F313407

General Info

Members Datasets Scaffolds Average Seq Length
205 155 410 365

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10044481|Ga0070677_100444812
Length 424
Sequence MTRLCCQFESLGVGPQPPIAMADQYAAVGIADIGRRRGRDRSTRGAGSIMAGVTTLKETLDRHTKIVSDLAQPLGDGRIRCLACGHRCPIPPGAVGVCKVRGNRDGALYAPWGYVGGVQCDPVEKKPFFHVVPGALAYSFGMLGCDLHCGYCQNWVTSQAIRDPRAVSPPEAATPESLVADAVAHGARLLVSTYNEPLITAEWAVEIFDVARRAGLLTGFVSNGNGTPEVLRFLRPHIDVYKVDLKSFDDRHYRELGGRLAPILDTIQALHASGVWIEIVTLVIEGFNDSDAELAKLASFVAGVSRDIPWHVTAFHGDYRMRDRHDTTADMLVRAATIGRDQGLRFVYAGNRPGRVGSLEDTHCTACGMLLVGRDGYLIRSYSITAQGTCPSCAAPVPGRFDRAFAPQLISRPFVPLSGLRSRP

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
81 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
82 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
83 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
84 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
85 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
88 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
89 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
100 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
103 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
104 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
115 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 0
Rhizoplane 5.85
Rhizosphere 90.24
Stem 0
Stem Tuber 0
Unclassified 2.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10044481 3300005333 Bacteria 1767
2 Ga0065712_10000156 3300005290 Bacteria 37789
3 Ga0065707_10006711 3300005295 Bacteria 3411
4 Ga0070676_10039194 3300005328 Bacteria 2739
5 Ga0070676_10069671 3300005328 Bacteria 2108
6 Ga0070670_100045773 3300005331 Bacteria 3761
7 Ga0070682_100000003 3300005337 Bacteria 469319
8 Ga0070669_100013360 3300005353 Bacteria 5837
9 Ga0070669_100285058 3300005353 Bacteria 1324
10 Ga0070675_100108939 3300005354 Bacteria 2340
11 Ga0070688_100137133 3300005365 Bacteria 1658
12 Ga0070713_100186145 3300005436 Bacteria 1869
13 Ga0070705_100017065 3300005440 Bacteria 3782
14 Ga0070694_100153494 3300005444 Bacteria 1683
15 Ga0070706_100247699 3300005467 Bacteria 1664
16 Ga0070698_100442523 3300005471 Bacteria 1235
17 Ga0070684_100075017 3300005535 Bacteria 2982
18 Ga0070697_100070877 3300005536 Bacteria 2858
19 Ga0070672_100013577 3300005543 Bacteria 5759
20 Ga0070686_100000477 3300005544 Bacteria 24252
21 Ga0070695_100001641 3300005545 Bacteria 12568
22 Ga0070696_100030018 3300005546 Bacteria 3719
23 Ga0070665_100025784 3300005548 Bacteria 5921
24 Ga0070704_100008875 3300005549 Bacteria 6052
25 Ga0068854_100084570 3300005578 Bacteria 2348
26 Ga0070702_100031605 3300005615 Bacteria 2899
27 Ga0068859_100012679 3300005617 Bacteria 8475
28 Ga0068864_100018370 3300005618 Bacteria 5842
29 Ga0068861_100042189 3300005719 Bacteria 3419
30 Ga0068863_100397241 3300005841 Bacteria 1348
31 Ga0075364_10007440 3300006051 Bacteria 6504
32 Ga0075362_10013647 3300006177 Bacteria 3258
33 Ga0075367_10032359 3300006178 Bacteria 3009
34 Ga0097621_100096324 3300006237 Bacteria 2483
35 Ga0075370_10002913 3300006353 Bacteria 8037
36 Ga0068871_100297918 3300006358 Bacteria 1415
37 Ga0075428_100000517 3300006844 Bacteria 39188
38 Ga0075428_100054668 3300006844 Bacteria 4375
39 Ga0075430_100192949 3300006846 Bacteria 1693
40 Ga0075431_100002106 3300006847 Bacteria 19009
41 Ga0075431_100113419 3300006847 Bacteria 2798
42 Ga0075434_100000907 3300006871 Bacteria 23753
43 Ga0075429_100000788 3300006880 Bacteria 24947
44 Ga0068865_100035915 3300006881 Bacteria 3337
45 Ga0068865_100147039 3300006881 Bacteria 1783
46 Ga0075436_100045646 3300006914 Bacteria 3023
47 Ga0097620_100012679 3300006931 Bacteria 8475
48 Ga0075435_100000083 3300007076 Bacteria 49520
49 Ga0105240_10147229 3300009093 Bacteria 2809
50 Ga0111539_10006917 3300009094 Bacteria 14565
51 Ga0111539_10312288 3300009094 Bacteria 1830
52 Ga0114129_10071925 3300009147 Unclassified 4822
53 Ga0105243_10028699 3300009148 Bacteria 4273
54 Ga0105242_10191455 3300009176 Bacteria 1811
55 Ga0105242_10379934 3300009176 Bacteria 1313
56 Ga0105248_10193290 3300009177 Bacteria 2293
57 Ga0105248_10418470 3300009177 Bacteria 1509
58 Ga0105249_10107723 3300009553 Bacteria 2630
59 Ga0105246_10031604 3300011119 Bacteria 3504
60 Ga0157374_10495890 3300013296 Bacteria 1225
61 Ga0157375_10107958 3300013308 Bacteria 2877
62 Ga0163163_10065680 3300014325 Bacteria 3603
63 Ga0157379_10402776 3300014968 Bacteria 1258
64 Ga0157376_10018451 3300014969 Bacteria 5349
65 Ga0157376_10234175 3300014969 Bacteria 1707
66 Ga0163161_10005969 3300017792 Bacteria 8443
67 Ga0207680_10013268 3300025903 Bacteria 4227
68 Ga0207645_10007848 3300025907 Bacteria 7506
69 Ga0207645_10038252 3300025907 Bacteria 3077
70 Ga0207663_10039230 3300025916 Bacteria 2868
71 Ga0207681_10009706 3300025923 Bacteria 5892
72 Ga0207681_10030426 3300025923 Bacteria 3520
73 Ga0207659_10039508 3300025926 Bacteria 3292
74 Ga0207659_10061004 3300025926 Bacteria 2716
75 Ga0207704_10108850 3300025938 Bacteria 1867
76 Ga0207665_10066997 3300025939 Bacteria 2444
77 Ga0207691_10082709 3300025940 Bacteria 2883
78 Ga0207711_10044986 3300025941 Bacteria 3771
79 Ga0207689_10020230 3300025942 Bacteria 5606
80 Ga0207661_10217571 3300025944 Bacteria 1687
81 Ga0207651_10277264 3300025960 Bacteria 1384
82 Ga0207703_10453654 3300026035 Bacteria 1198
83 Ga0207708_10009994 3300026075 Bacteria 7046
84 Ga0207708_10067936 3300026075 Bacteria 2727
85 Ga0207641_10397883 3300026088 Bacteria 1322
86 Ga0207648_10018826 3300026089 Bacteria 6241
87 Ga0207676_10142233 3300026095 Bacteria 2055
88 Ga0207674_10439009 3300026116 Bacteria 1262
89 Ga0207675_100006665 3300026118 Bacteria 10926
90 Ga0207675_100014438 3300026118 Bacteria 7364
91 Ga0207675_100069257 3300026118 Bacteria 3297
92 Ga0207675_100083771 3300026118 Bacteria 2991
93 Ga0207698_10165738 3300026142 Bacteria 1939
94 Ga0207428_10009383 3300027907 Bacteria 8776
95 Ga0207428_10052415 3300027907 Unclassified 3258
96 Ga0268265_10042473 3300028380 Bacteria 3374
97 Ga0268265_10136388 3300028380 Bacteria 2048
98 Ga0265337_1002305 3300028556 Bacteria 8861
99 Ga0265337_1015752 3300028556 Bacteria 2464
100 Ga0265319_1000837 3300028563 Bacteria 19625
101 Ga0265319_1008983 3300028563 Bacteria 4314
102 Ga0265334_10001344 3300028573 Bacteria 11890
103 Ga0265318_10004789 3300028577 Bacteria 6480
104 Ga0265323_10000330 3300028653 Bacteria 27095
105 Ga0265323_10002009 3300028653 Bacteria 9595
106 Ga0265323_10012023 3300028653 Unclassified 3478
107 Ga0265322_10001091 3300028654 Bacteria 9370
108 Ga0265322_10040981 3300028654 Bacteria 1318
109 Ga0265338_10003296 3300028800 Bacteria 22901
110 Ga0265338_10004062 3300028800 Bacteria 20062
111 Ga0265338_10008415 3300028800 Bacteria 12529
112 Ga0265324_10001676 3300029957 Bacteria 12223
113 Ga0265324_10006882 3300029957 Bacteria 4685
114 Ga0265330_10001691 3300031235 Bacteria 12485
115 Ga0265332_10003178 3300031238 Bacteria 7996
116 Ga0265332_10004595 3300031238 Bacteria 6458
117 Ga0265325_10034473 3300031241 Bacteria 2692
118 Ga0265329_10010165 3300031242 Bacteria 3471
119 Ga0265329_10026473 3300031242 Bacteria 1910
120 Ga0265340_10025891 3300031247 Bacteria 2968
121 Ga0265339_10002853 3300031249 Bacteria 12265
122 Ga0265339_10114620 3300031249 Bacteria 1391
123 Ga0265331_10014495 3300031250 Unclassified 4197
124 Ga0265331_10033498 3300031250 Bacteria 2539
125 Ga0265316_10009798 3300031344 Bacteria 8796
126 Ga0265316_10011585 3300031344 Bacteria 7943
127 Ga0265316_10034738 3300031344 Bacteria 4094
128 Ga0265316_10037789 3300031344 Bacteria 3893
129 Ga0265313_10001706 3300031595 Bacteria 20234
130 Ga0265314_10001542 3300031711 Bacteria 25410
131 Ga0265314_10073481 3300031711 Bacteria 2280
132 Ga0265342_10003212 3300031712 Bacteria 13582
133 Ga0265342_10008346 3300031712 Bacteria 7439
134 Ga0265342_10019709 3300031712 Bacteria 4341
135 Ga0265342_10090815 3300031712 Bacteria 1751
136 Ga0373948_0002402 3300034817 Bacteria 2761
137 Ga0373949_0000766 3300035090 Bacteria 10357
138 Ga0373932_0005844 3300035112 Bacteria 2897
139 Ga0373939_0000773 3300035114 Bacteria 7889
140 Ga0373941_0000702 3300035115 Bacteria 6841
141 Ga0373960_0003120 3300035121 Bacteria 3742
142 Ga0373946_0001736 3300035171 Bacteria 7601
143 Ga0373942_0003032 3300035207 Bacteria 3977
144 Ga0373961_0001342 3300035241 Bacteria 7392
145 Ga0373962_0001856 3300035242 Bacteria 5034
146 Ga0373931_0000879 3300035691 Bacteria 12678
147 Ga0373947_0031653 3300035725 Bacteria 3115
148 Ga0373947_0039027 3300035725 Bacteria 2824
149 Ga0316584_0007886 3300036712 Bacteria 7307
150 Ga0373925_0000037 3300037068 Bacteria 143020
151 Ga0436365_0069897 3300039437 Bacteria 2283
152 Ga0439435_0044931 3300042436 Bacteria 1247
153 Ga0439460_0015062 3300042461 Bacteria 2041
154 Ga0451577_0055423 3300042876 Bacteria 3537
155 Ga0453684_0036234 3300044712 Bacteria 6801
156 Ga0453684_0363563 3300044712 Bacteria 1628
157 Ga0453684_0528614 3300044712 Bacteria 1302
158 Ga0451576_0020242 3300045051 Bacteria 7247
159 Ga0451576_0020728 3300045051 Bacteria 7155
160 Ga0451576_0122286 3300045051 Bacteria 2710
161 Ga0466958_0084789 3300045836 Bacteria 1954
162 Ga0495629_0000001 3300046459 Bacteria 807972
163 Ga0495639_0000054 3300046475 Bacteria 50497
164 Ga0495628_0306626 3300046516 Bacteria 1174
165 Ga0495630_0049423 3300046517 Bacteria 3148
166 Ga0495666_0000001 3300046526 Bacteria 147374
167 Ga0495586_0000007 3300046535 Bacteria 153732
168 Ga0495645_0050094 3300046543 Bacteria 3041
169 Ga0495622_0010043 3300046557 Bacteria 4379
170 Ga0495647_0004480 3300046681 Bacteria 4541
171 Ga0495658_0005736 3300046683 Bacteria 6100
172 Ga0495658_0026796 3300046683 Bacteria 3094
173 Ga0495581_0050580 3300047315 Bacteria 2400
174 Ga0495672_0000327 3300047320 Bacteria 62456
175 Ga0495676_0004666 3300047321 Bacteria 12547
176 Ga0496101_0038412 3300048904 Bacteria 3401
177 Ga0496102_0299700 3300048905 Bacteria 1515
178 Ga0496104_0027085 3300048907 Bacteria 5301
179 Ga0496105_0131751 3300048908 Bacteria 2061
180 Ga0496106_0106869 3300048909 Bacteria 2176
181 Ga0496108_0020778 3300048911 Bacteria 5397
182 Ga0496109_0001763 3300048912 Bacteria 17979
183 Ga0496110_0043201 3300048913 Bacteria 3935
184 Ga0496111_0011062 3300048914 Bacteria 6074
185 Ga0496112_0001651 3300048915 Bacteria 17324
186 Ga0496114_0056289 3300048917 Bacteria 3281
187 Ga0496114_0201998 3300048917 Bacteria 1741
188 Ga0501072_0244432 3300049588 Bacteria 1430
189 Ga0501075_0145639 3300049591 Bacteria 1805
190 nmdc:mga03683_4465_c1 3300050489 Bacteria 4647
191 nmdc:mga0yw44_54463_c2 3300050492 Bacteria 2030
192 nmdc:mga09592_161_c1 3300050508 Bacteria 46835
193 nmdc:mga0qj67_198270_c1 3300050509 Bacteria 1631
194 nmdc:mga06r32_15138_c1 3300050510 Bacteria 7004
195 nmdc:mga06r32_193991_c1 3300050510 Bacteria 2018
196 nmdc:mga06r32_289006_c1 3300050510 Bacteria 1626
197 nmdc:mga08y16_22440_c1 3300050511 Bacteria 6662
198 nmdc:mga08y16_4184_c1 3300050511 Bacteria 15075
199 nmdc:mga08y16_59166_c1 3300050511 Unclassified 4003
200 nmdc:mga0n895_7_c1 3300050512 Bacteria 121855
201 nmdc:mga0rr50_2554_c1 3300050513 Bacteria 10311
202 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
203 nmdc:mga08x19_263_c1 3300050514 Bacteria 39779
204 nmdc:mga08x19_69872_c1 3300050514 Bacteria 2288
205 Ga0500566_0049875 3300053094 Unclassified 2398
206 Ga0070677_10044481
207 Ga0065712_10000156
208 Ga0065707_10006711
209 Ga0070676_10039194
210 Ga0070676_10069671
211 Ga0070670_100045773
212 Ga0070682_100000003
213 Ga0070669_100013360
214 Ga0070669_100285058
215 Ga0070675_100108939
216 Ga0070688_100137133
217 Ga0070713_100186145
218 Ga0070705_100017065
219 Ga0070694_100153494
220 Ga0070706_100247699
221 Ga0070698_100442523
222 Ga0070684_100075017
223 Ga0070697_100070877
224 Ga0070672_100013577
225 Ga0070686_100000477
226 Ga0070695_100001641
227 Ga0070696_100030018
228 Ga0070665_100025784
229 Ga0070704_100008875
230 Ga0068854_100084570
231 Ga0070702_100031605
232 Ga0068859_100012679
233 Ga0068864_100018370
234 Ga0068861_100042189
235 Ga0068863_100397241
236 Ga0075364_10007440
237 Ga0075362_10013647
238 Ga0075367_10032359
239 Ga0097621_100096324
240 Ga0075370_10002913
241 Ga0068871_100297918
242 Ga0075428_100000517
243 Ga0075428_100054668
244 Ga0075430_100192949
245 Ga0075431_100002106
246 Ga0075431_100113419
247 Ga0075434_100000907
248 Ga0075429_100000788
249 Ga0068865_100035915
250 Ga0068865_100147039
251 Ga0075436_100045646
252 Ga0097620_100012679
253 Ga0075435_100000083
254 Ga0105240_10147229
255 Ga0111539_10006917
256 Ga0111539_10312288
257 Ga0114129_10071925
258 Ga0105243_10028699
259 Ga0105242_10191455
260 Ga0105242_10379934
261 Ga0105248_10193290
262 Ga0105248_10418470
263 Ga0105249_10107723
264 Ga0105246_10031604
265 Ga0157374_10495890
266 Ga0157375_10107958
267 Ga0163163_10065680
268 Ga0157379_10402776
269 Ga0157376_10018451
270 Ga0157376_10234175
271 Ga0163161_10005969
272 Ga0207680_10013268
273 Ga0207645_10007848
274 Ga0207645_10038252
275 Ga0207663_10039230
276 Ga0207681_10009706
277 Ga0207681_10030426
278 Ga0207659_10039508
279 Ga0207659_10061004
280 Ga0207704_10108850
281 Ga0207665_10066997
282 Ga0207691_10082709
283 Ga0207711_10044986
284 Ga0207689_10020230
285 Ga0207661_10217571
286 Ga0207651_10277264
287 Ga0207703_10453654
288 Ga0207708_10009994
289 Ga0207708_10067936
290 Ga0207641_10397883
291 Ga0207648_10018826
292 Ga0207676_10142233
293 Ga0207674_10439009
294 Ga0207675_100006665
295 Ga0207675_100014438
296 Ga0207675_100069257
297 Ga0207675_100083771
298 Ga0207698_10165738
299 Ga0207428_10009383
300 Ga0207428_10052415
301 Ga0268265_10042473
302 Ga0268265_10136388
303 Ga0265337_1002305
304 Ga0265337_1015752
305 Ga0265319_1000837
306 Ga0265319_1008983
307 Ga0265334_10001344
308 Ga0265318_10004789
309 Ga0265323_10000330
310 Ga0265323_10002009
311 Ga0265323_10012023
312 Ga0265322_10001091
313 Ga0265322_10040981
314 Ga0265338_10003296
315 Ga0265338_10004062
316 Ga0265338_10008415
317 Ga0265324_10001676
318 Ga0265324_10006882
319 Ga0265330_10001691
320 Ga0265332_10003178
321 Ga0265332_10004595
322 Ga0265325_10034473
323 Ga0265329_10010165
324 Ga0265329_10026473
325 Ga0265340_10025891
326 Ga0265339_10002853
327 Ga0265339_10114620
328 Ga0265331_10014495
329 Ga0265331_10033498
330 Ga0265316_10009798
331 Ga0265316_10011585
332 Ga0265316_10034738
333 Ga0265316_10037789
334 Ga0265313_10001706
335 Ga0265314_10001542
336 Ga0265314_10073481
337 Ga0265342_10003212
338 Ga0265342_10008346
339 Ga0265342_10019709
340 Ga0265342_10090815
341 Ga0373948_0002402
342 Ga0373949_0000766
343 Ga0373932_0005844
344 Ga0373939_0000773
345 Ga0373941_0000702
346 Ga0373960_0003120
347 Ga0373946_0001736
348 Ga0373942_0003032
349 Ga0373961_0001342
350 Ga0373962_0001856
351 Ga0373931_0000879
352 Ga0373947_0031653
353 Ga0373947_0039027
354 Ga0316584_0007886
355 Ga0373925_0000037
356 Ga0436365_0069897
357 Ga0439435_0044931
358 Ga0439460_0015062
359 Ga0451577_0055423
360 Ga0453684_0036234
361 Ga0453684_0363563
362 Ga0453684_0528614
363 Ga0451576_0020242
364 Ga0451576_0020728
365 Ga0451576_0122286
366 Ga0466958_0084789
367 Ga0495629_0000001
368 Ga0495639_0000054
369 Ga0495628_0306626
370 Ga0495630_0049423
371 Ga0495666_0000001
372 Ga0495586_0000007
373 Ga0495645_0050094
374 Ga0495622_0010043
375 Ga0495647_0004480
376 Ga0495658_0005736
377 Ga0495658_0026796
378 Ga0495581_0050580
379 Ga0495672_0000327
380 Ga0495676_0004666
381 Ga0496101_0038412
382 Ga0496102_0299700
383 Ga0496104_0027085
384 Ga0496105_0131751
385 Ga0496106_0106869
386 Ga0496108_0020778
387 Ga0496109_0001763
388 Ga0496110_0043201
389 Ga0496111_0011062
390 Ga0496112_0001651
391 Ga0496114_0056289
392 Ga0496114_0201998
393 Ga0501072_0244432
394 Ga0501075_0145639
395 nmdc:mga03683_4465_c1
396 nmdc:mga0yw44_54463_c2
397 nmdc:mga09592_161_c1
398 nmdc:mga0qj67_198270_c1
399 nmdc:mga06r32_15138_c1
400 nmdc:mga06r32_193991_c1
401 nmdc:mga06r32_289006_c1
402 nmdc:mga08y16_22440_c1
403 nmdc:mga08y16_4184_c1
404 nmdc:mga08y16_59166_c1
405 nmdc:mga0n895_7_c1
406 nmdc:mga0rr50_2554_c1
407 nmdc:mga0rr50_3_c1
408 nmdc:mga08x19_263_c1
409 nmdc:mga08x19_69872_c1
410 Ga0500566_0049875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

141

298

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3can-assembly1.cif.gz_A-2 crystal structure of a domain of pyruvate-formate lyase-activating enzyme from bacteroides vulgatus atcc 8482 0.9064 137 297
3can-assembly1.cif.gz_A-2 crystal structure of a domain of pyruvate-formate lyase-activating enzyme from bacteroides vulgatus atcc 8482 0.8799 137 297
7bi7-assembly2.cif.gz_B an unexpected p-cluster like intermediate en route to the nitrogenase femo-co 0.8385 117 293
7jma-assembly1.cif.gz_A crystal structure of the apo form of nitrogenase iron-molybdenum cofactor biosynthesis enzyme nifb from methanothermobacter thermautotrophicus 0.8367 118 294
3cb8-assembly1.cif.gz_A 4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate 0.8156 59 294
ID Description Score Start End Superfamily
af_Q58218_60_281_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9065 69 294 3.20.20.70
af_P95188_67_289_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9032 71 293 3.20.20.70
af_Q58218_60_281_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9026 69 294 3.20.20.70
3canA00 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;pyruvate-formate lyase- activating enzyme 0.8998 137 297 3.80.30.10
af_P95188_67_289_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8993 71 293 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3D4FWP4-F1-model_v4 AmmeMemoRadiSam system radical SAM enzyme 0.9887 120 322 GO:0003824
GO:0046872
GO:0051539
AF-A0A2V7KAU5-F1-model_v4 AmmeMemoRadiSam system radical SAM enzyme 0.9876 119 328 GO:0003824
GO:0046872
GO:0051539
AF-A0A3N5UC18-F1-model_v4 Radical SAM core domain-containing protein 0.9868 178 331 GO:0046872
GO:0051539
AF-A0A2V8GKW0-F1-model_v4 AmmeMemoRadiSam system radical SAM enzyme 0.9855 145 332 GO:0003824
GO:0046872
GO:0051539
AF-A0A3D4FWP4-F1-model_v4 AmmeMemoRadiSam system radical SAM enzyme 0.9744 120 322 GO:0003824
GO:0046872
GO:0051539

Map