreductase in the nucleotide-free form. 0.9004 2 37
ID Description Score Start End Superfamily
af_Q6PUR6_12_273_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.95 5 37 3.40.50.300
af_P32125_6_175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.942 1 164 3.40.50.300
af_A4I071_731_879_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9394 3 36 3.40.50.300
af_I1LLN3_330_536_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9315 4 37 3.40.50.300
af_P36590_1_207_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9272 2 37 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1B8S7X5-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9857 3 165 GO:0005525
GO:0006777
AF-A0A3D4DTB4-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9855 3 165 GO:0005525
GO:0006777
AF-A0A442X154-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.984 2 167 GO:0005525
GO:0006777
AF-A0A7I8ED59-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein MobB 0.9838 1 166 GO:0005525
GO:0006777
AF-A0A2E2YGX8-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9834 3 166 GO:0005525
GO:0006777

Feature Viewer

pLDDT pTM Quality
93.31 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map