F313294

General Info

Members Datasets Scaffolds Average Seq Length
205 174 410 275

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10000756|JGI25153J46596_100007564
Length 273
Sequence MNRIDGKYAVITGGTQGLGAAIARLFAKAGAVGIVTCGRNREKGDAVASSITEETGVPVTFVQADLSQVSDCRNVIASAEMAVGRIDILVNAAGLTDRGNLLNSTQDLFDRMFAINVRAPFFLMQEAAKLMIRDSVRGSMINIGSTSEHAGQPFLAPYSASKGALATLTRNSGYALMRNQIRVNQLDIGWMASDGEDRIQRDYHGADSDWLAKAAAAQPFGRILAPEEVARAVLFLASDDSGMMTGSVVHFDQSVWGAYDGGPPAPATALSER

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
49 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
105 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
143 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
144 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
149 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
150 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
151 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
152 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 2508501050 Microvirga lupini Lut6 Isolate Nodule
155 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
156 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
157 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
158 2643221558 Rhizobium sp. Root149 Isolate Unclassified
159 2643221582 Rhizobium sp. Root651 Isolate Unclassified
160 2773857925 Microvirga vignae BR3299 Isolate Unclassified
161 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
162 2791355262 Rhizobium sp. M1 Isolate Nodule
163 2791355267 Rhizobium sp. L18 Isolate Nodule
164 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
165 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
166 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
167 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
168 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
169 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
170 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
171 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
172 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
173 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
174 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.76
Metatranscriptomes 0
Isolates 10.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.12
Nodule 5.85
Rhizoplane 3.9
Rhizosphere 67.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000756 3300003215 Bacteria 19789
2 Ga0055540_1000384 3300003792 Bacteria 36797
3 Ga0070690_100229203 3300005330 Bacteria 1305
4 Ga0070668_100191119 3300005347 Bacteria 1677
5 Ga0070674_100037993 3300005356 Bacteria 3242
6 Ga0070688_100123419 3300005365 Bacteria 1738
7 Ga0070659_100190205 3300005366 Bacteria 1687
8 Ga0070700_100041241 3300005441 Bacteria 2829
9 Ga0070694_100264733 3300005444 Bacteria 1305
10 Ga0070694_100358182 3300005444 Bacteria 1132
11 Ga0068867_100064796 3300005459 Bacteria 2717
12 Ga0068853_100031046 3300005539 Bacteria 4517
13 Ga0068853_100119003 3300005539 Bacteria 2354
14 Ga0070695_100154035 3300005545 Bacteria 1607
15 Ga0070696_100044985 3300005546 Bacteria 3058
16 Ga0070665_100039428 3300005548 Bacteria 4749
17 Ga0068855_100238691 3300005563 Bacteria 2032
18 Ga0070664_100222183 3300005564 Bacteria 1690
19 Ga0068858_100567680 3300005842 Bacteria 1099
20 Ga0068860_100660874 3300005843 Bacteria 1053
21 Ga0068862_100549958 3300005844 Bacteria 1102
22 Ga0075365_10185603 3300006038 Bacteria 1455
23 Ga0075368_10006677 3300006042 Bacteria 4046
24 Ga0075363_100037384 3300006048 Bacteria 2550
25 Ga0075363_100040364 3300006048 Bacteria 2460
26 Ga0075364_10005164 3300006051 Bacteria 7571
27 Ga0075367_10068021 3300006178 Bacteria 2136
28 Ga0075367_10178021 3300006178 Bacteria 1325
29 Ga0075370_10004915 3300006353 Bacteria 6565
30 Ga0075430_100385961 3300006846 Bacteria 1156
31 Ga0075433_10162425 3300006852 Bacteria 1988
32 Ga0075434_100545757 3300006871 Bacteria 1179
33 Ga0068865_100224588 3300006881 Bacteria 1470
34 Ga0099794_10041471 3300007265 Bacteria 2192
35 Ga0105240_10019289 3300009093 Bacteria 9115
36 Ga0105240_10114335 3300009093 Bacteria 3260
37 Ga0114129_10174327 3300009147 Bacteria 2930
38 Ga0105243_10377540 3300009148 Bacteria 1310
39 Ga0105241_10059495 3300009174 Bacteria 2938
40 Ga0105242_10052535 3300009176 Bacteria 3325
41 Ga0105248_10418751 3300009177 Bacteria 1508
42 Ga0105237_10097353 3300009545 Bacteria 2932
43 Ga0105238_10174819 3300009551 Bacteria 2124
44 Ga0105238_10247161 3300009551 Bacteria 1762
45 Ga0105249_10361682 3300009553 Bacteria 1473
46 Ga0123342_1006381 3300009766 Bacteria 16408
47 Ga0105239_10143814 3300010375 Bacteria 2658
48 Ga0157369_10049716 3300013105 Bacteria 4544
49 Ga0157375_10274641 3300013308 Bacteria 1847
50 Ga0157380_10098029 3300014326 Bacteria 2434
51 Ga0157380_10143008 3300014326 Bacteria 2058
52 Ga0157379_10090764 3300014968 Bacteria 2741
53 Ga0213872_10064039 3300021361 Bacteria 1661
54 Ga0213872_10073982 3300021361 Bacteria 1534
55 Ga0213876_10043875 3300021384 Bacteria 2363
56 Ga0213871_10001696 3300021441 Bacteria 3803
57 Ga0213871_10010124 3300021441 Bacteria 2131
58 Ga0209646_1009379 3300025246 Bacteria 1555
59 Ga0209673_1002071 3300025273 Bacteria 15086
60 Ga0209025_1048404 3300025294 Bacteria 1724
61 Ga0209758_1000793 3300025297 Bacteria 44917
62 Ga0209758_1001268 3300025297 Bacteria 31270
63 Ga0209758_1038510 3300025297 Bacteria 1833
64 Ga0209050_1012392 3300025298 Bacteria 3917
65 Ga0209051_1000166 3300025303 Bacteria 120265
66 Ga0209257_1008877 3300025304 Bacteria 5548
67 Ga0207647_10116394 3300025904 Bacteria 1578
68 Ga0207654_10077493 3300025911 Bacteria 1993
69 Ga0207671_10091641 3300025914 Bacteria 2290
70 Ga0207693_10135236 3300025915 Bacteria 1938
71 Ga0207663_10138036 3300025916 Bacteria 1695
72 Ga0207663_10210798 3300025916 Bacteria 1408
73 Ga0207662_10021168 3300025918 Bacteria 3713
74 Ga0207694_10305737 3300025924 Bacteria 1310
75 Ga0207659_10139954 3300025926 Bacteria 1878
76 Ga0207687_10076940 3300025927 Bacteria 2398
77 Ga0207690_10271283 3300025932 Bacteria 1318
78 Ga0207686_10101702 3300025934 Bacteria 1920
79 Ga0207670_10426799 3300025936 Bacteria 1065
80 Ga0207704_10357070 3300025938 Bacteria 1140
81 Ga0207711_10414555 3300025941 Bacteria 1252
82 Ga0207667_10294996 3300025949 Bacteria 1656
83 Ga0207712_10340353 3300025961 Bacteria 1244
84 Ga0207668_10401593 3300025972 Bacteria 1159
85 Ga0207677_10208084 3300026023 Bacteria 1560
86 Ga0207639_10165380 3300026041 Bacteria 1868
87 Ga0207708_10042011 3300026075 Bacteria 3486
88 Ga0207648_10020104 3300026089 Bacteria 6021
89 Ga0207648_10099859 3300026089 Bacteria 2542
90 Ga0207675_100396311 3300026118 Bacteria 1360
91 Ga0207683_10352800 3300026121 Bacteria 1350
92 Ga0209371_1003411 3300027312 Bacteria 7770
93 Ga0209588_1006365 3300027671 Bacteria 3429
94 Ga0268266_10204667 3300028379 Bacteria 1808
95 Ga0268265_10129216 3300028380 Bacteria 2096
96 Ga0307515_10000084 3300028794 Bacteria 221434
97 Ga0268256_1003100 3300030500 Bacteria 7770
98 Ga0265331_10051369 3300031250 Bacteria 1973
99 Ga0307513_10008207 3300031456 Bacteria 13394
100 Ga0307408_100162868 3300031548 Bacteria 1773
101 Ga0307508_10053111 3300031616 Bacteria 3598
102 Ga0307514_10000319 3300031649 Bacteria 115327
103 Ga0265314_10175898 3300031711 Bacteria 1287
104 Ga0307410_10136561 3300031852 Bacteria 1808
105 Ga0307406_10156466 3300031901 Bacteria 1633
106 Ga0307510_10168230 3300033180 Bacteria 1775
107 Ga0373927_0281832 3300035695 Bacteria 1093
108 Ga0373947_0138397 3300035725 Bacteria 1560
109 Ga0373937_0468516 3300036401 Bacteria 1196
110 Ga0373925_0353324 3300037068 Bacteria 1194
111 Ga0395900_0315305 3300037418 Bacteria 1546
112 Ga0395905_0053016 3300037471 Bacteria 3797
113 Ga0436364_0317401 3300037853 Bacteria 1817
114 Ga0436365_1334216 3300039437 Bacteria 2350
115 Ga0436360_0119048 3300039438 Bacteria 1181
116 Ga0436360_0294239 3300039438 Bacteria 3230
117 Ga0436360_0704126 3300039438 Bacteria 1389
118 Ga0436360_0963348 3300039438 Bacteria 8301
119 Ga0436360_1065807 3300039438 Bacteria 1968
120 Ga0436361_0357884 3300039447 Bacteria 5082
121 Ga0436361_0850146 3300039447 Bacteria 3114
122 Ga0436361_1039167 3300039447 Bacteria 3564
123 Ga0439443_001481 3300042003 Bacteria 2602
124 Ga0439460_0039812 3300042461 Bacteria 1375
125 Ga0453684_0009083 3300044712 Bacteria 17522
126 Ga0495638_0000785 3300046460 Bacteria 33482
127 Ga0495585_0026331 3300046492 Bacteria 3322
128 Ga0495616_0172891 3300046513 Bacteria 965
129 Ga0495631_0025238 3300046518 Bacteria 2739
130 Ga0495648_0066035 3300046524 Bacteria 2123
131 Ga0495668_0032789 3300046616 Bacteria 2920
132 Ga0495625_0004366 3300046660 Bacteria 13420
133 Ga0495625_0069946 3300046660 Bacteria 2465
134 Ga0495670_0146153 3300046691 Bacteria 1239
135 Ga0496102_0158153 3300048905 Bacteria 2131
136 Ga0496104_0070671 3300048907 Bacteria 3319
137 Ga0496106_0193177 3300048909 Bacteria 1619
138 Ga0496106_0257360 3300048909 Bacteria 1396
139 Ga0496110_0046828 3300048913 Bacteria 3784
140 Ga0496110_0092323 3300048913 Bacteria 2709
141 Ga0496111_0187383 3300048914 Bacteria 1538
142 Ga0496112_0043173 3300048915 Bacteria 4414
143 Ga0495682_0131810 3300049460 Bacteria 894
144 Ga0501031_0026673 3300049568 Bacteria 3766
145 Ga0501034_0000606 3300049571 Bacteria 56542
146 Ga0501034_0131354 3300049571 Bacteria 2487
147 Ga0501038_0160352 3300049574 Bacteria 1828
148 Ga0501039_0299131 3300049575 Bacteria 1265
149 Ga0501042_0165691 3300049578 Bacteria 1594
150 Ga0501043_0342998 3300049579 Bacteria 1136
151 Ga0501047_0104286 3300049581 Bacteria 2716
152 Ga0501048_0096357 3300049582 Bacteria 2087
153 Ga0501070_0061911 3300049586 Bacteria 3100
154 Ga0501070_0264481 3300049586 Bacteria 1405
155 Ga0501070_0294210 3300049586 Bacteria 1323
156 Ga0501071_0174338 3300049587 Bacteria 1610
157 Ga0501072_0191076 3300049588 Bacteria 1633
158 Ga0501073_0005227 3300049589 Bacteria 9731
159 Ga0501073_0100916 3300049589 Bacteria 2004
160 Ga0501073_0283477 3300049589 Bacteria 1143
161 Ga0501077_0242135 3300049593 Bacteria 1147
162 Ga0501079_0262392 3300049741 Bacteria 1350
163 Ga0501079_0316003 3300049741 Bacteria 1223
164 Ga0501080_0081945 3300049742 Bacteria 2997
165 Ga0501083_0101901 3300049744 Bacteria 1892
166 Ga0501035_0235780 3300049822 Bacteria 1558
167 nmdc:mga03n38_106654_c1 3300050490 Bacteria 1358
168 nmdc:mga03n38_29494_c1 3300050490 Bacteria 2297
169 nmdc:mga00v17_20007_c1 3300050491 Bacteria 3829
170 nmdc:mga0k408_256337_c1 3300050493 Bacteria 1044
171 nmdc:mga06z11_110973_c1 3300050494 Bacteria 1518
172 nmdc:mga06z11_49166_c1 3300050494 Bacteria 2150
173 nmdc:mga04h51_4163_c1 3300050495 Bacteria 3573
174 nmdc:mga07m45_91612_c1 3300050496 Bacteria 1742
175 nmdc:mga0qj67_311927_c1 3300050509 Bacteria 1274
176 nmdc:mga08y16_220235_c1 3300050511 Bacteria 1965
177 nmdc:mga0a205_249955_c1 3300050515 Bacteria 1653
178 Ga0500643_028310 3300053087 Bacteria 1735
179 Ga0500594_0003121 3300053118 Bacteria 3624
180 Ga0500618_000475 3300053125 Bacteria 25939
181 Ga0500627_0132638 3300053158 Bacteria 1125
182 Ga0500636_0015051 3300053177 Bacteria 4553
183 Ga0501084_0082919 3300054114 Bacteria 2691
184 Ga0501084_0154598 3300054114 Bacteria 1934
185 2508728862 2508501050 Bacteria 9633614
186 2509075732 2508501114 Bacteria 7082538
187 2585393683 2582581866 Bacteria 6859583
188 2617386578 2617270742 Bacteria 6808054
189 2643812182 2643221558 Bacteria 5460675
190 2643917002 2643221582 Bacteria 5804683
191 2774874340 2773857925 Bacteria 6472445
192 2776262033 2775506901 Bacteria 9631051
193 2793335261 2791355262 Bacteria 6774204
194 2793366320 2791355267 Bacteria 7222458
195 2835320005 2835312727 Bacteria 7413381
196 2841861664 2841859092 Bacteria 5436171
197 2842518070 2842515876 Bacteria 5436280
198 2882458486 2882456835 Bacteria 6863978
199 2884299038 2884298095 Bacteria 3823049
200 2894235611 2894232714 Bacteria 8834183
201 2933013699 2933011516 Bacteria 5439334
202 8003572908 8003570095 Bacteria 5747666
203 8018150769 8018150411 Bacteria 5549903
204 8056380031 8056375014 Bacteria 7006639
205 8057875926 8057874678 Bacteria 7494653
206 JGI25153J46596_10000756
207 Ga0055540_1000384
208 Ga0070690_100229203
209 Ga0070668_100191119
210 Ga0070674_100037993
211 Ga0070688_100123419
212 Ga0070659_100190205
213 Ga0070700_100041241
214 Ga0070694_100264733
215 Ga0070694_100358182
216 Ga0068867_100064796
217 Ga0068853_100031046
218 Ga0068853_100119003
219 Ga0070695_100154035
220 Ga0070696_100044985
221 Ga0070665_100039428
222 Ga0068855_100238691
223 Ga0070664_100222183
224 Ga0068858_100567680
225 Ga0068860_100660874
226 Ga0068862_100549958
227 Ga0075365_10185603
228 Ga0075368_10006677
229 Ga0075363_100037384
230 Ga0075363_100040364
231 Ga0075364_10005164
232 Ga0075367_10068021
233 Ga0075367_10178021
234 Ga0075370_10004915
235 Ga0075430_100385961
236 Ga0075433_10162425
237 Ga0075434_100545757
238 Ga0068865_100224588
239 Ga0099794_10041471
240 Ga0105240_10019289
241 Ga0105240_10114335
242 Ga0114129_10174327
243 Ga0105243_10377540
244 Ga0105241_10059495
245 Ga0105242_10052535
246 Ga0105248_10418751
247 Ga0105237_10097353
248 Ga0105238_10174819
249 Ga0105238_10247161
250 Ga0105249_10361682
251 Ga0123342_1006381
252 Ga0105239_10143814
253 Ga0157369_10049716
254 Ga0157375_10274641
255 Ga0157380_10098029
256 Ga0157380_10143008
257 Ga0157379_10090764
258 Ga0213872_10064039
259 Ga0213872_10073982
260 Ga0213876_10043875
261 Ga0213871_10001696
262 Ga0213871_10010124
263 Ga0209646_1009379
264 Ga0209673_1002071
265 Ga0209025_1048404
266 Ga0209758_1000793
267 Ga0209758_1001268
268 Ga0209758_1038510
269 Ga0209050_1012392
270 Ga0209051_1000166
271 Ga0209257_1008877
272 Ga0207647_10116394
273 Ga0207654_10077493
274 Ga0207671_10091641
275 Ga0207693_10135236
276 Ga0207663_10138036
277 Ga0207663_10210798
278 Ga0207662_10021168
279 Ga0207694_10305737
280 Ga0207659_10139954
281 Ga0207687_10076940
282 Ga0207690_10271283
283 Ga0207686_10101702
284 Ga0207670_10426799
285 Ga0207704_10357070
286 Ga0207711_10414555
287 Ga0207667_10294996
288 Ga0207712_10340353
289 Ga0207668_10401593
290 Ga0207677_10208084
291 Ga0207639_10165380
292 Ga0207708_10042011
293 Ga0207648_10020104
294 Ga0207648_10099859
295 Ga0207675_100396311
296 Ga0207683_10352800
297 Ga0209371_1003411
298 Ga0209588_1006365
299 Ga0268266_10204667
300 Ga0268265_10129216
301 Ga0307515_10000084
302 Ga0268256_1003100
303 Ga0265331_10051369
304 Ga0307513_10008207
305 Ga0307408_100162868
306 Ga0307508_10053111
307 Ga0307514_10000319
308 Ga0265314_10175898
309 Ga0307410_10136561
310 Ga0307406_10156466
311 Ga0307510_10168230
312 Ga0373927_0281832
313 Ga0373947_0138397
314 Ga0373937_0468516
315 Ga0373925_0353324
316 Ga0395900_0315305
317 Ga0395905_0053016
318 Ga0436364_0317401
319 Ga0436365_1334216
320 Ga0436360_0119048
321 Ga0436360_0294239
322 Ga0436360_0704126
323 Ga0436360_0963348
324 Ga0436360_1065807
325 Ga0436361_0357884
326 Ga0436361_0850146
327 Ga0436361_1039167
328 Ga0439443_001481
329 Ga0439460_0039812
330 Ga0453684_0009083
331 Ga0495638_0000785
332 Ga0495585_0026331
333 Ga0495616_0172891
334 Ga0495631_0025238
335 Ga0495648_0066035
336 Ga0495668_0032789
337 Ga0495625_0004366
338 Ga0495625_0069946
339 Ga0495670_0146153
340 Ga0496102_0158153
341 Ga0496104_0070671
342 Ga0496106_0193177
343 Ga0496106_0257360
344 Ga0496110_0046828
345 Ga0496110_0092323
346 Ga0496111_0187383
347 Ga0496112_0043173
348 Ga0495682_0131810
349 Ga0501031_0026673
350 Ga0501034_0000606
351 Ga0501034_0131354
352 Ga0501038_0160352
353 Ga0501039_0299131
354 Ga0501042_0165691
355 Ga0501043_0342998
356 Ga0501047_0104286
357 Ga0501048_0096357
358 Ga0501070_0061911
359 Ga0501070_0264481
360 Ga0501070_0294210
361 Ga0501071_0174338
362 Ga0501072_0191076
363 Ga0501073_0005227
364 Ga0501073_0100916
365 Ga0501073_0283477
366 Ga0501077_0242135
367 Ga0501079_0262392
368 Ga0501079_0316003
369 Ga0501080_0081945
370 Ga0501083_0101901
371 Ga0501035_0235780
372 nmdc:mga03n38_106654_c1
373 nmdc:mga03n38_29494_c1
374 nmdc:mga00v17_20007_c1
375 nmdc:mga0k408_256337_c1
376 nmdc:mga06z11_110973_c1
377 nmdc:mga06z11_49166_c1
378 nmdc:mga04h51_4163_c1
379 nmdc:mga07m45_91612_c1
380 nmdc:mga0qj67_311927_c1
381 nmdc:mga08y16_220235_c1
382 nmdc:mga0a205_249955_c1
383 Ga0500643_028310
384 Ga0500594_0003121
385 Ga0500618_000475
386 Ga0500627_0132638
387 Ga0500636_0015051
388 Ga0501084_0082919
389 Ga0501084_0154598
390 2508728862
391 2509075732
392 2585393683
393 2617386578
394 2643812182
395 2643917002
396 2774874340
397 2776262033
398 2793335261
399 2793366320
400 2835320005
401 2841861664
402 2842518070
403 2882458486
404 2884299038
405 2894235611
406 2933013699
407 8003572908
408 8018150769
409 8056380031
410 8057875926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

7

204

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

254

0.94

PF08659

KR

KR domain

6

192

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nim-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella melitensis 0.9832 3 270
4nim-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella melitensis 0.9751 3 270
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9495 4 252
4cql-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.9495 6 252
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9464 1 253
ID Description Score Start End Superfamily
4nimA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9832 3 270 3.40.50.720
4nimA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9751 3 270 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9464 1 253 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9458 2 189 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.945 93 192 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A837FTV3-F1-model_v4 deleted 0.9862 7 260
AF-A0A531MPV5-F1-model_v4 SDR family oxidoreductase 0.9783 117 260 GO:0016491
AF-A0A2E2PKQ3-F1-model_v4 Short-chain dehydrogenase 0.9775 7 260 GO:0016491
AF-A0A531MPV5-F1-model_v4 SDR family oxidoreductase 0.9587 117 260 GO:0016491
AF-X1JYA3-F1-model_v4 Uncharacterized protein 0.9557 3 169 GO:0016616

Map