F313226

General Info

Members Datasets Scaffolds Average Seq Length
204 147 199 227

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8002775197|8002782654
Length 276
Sequence LPVIRVLVADDHEVVRTGFAGILGSQPDITVVGTAADGAEAVRLCREQAPDVVLMDVRMPGMDGIEATRRLTRGTAGAGGSGRGIPGGGASGGGTSAGGNPSAGTSAGATGATGATGTRGAGDAAGGRPRVIILTTFDLDEYVYDAIRAGASGFLLKDVTAERLFDAVRVVAAGDALLAPTVTRRLIAEFATLRRPGTPPGTALAALTPRETEVLCLVAEGLSNPEIAARLTVTEETVKTHVSRMLTKLGLRDRTQAVVTAYETGLVVPRSHQRPS

Samples

Sample ID Description Type Environment
1 2687453737 Frankia sp. BMG5.36 Isolate Nodule
2 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
3 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
84 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
97 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
98 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
107 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
110 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
113 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
114 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
115 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
146 8002775197 Frankia nepalensis CN7 Isolate Nodule
147 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.55
Metatranscriptomes 0
Isolates 2.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.39
Nodule 0.98
Rhizoplane 8.33
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 1.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10013736 3300005327 Bacteria 6498
2 Ga0070683_100071427 3300005329 Bacteria 3239
3 Ga0068869_100206483 3300005334 Bacteria 1551
4 Ga0070680_100124907 3300005336 Bacteria 2150
5 Ga0070680_100170970 3300005336 Bacteria 1828
6 Ga0070709_10006598 3300005434 Bacteria 6330
7 Ga0070714_100068548 3300005435 Bacteria 3061
8 Ga0070714_100521933 3300005435 Bacteria 1135
9 Ga0070713_100646487 3300005436 Bacteria 1007
10 Ga0070710_10050851 3300005437 Bacteria 2325
11 Ga0070711_100028941 3300005439 Bacteria 3650
12 Ga0070705_100048254 3300005440 Bacteria 2466
13 Ga0070706_100019021 3300005467 Bacteria 6336
14 Ga0070706_100069041 3300005467 Bacteria 3269
15 Ga0070698_100003974 3300005471 Bacteria 16274
16 Ga0070698_100120569 3300005471 Bacteria 2583
17 Ga0070684_100209284 3300005535 Bacteria 1777
18 Ga0070695_100020943 3300005545 Bacteria 3997
19 Ga0070695_100197882 3300005545 Bacteria 1434
20 Ga0068855_100399150 3300005563 Bacteria 1507
21 Ga0068856_100259577 3300005614 Bacteria 1753
22 Ga0068859_100329389 3300005617 Bacteria 1621
23 Ga0068864_101107548 3300005618 Bacteria 788
24 Ga0081455_10001836 3300005937 Bacteria 25562
25 Ga0081455_10002459 3300005937 Bacteria 22060
26 Ga0081455_10013352 3300005937 Bacteria 8125
27 Ga0081539_10014627 3300005985 Bacteria 5780
28 Ga0081539_10016448 3300005985 Bacteria 5282
29 Ga0075365_10023433 3300006038 Bacteria 3883
30 Ga0075365_10048717 3300006038 Bacteria 2790
31 Ga0075365_10460966 3300006038 Bacteria 898
32 Ga0075368_10075716 3300006042 Bacteria 1365
33 Ga0075363_100039142 3300006048 Bacteria 2494
34 Ga0075364_10010102 3300006051 Bacteria 5692
35 Ga0070716_100138819 3300006173 Bacteria 1547
36 Ga0075367_10025294 3300006178 Bacteria 3357
37 Ga0075428_100060015 3300006844 Bacteria 4165
38 Ga0075428_100115080 3300006844 Bacteria 2929
39 Ga0075428_100129239 3300006844 Bacteria 2749
40 Ga0075428_100181671 3300006844 Bacteria 2276
41 Ga0075430_100061584 3300006846 Bacteria 3153
42 Ga0097620_100329401 3300006931 Bacteria 1621
43 Ga0111539_10037654 3300009094 Bacteria 5840
44 Ga0105245_10042992 3300009098 Bacteria 4031
45 Ga0105245_10366547 3300009098 Bacteria 1431
46 Ga0105245_10530738 3300009098 Bacteria 1197
47 Ga0114129_10048626 3300009147 Bacteria 5959
48 Ga0114129_10549483 3300009147 Bacteria 1502
49 Ga0105248_10097895 3300009177 Bacteria 3305
50 Ga0105248_11415167 3300009177 Bacteria 787
51 Ga0105237_10738030 3300009545 Bacteria 991
52 Ga0105249_10045372 3300009553 Bacteria 3997
53 Ga0105239_10313717 3300010375 Bacteria 1767
54 Ga0157369_10021127 3300013105 Bacteria 7278
55 Ga0157369_10517390 3300013105 Bacteria 1234
56 Ga0157378_10357204 3300013297 Bacteria 1429
57 Ga0157379_10179463 3300014968 Bacteria 1913
58 Ga0157376_10060345 3300014969 Bacteria 3184
59 Ga0207692_10112709 3300025898 Bacteria 1511
60 Ga0207699_10020012 3300025906 Bacteria 3580
61 Ga0207705_10028953 3300025909 Bacteria 3950
62 Ga0207684_10000428 3300025910 Bacteria 55836
63 Ga0207707_10092557 3300025912 Bacteria 2642
64 Ga0207693_10297960 3300025915 Bacteria 1263
65 Ga0207663_10014350 3300025916 Bacteria 4333
66 Ga0207657_10071439 3300025919 Bacteria 2939
67 Ga0207649_10127470 3300025920 Bacteria 1724
68 Ga0207652_10446292 3300025921 Bacteria 1166
69 Ga0207646_10336647 3300025922 Bacteria 1363
70 Ga0207687_10035618 3300025927 Bacteria 3386
71 Ga0207687_10220217 3300025927 Bacteria 1494
72 Ga0207687_10353095 3300025927 Bacteria 1198
73 Ga0207700_10032549 3300025928 Bacteria 3720
74 Ga0207664_10104989 3300025929 Bacteria 2340
75 Ga0207665_10150276 3300025939 Bacteria 1668
76 Ga0207711_10503732 3300025941 Bacteria 1129
77 Ga0207689_10215262 3300025942 Bacteria 1587
78 Ga0207689_10585322 3300025942 Bacteria 938
79 Ga0207661_10024109 3300025944 Bacteria 4605
80 Ga0207712_10936283 3300025961 Bacteria 767
81 Ga0207668_10214126 3300025972 Bacteria 1543
82 Ga0207428_10048938 3300027907 Bacteria 3389
83 Ga0207428_10199845 3300027907 Bacteria 1504
84 Ga0265338_10004214 3300028800 Bacteria 19598
85 Ga0265338_10008152 3300028800 Bacteria 12785
86 Ga0265328_10035359 3300031239 Bacteria 1848
87 Ga0307516_10048610 3300031730 Bacteria 4174
88 Ga0307405_10000703 3300031731 Bacteria 12993
89 Ga0307410_10035378 3300031852 Bacteria 3243
90 Ga0307410_10244540 3300031852 Bacteria 1392
91 Ga0326468_10000394 3300031889 Bacteria 4615
92 Ga0307406_10001772 3300031901 Bacteria 11801
93 Ga0307406_10215374 3300031901 Bacteria 1424
94 Ga0307407_10014971 3300031903 Bacteria 3815
95 Ga0307407_10109625 3300031903 Bacteria 1731
96 Ga0307409_100004753 3300031995 Bacteria 7696
97 Ga0307409_100615669 3300031995 Bacteria 1075
98 Ga0307416_100008483 3300032002 Bacteria 6636
99 Ga0307411_10185904 3300032005 Bacteria 1582
100 Ga0307415_100014155 3300032126 Bacteria 4680
101 Ga0307415_100040301 3300032126 Bacteria 3093
102 Ga0307415_100088232 3300032126 Bacteria 2237
103 Ga0307415_100315067 3300032126 Bacteria 1302
104 Ga0307415_100758060 3300032126 Bacteria 882
105 Ga0373936_0033114 3300035113 Bacteria 2047
106 Ga0373935_0004006 3300035692 Bacteria 8604
107 Ga0373935_0219518 3300035692 Bacteria 1320
108 Ga0373947_0101839 3300035725 Bacteria 1806
109 Ga0316582_0126225 3300036647 Bacteria 1715
110 Ga0373925_0327903 3300037068 Bacteria 1240
111 Ga0395898_0536355 3300037466 Bacteria 1112
112 Ga0400485_17369 3300038735 Bacteria 2109
113 Ga0436360_1174333 3300039438 Bacteria 1384
114 Ga0436360_1321289 3300039438 Bacteria 1167
115 Ga0466969_0003142 3300044656 Bacteria 8796
116 Ga0466969_0112017 3300044656 Bacteria 1276
117 Ga0466961_0034685 3300044693 Bacteria 3239
118 Ga0466961_0506586 3300044693 Bacteria 729
119 Ga0466970_0048232 3300044765 Bacteria 2270
120 Ga0466960_0022574 3300044901 Bacteria 2815
121 Ga0466959_0168965 3300045049 Bacteria 1534
122 Ga0466958_0138925 3300045836 Bacteria 1529
123 Ga0495603_0001818 3300046455 Bacteria 12594
124 Ga0495590_0166355 3300046457 Bacteria 803
125 Ga0495629_0042992 3300046459 Bacteria 3173
126 Ga0495629_0369878 3300046459 Bacteria 976
127 Ga0495653_0390211 3300046463 Bacteria 887
128 Ga0495582_0073645 3300046473 Bacteria 1891
129 Ga0495662_0130784 3300046476 Bacteria 1234
130 Ga0495585_0171142 3300046492 Bacteria 1122
131 Ga0495594_0001746 3300046499 Bacteria 11249
132 Ga0495594_0060002 3300046499 Bacteria 2104
133 Ga0495618_0184190 3300046514 Bacteria 1326
134 Ga0495620_0024461 3300046515 Bacteria 2872
135 Ga0495628_0039546 3300046516 Bacteria 3772
136 Ga0495631_0221704 3300046518 Bacteria 807
137 Ga0495652_0202131 3300046529 Bacteria 1507
138 Ga0495640_0234604 3300046533 Bacteria 1153
139 Ga0495640_0247243 3300046533 Bacteria 1118
140 Ga0495640_0321535 3300046533 Bacteria 958
141 Ga0495622_0171551 3300046557 Bacteria 975
142 Ga0495611_0079707 3300046648 Bacteria 1504
143 Ga0495647_0155615 3300046681 Bacteria 982
144 Ga0495613_0004401 3300046689 Bacteria 10544
145 Ga0495589_0084100 3300046794 Bacteria 1546
146 Ga0495581_0008876 3300047315 Bacteria 5819
147 Ga0495674_0055595 3300047319 Bacteria 3470
148 Ga0495674_0750758 3300047319 Bacteria 762
149 Ga0495683_0072140 3300047323 Bacteria 1694
150 Ga0495685_005798 3300047447 Bacteria 4034
151 Ga0495593_0017215 3300047673 Bacteria 4067
152 Ga0495593_0248471 3300047673 Bacteria 891
153 Ga0495614_0017716 3300048089 Bacteria 3092
154 Ga0495614_0076299 3300048089 Bacteria 1449
155 Ga0496102_0083170 3300048905 Bacteria 2953
156 Ga0496102_0114193 3300048905 Bacteria 2520
157 Ga0496104_0027002 3300048907 Bacteria 5308
158 Ga0496105_0013491 3300048908 Bacteria 6488
159 Ga0496108_0014146 3300048911 Bacteria 6511
160 Ga0496109_0005846 3300048912 Bacteria 10319
161 Ga0496109_0172454 3300048912 Bacteria 2030
162 Ga0496110_0025795 3300048913 Bacteria 5024
163 Ga0496110_0187572 3300048913 Bacteria 1878
164 Ga0496110_0685069 3300048913 Bacteria 926
165 Ga0496111_0006321 3300048914 Bacteria 7681
166 Ga0496114_0048931 3300048917 Bacteria 3517
167 Ga0496114_0066187 3300048917 Bacteria 3029
168 Ga0496114_0466363 3300048917 Bacteria 1118
169 Ga0496114_0528612 3300048917 Bacteria 1043
170 Ga0496115_0385772 3300048918 Bacteria 1139
171 Ga0496115_0445464 3300048918 Bacteria 1047
172 Ga0496124_0169741 3300048927 Bacteria 1691
173 Ga0496126_0100651 3300048929 Bacteria 2529
174 Ga0501032_0450054 3300049569 Bacteria 825
175 Ga0501033_0004594 3300049570 Bacteria 11063
176 Ga0501034_0177659 3300049571 Bacteria 2094
177 Ga0501043_0430875 3300049579 Bacteria 993
178 Ga0501047_0116537 3300049581 Bacteria 2553
179 Ga0501070_0250771 3300049586 Bacteria 1448
180 Ga0501073_0238777 3300049589 Bacteria 1255
181 Ga0501075_0159663 3300049591 Bacteria 1720
182 Ga0501075_0321211 3300049591 Bacteria 1180
183 Ga0501035_0339706 3300049822 Bacteria 1258
184 nmdc:mga03683_14887_c1 3300050489 Bacteria 1299
185 nmdc:mga00v17_27514_c1 3300050491 Bacteria 3320
186 nmdc:mga00v17_614075_c1 3300050491 Bacteria 701
187 nmdc:mga06z11_31643_c1 3300050494 Bacteria 2573
188 nmdc:mga05p37_87729_c1 3300050507 Bacteria 3835
189 nmdc:mga05p37_985206_c1 3300050507 Bacteria 898
190 nmdc:mga09592_104470_c1 3300050508 Bacteria 2428
191 nmdc:mga09592_429349_c1 3300050508 Bacteria 1141
192 nmdc:mga0qj67_369525_c1 3300050509 Bacteria 1159
193 nmdc:mga0qj67_76988_c1 3300050509 Bacteria 2669
194 nmdc:mga06r32_176079_c1 3300050510 Bacteria 2124
195 nmdc:mga06r32_62332_c1 3300050510 Bacteria 3593
196 nmdc:mga08y16_155090_c1 3300050511 Bacteria 2380
197 nmdc:mga0n895_207896_c1 3300050512 Bacteria 1988
198 nmdc:mga0n895_582913_c1 3300050512 Bacteria 1122
199 Ga0466962_0071880 3300061719 Bacteria 1653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_207896_c1 nmdc:mga0n895_207896_c1_381_1088 193
2 3300005440 Ga0070705_100048254 Ga0070705_1000482542 194
3 3300005545 Ga0070695_100020943 Ga0070695_1000209432 194
4 3300009098 Ga0105245_10042992 Ga0105245_100429922 194
5 3300013297 Ga0157378_10357204 Ga0157378_103572042 194
6 3300025927 Ga0207687_10035618 Ga0207687_100356183 194
7 3300006038 Ga0075365_10023433 Ga0075365_100234334 200
8 3300006042 Ga0075368_10075716 Ga0075368_100757162 200
9 3300006051 Ga0075364_10010102 Ga0075364_100101024 200
10 3300036647 Ga0316582_0126225 Ga0316582_0126225_858_1526 200
11 3300038735 Ga0400485_17369 Ga0400485_17369_236_904 200
12 3300050491 nmdc:mga00v17_27514_c1 nmdc:mga00v17_27514_c1_1319_1951 200
13 3300049591 Ga0501075_0159663 Ga0501075_0159663_610_1263 201
14 3300025927 Ga0207687_10220217 Ga0207687_102202172 202
15 3300048905 Ga0496102_0114193 Ga0496102_0114193_1480_2190 202
16 3300048913 Ga0496110_0187572 Ga0496110_0187572_809_1519 202
17 3300048918 Ga0496115_0385772 Ga0496115_0385772_405_1076 203
18 3300031239 Ga0265328_10035359 Ga0265328_100353592 204
19 3300039438 Ga0436360_1321289 Ga0436360_1321289_341_1027 204
20 3300005334 Ga0068869_100206483 Ga0068869_1002064832 205
21 3300005336 Ga0070680_100170970 Ga0070680_1001709702 205
22 3300005535 Ga0070684_100209284 Ga0070684_1002092842 205
23 3300005937 Ga0081455_10013352 Ga0081455_100133527 205
24 3300006844 Ga0075428_100060015 Ga0075428_1000600153 205
25 3300009147 Ga0114129_10048626 Ga0114129_100486262 205
26 3300013105 Ga0157369_10517390 Ga0157369_105173902 205
27 3300025942 Ga0207689_10585322 Ga0207689_105853222 205
28 3300027907 Ga0207428_10048938 Ga0207428_100489382 205
29 3300031731 Ga0307405_10000703 Ga0307405_100007035 205
30 3300031852 Ga0307410_10035378 Ga0307410_100353783 205
31 3300031889 Ga0326468_10000394 Ga0326468_100003946 205
32 3300031901 Ga0307406_10001772 Ga0307406_100017724 205
33 3300031903 Ga0307407_10014971 Ga0307407_100149713 205
34 3300031995 Ga0307409_100004753 Ga0307409_1000047535 205
35 3300032002 Ga0307416_100008483 Ga0307416_1000084836 205
36 3300032126 Ga0307415_100014155 Ga0307415_1000141554 205
37 3300044901 Ga0466960_0022574 Ga0466960_0022574_2120_2797 205
38 3300037466 Ga0395898_0536355 Ga0395898_0536355_141_821 206
39 iso_pu_bacteria 2862178590 2862180047 206
40 3300005937 Ga0081455_10001836 Ga0081455_1000183612 207
41 3300035692 Ga0373935_0004006 Ga0373935_0004006_5055_5729 207
42 3300005545 Ga0070695_100197882 Ga0070695_1001978822 208
43 3300005618 Ga0068864_101107548 Ga0068864_1011075481 208
44 3300009098 Ga0105245_10366547 Ga0105245_103665472 208
45 3300009098 Ga0105245_10530738 Ga0105245_105307382 208
46 3300009553 Ga0105249_10045372 Ga0105249_100453727 208
47 3300025927 Ga0207687_10353095 Ga0207687_103530951 208
48 3300028800 Ga0265338_10004214 Ga0265338_1000421414 208
49 3300032126 Ga0307415_100315067 Ga0307415_1003150672 208
50 3300039438 Ga0436360_1174333 Ga0436360_1174333_607_1275 208
51 3300049569 Ga0501032_0450054 Ga0501032_0450054_96_761 208
52 3300049570 Ga0501033_0004594 Ga0501033_0004594_4919_5584 208
53 3300049571 Ga0501034_0177659 Ga0501034_0177659_851_1516 208
54 3300049579 Ga0501043_0430875 Ga0501043_0430875_174_839 208
55 3300049581 Ga0501047_0116537 Ga0501047_0116537_555_1220 208
56 3300049586 Ga0501070_0250771 Ga0501070_0250771_523_1188 208
57 3300049822 Ga0501035_0339706 Ga0501035_0339706_369_1034 208
58 iso_pu_bacteria 2802429296 2804844685 209
59 iso_pu_bacteria 8025413630 8025416986 209
60 3300025961 Ga0207712_10936283 Ga0207712_109362831 210
61 3300028800 Ga0265338_10008152 Ga0265338_1000815211 210
62 3300046457 Ga0495590_0166355 Ga0495590_0166355_43_753 210
63 3300046492 Ga0495585_0171142 Ga0495585_0171142_291_1001 210
64 3300046515 Ga0495620_0024461 Ga0495620_0024461_1687_2397 210
65 3300046518 Ga0495631_0221704 Ga0495631_0221704_64_774 210
66 3300046648 Ga0495611_0079707 Ga0495611_0079707_438_1148 210
67 3300046794 Ga0495589_0084100 Ga0495589_0084100_407_1117 210
68 3300047323 Ga0495683_0072140 Ga0495683_0072140_271_981 210
69 3300047447 Ga0495685_005798 Ga0495685_005798_2074_2784 210
70 3300050491 nmdc:mga00v17_614075_c1 nmdc:mga00v17_614075_c1_17_688 210
71 3300005985 Ga0081539_10016448 Ga0081539_100164484 211
72 3300006048 Ga0075363_100039142 Ga0075363_1000391422 211
73 3300006178 Ga0075367_10025294 Ga0075367_100252942 211
74 3300044693 Ga0466961_0506586 Ga0466961_0506586_13_681 211
75 3300046459 Ga0495629_0369878 Ga0495629_0369878_240_914 211
76 3300046499 Ga0495594_0060002 Ga0495594_0060002_1303_1977 211
77 3300050489 nmdc:mga03683_14887_c1 nmdc:mga03683_14887_c1_526_1191 211
78 3300050494 nmdc:mga06z11_31643_c1 nmdc:mga06z11_31643_c1_1854_2519 211
79 3300006844 Ga0075428_100115080 Ga0075428_1001150803 212
80 3300009094 Ga0111539_10037654 Ga0111539_100376544 212
81 3300009147 Ga0114129_10549483 Ga0114129_105494831 212
82 3300009177 Ga0105248_11415167 Ga0105248_114151672 212
83 3300027907 Ga0207428_10199845 Ga0207428_101998452 212
84 3300031852 Ga0307410_10244540 Ga0307410_102445402 212
85 3300031901 Ga0307406_10215374 Ga0307406_102153741 212
86 3300031903 Ga0307407_10109625 Ga0307407_101096252 212
87 3300032005 Ga0307411_10185904 Ga0307411_101859042 212
88 3300044656 Ga0466969_0112017 Ga0466969_0112017_236_904 212
89 3300044693 Ga0466961_0034685 Ga0466961_0034685_339_1007 212
90 3300044765 Ga0466970_0048232 Ga0466970_0048232_259_927 212
91 3300045049 Ga0466959_0168965 Ga0466959_0168965_749_1417 212
92 3300045836 Ga0466958_0138925 Ga0466958_0138925_626_1294 212
93 3300050507 nmdc:mga05p37_87729_c1 nmdc:mga05p37_87729_c1_1803_2501 212
94 3300050508 nmdc:mga09592_104470_c1 nmdc:mga09592_104470_c1_180_878 212
95 3300050509 nmdc:mga0qj67_369525_c1 nmdc:mga0qj67_369525_c1_180_878 212
96 3300050510 nmdc:mga06r32_176079_c1 nmdc:mga06r32_176079_c1_760_1458 212
97 3300050511 nmdc:mga08y16_155090_c1 nmdc:mga08y16_155090_c1_1047_1745 212
98 3300061719 Ga0466962_0071880 Ga0466962_0071880_811_1479 212
99 3300005985 Ga0081539_10014627 Ga0081539_100146272 213
100 3300025972 Ga0207668_10214126 Ga0207668_102141261 213
101 3300032126 Ga0307415_100758060 Ga0307415_1007580602 213
102 3300035113 Ga0373936_0033114 Ga0373936_0033114_892_1563 213
103 3300046463 Ga0495653_0390211 Ga0495653_0390211_151_864 213
104 3300048905 Ga0496102_0083170 Ga0496102_0083170_37_750 213
105 3300048907 Ga0496104_0027002 Ga0496104_0027002_4556_5269 213
106 3300048908 Ga0496105_0013491 Ga0496105_0013491_4852_5565 213
107 3300048911 Ga0496108_0014146 Ga0496108_0014146_4983_5696 213
108 3300048912 Ga0496109_0005846 Ga0496109_0005846_1770_2483 213
109 3300048912 Ga0496109_0172454 Ga0496109_0172454_1076_1786 213
110 3300048913 Ga0496110_0025795 Ga0496110_0025795_2688_3401 213
111 3300048914 Ga0496111_0006321 Ga0496111_0006321_4307_5020 213
112 3300048917 Ga0496114_0048931 Ga0496114_0048931_886_1599 213
113 3300048917 Ga0496114_0066187 Ga0496114_0066187_510_1238 213
114 3300048917 Ga0496114_0466363 Ga0496114_0466363_24_779 213
115 3300048918 Ga0496115_0445464 Ga0496115_0445464_200_940 213
116 3300048927 Ga0496124_0169741 Ga0496124_0169741_694_1407 213
117 3300025942 Ga0207689_10215262 Ga0207689_102152622 214
118 3300032126 Ga0307415_100040301 Ga0307415_1000403012 214
119 3300032126 Ga0307415_100088232 Ga0307415_1000882321 214
120 3300047319 Ga0495674_0750758 Ga0495674_0750758_78_752 214
121 3300049589 Ga0501073_0238777 Ga0501073_0238777_121_807 214
122 3300005467 Ga0070706_100069041 Ga0070706_1000690411 215
123 3300005937 Ga0081455_10002459 Ga0081455_100024598 215
124 3300006038 Ga0075365_10048717 Ga0075365_100487173 215
125 3300025922 Ga0207646_10336647 Ga0207646_103366472 215
126 3300031730 Ga0307516_10048610 Ga0307516_100486104 215
127 3300031995 Ga0307409_100615669 Ga0307409_1006156692 215
128 3300044656 Ga0466969_0003142 Ga0466969_0003142_4134_4844 215
129 iso_pu_bacteria 2687453737 2689958975 215
130 3300006038 Ga0075365_10460966 Ga0075365_104609662 216
131 3300006844 Ga0075428_100181671 Ga0075428_1001816711 216
132 3300006846 Ga0075430_100061584 Ga0075430_1000615842 216
133 3300009177 Ga0105248_10097895 Ga0105248_100978953 216
134 3300014968 Ga0157379_10179463 Ga0157379_101794632 216
135 3300025941 Ga0207711_10503732 Ga0207711_105037322 216
136 3300048929 Ga0496126_0100651 Ga0496126_0100651_247_936 216
137 3300050507 nmdc:mga05p37_985206_c1 nmdc:mga05p37_985206_c1_40_729 216
138 3300050509 nmdc:mga0qj67_76988_c1 nmdc:mga0qj67_76988_c1_1466_2155 216
139 3300050510 nmdc:mga06r32_62332_c1 nmdc:mga06r32_62332_c1_2565_3254 216
140 3300005434 Ga0070709_10006598 Ga0070709_100065984 217
141 3300005435 Ga0070714_100068548 Ga0070714_1000685482 217
142 3300005437 Ga0070710_10050851 Ga0070710_100508512 217
143 3300005439 Ga0070711_100028941 Ga0070711_1000289412 217
144 3300005467 Ga0070706_100019021 Ga0070706_1000190213 217
145 3300005471 Ga0070698_100003974 Ga0070698_10000397414 217
146 3300006173 Ga0070716_100138819 Ga0070716_1001388192 217
147 3300009545 Ga0105237_10738030 Ga0105237_107380301 217
148 3300025898 Ga0207692_10112709 Ga0207692_101127092 217
149 3300025906 Ga0207699_10020012 Ga0207699_100200121 217
150 3300025910 Ga0207684_10000428 Ga0207684_1000042861 217
151 3300025916 Ga0207663_10014350 Ga0207663_100143504 217
152 3300025928 Ga0207700_10032549 Ga0207700_100325493 217
153 3300025929 Ga0207664_10104989 Ga0207664_101049893 217
154 3300025939 Ga0207665_10150276 Ga0207665_101502762 217
155 3300046455 Ga0495603_0001818 Ga0495603_0001818_77_781 217
156 3300046459 Ga0495629_0042992 Ga0495629_0042992_77_781 217
157 3300046473 Ga0495582_0073645 Ga0495582_0073645_11_715 217
158 3300046476 Ga0495662_0130784 Ga0495662_0130784_483_1187 217
159 3300046499 Ga0495594_0001746 Ga0495594_0001746_3858_4562 217
160 3300046533 Ga0495640_0234604 Ga0495640_0234604_256_960 217
161 3300046557 Ga0495622_0171551 Ga0495622_0171551_58_762 217
162 3300046689 Ga0495613_0004401 Ga0495613_0004401_5880_6584 217
163 3300047315 Ga0495581_0008876 Ga0495581_0008876_320_1024 217
164 3300047673 Ga0495593_0017215 Ga0495593_0017215_975_1679 217
165 3300048089 Ga0495614_0017716 Ga0495614_0017716_205_909 217
166 3300005436 Ga0070713_100646487 Ga0070713_1006464871 218
167 3300005471 Ga0070698_100120569 Ga0070698_1001205692 218
168 3300049591 Ga0501075_0321211 Ga0501075_0321211_144_839 218
169 3300005614 Ga0068856_100259577 Ga0068856_1002595772 219
170 3300005617 Ga0068859_100329389 Ga0068859_1003293892 220
171 3300006931 Ga0097620_100329401 Ga0097620_1003294012 220
172 3300048913 Ga0496110_0685069 Ga0496110_0685069_115_810 220
173 iso_pu_bacteria 8002775197 8002782654 220
174 3300006844 Ga0075428_100129239 Ga0075428_1001292393 221
175 3300013105 Ga0157369_10021127 Ga0157369_100211279 221
176 3300014969 Ga0157376_10060345 Ga0157376_100603454 221
177 3300035725 Ga0373947_0101839 Ga0373947_0101839_176_883 221
178 3300037068 Ga0373925_0327903 Ga0373925_0327903_16_723 221
179 3300046514 Ga0495618_0184190 Ga0495618_0184190_170_877 221
180 3300046533 Ga0495640_0247243 Ga0495640_0247243_152_859 221
181 3300046681 Ga0495647_0155615 Ga0495647_0155615_153_890 221
182 3300047673 Ga0495593_0248471 Ga0495593_0248471_27_764 221
183 3300048089 Ga0495614_0076299 Ga0495614_0076299_55_762 221
184 3300048917 Ga0496114_0528612 Ga0496114_0528612_28_765 221
185 3300050512 nmdc:mga0n895_582913_c1 nmdc:mga0n895_582913_c1_377_1084 221
186 3300005435 Ga0070714_100521933 Ga0070714_1005219332 222
187 3300050508 nmdc:mga09592_429349_c1 nmdc:mga09592_429349_c1_291_1016 222
188 3300025915 Ga0207693_10297960 Ga0207693_102979601 223
189 3300035692 Ga0373935_0219518 Ga0373935_0219518_341_1054 223
190 3300046516 Ga0495628_0039546 Ga0495628_0039546_185_898 223
191 3300046529 Ga0495652_0202131 Ga0495652_0202131_20_733 223
192 3300046533 Ga0495640_0321535 Ga0495640_0321535_213_926 223
193 3300047319 Ga0495674_0055595 Ga0495674_0055595_2415_3128 223
194 3300005327 Ga0070658_10013736 Ga0070658_100137362 227
195 3300005329 Ga0070683_100071427 Ga0070683_1000714272 227
196 3300005336 Ga0070680_100124907 Ga0070680_1001249072 227
197 3300005563 Ga0068855_100399150 Ga0068855_1003991502 227
198 3300010375 Ga0105239_10313717 Ga0105239_103137172 227
199 3300025909 Ga0207705_10028953 Ga0207705_100289533 227
200 3300025912 Ga0207707_10092557 Ga0207707_100925572 227
201 3300025919 Ga0207657_10071439 Ga0207657_100714392 227
202 3300025920 Ga0207649_10127470 Ga0207649_101274702 227
203 3300025921 Ga0207652_10446292 Ga0207652_104462922 227
204 3300025944 Ga0207661_10024109 Ga0207661_100241091 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

205

261

0.97

PF00072

Response_reg

Response regulator receiver domain

6

78

0.96

PF04545

Sigma70_r4

Sigma-70, region 4

203

250

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

201

249

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9994 148 212
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9993 150 212
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.997 148 212
4wul-assembly1.cif.gz_B crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9946 152 212
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9936 148 211
ID Description Score Start End Superfamily
4if4B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9858 148 211 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9745 146 212 1.10.10.10
4if4D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9736 146 212 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9662 152 206 1.10.10.10
3qp5D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9611 152 204 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3D5E0P0-F1-model_v4 Response regulatory domain-containing protein 0.9698 1 111 GO:0000160
GO:0003677
AF-A0A3N5UMV8-F1-model_v4 DNA-binding response regulator 0.9426 2 107 GO:0000160
GO:0003677
AF-A0A4P8SLA0-F1-model_v4 DNA-binding response regulator 0.9201 4 214 GO:0000160
GO:0003677
GO:0006355
AF-A0A068MW04-F1-model_v4 Two-component response regulator 0.9129 2 116 GO:0000160
AF-G7GL04-F1-model_v4 Putative two-component response regulator 0.9121 1 114 GO:0000160
GO:0003677

Feature Viewer

pLDDT pTM Quality
74.71 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map