F313188

General Info

Members Datasets Scaffolds Average Seq Length
204 136 408 414

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606370|2808890960
Length 453
Sequence FLPPLIPLSMRFLISREEAMYKLNNRIRDYAWGSTTLIADYLGRTPSGAPEAEMWIGAHPGAPSEALLDSCHRRLDKLIEADPEGMLGPDSHAAFGSTLPFLMKVLAAESPLSLQVHPTREQAASGFAAEDALGVPKDAQTRNYKDPNHKPEMIVALTDFEALCGFRPATEAKAIFDALVTLFRETGAEILEVLQQASSTLAGADEPTAIRQTFTGLIRGGDEVSRAVDAVAALLGSRIPEGPYTAALKTALELSEAYPRDPGVLISLMLNRVSLRPNEAIYLPAGNIHAYLHGLGIEVMASSDNVLRGGLTAKHIDVDELLRTVDFTPLPVPRLAATSPAEGHLIWKPPFDEFQLQRIELEPGAPNMELPAVLPVIVLVASGSGLLGTRLQTLELGKGDSAFAGANESPITLRAGSTEPLVAFVATTGIQEGIPIDGPPTLRPSRNDTSGMI

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
8 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
9 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
10 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
11 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
12 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
13 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
14 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
15 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
16 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
25 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
26 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
27 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
28 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
29 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
30 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
31 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
32 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
33 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
34 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
35 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
36 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
39 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
40 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
41 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
42 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
43 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
44 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
45 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
46 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
47 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
48 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
49 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
50 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
51 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
52 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
53 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
54 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
55 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
56 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
57 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
58 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
59 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
60 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
61 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
62 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
63 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
64 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
65 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
66 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
67 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
68 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
69 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
70 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
71 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
72 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
73 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
74 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
75 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
76 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
77 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
78 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
79 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
80 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
81 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
82 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
90 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
91 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
99 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
100 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
101 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
102 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
103 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
104 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
105 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
106 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
107 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
108 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
109 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
110 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
111 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
112 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
113 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
114 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
115 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
116 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
117 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
118 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
119 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
120 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
121 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
122 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
123 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
124 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
125 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
126 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
127 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
128 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
129 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
130 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
131 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
132 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
133 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
134 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
135 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
136 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.94
Metatranscriptomes 0.49
Isolates 21.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.96
Nodule 0
Rhizoplane 11.76
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000325 3300000549 Bacteria 8319
2 LJQas_1001891 3300000549 Bacteria 3030
3 JGI25152J39213_1000411 3300002773 Bacteria 25803
4 Ga0070668_100235868 3300005347 Bacteria 1514
5 Ga0070671_100080092 3300005355 Bacteria 2730
6 Ga0070673_100005033 3300005364 Bacteria 8434
7 Ga0081539_10000272 3300005985 Bacteria 118649
8 Ga0105244_10000921 3300009036 Bacteria 24878
9 Ga0105246_10000335 3300011119 Bacteria 24992
10 Ga0105246_10009592 3300011119 Bacteria 5966
11 Ga0105246_10056428 3300011119 Bacteria 2715
12 Ga0157370_10288107 3300013104 Bacteria 1517
13 Ga0157369_10024129 3300013105 Bacteria 6768
14 Ga0157369_10043804 3300013105 Bacteria 4876
15 Ga0163162_10034182 3300013306 Bacteria 5057
16 Ga0157375_10120137 3300013308 Bacteria 2736
17 Ga0207425_1006140 3300025245 Bacteria 3322
18 Ga0209129_1000059 3300025258 Bacteria 250603
19 Ga0209025_1000782 3300025294 Bacteria 52292
20 Ga0207697_10003837 3300025315 Bacteria 7339
21 Ga0207655_1018563 3300025728 Bacteria 3681
22 Ga0207645_10000498 3300025907 Bacteria 32459
23 Ga0207650_10237756 3300025925 Bacteria 1471
24 Ga0207659_10038112 3300025926 Bacteria 3341
25 Ga0207669_10143004 3300025937 Bacteria 1664
26 Ga0207691_10002486 3300025940 Bacteria 18025
27 Ga0207683_10002731 3300026121 Bacteria 15413
28 Ga0207428_10002560 3300027907 Bacteria 18166
29 Ga0307408_100003478 3300031548 Bacteria 10758
30 Ga0307408_100039938 3300031548 Bacteria 3320
31 Ga0307408_100115469 3300031548 Bacteria 2070
32 Ga0307408_100201384 3300031548 Bacteria 1611
33 Ga0307405_10001166 3300031731 Bacteria 10818
34 Ga0307405_10002128 3300031731 Bacteria 8625
35 Ga0307405_10004349 3300031731 Bacteria 6680
36 Ga0307405_10020623 3300031731 Bacteria 3686
37 Ga0307405_10025087 3300031731 Bacteria 3417
38 Ga0307405_10036356 3300031731 Bacteria 2950
39 Ga0307405_10074437 3300031731 Bacteria 2196
40 Ga0307405_10117249 3300031731 Bacteria 1815
41 Ga0307413_10033010 3300031824 Bacteria 2941
42 Ga0307413_10082595 3300031824 Bacteria 2064
43 Ga0307413_10095019 3300031824 Bacteria 1953
44 Ga0307413_10101999 3300031824 Bacteria 1899
45 Ga0307410_10004871 3300031852 Bacteria 7021
46 Ga0307410_10010053 3300031852 Bacteria 5341
47 Ga0307410_10016044 3300031852 Bacteria 4455
48 Ga0307410_10020841 3300031852 Bacteria 4020
49 Ga0307410_10055453 3300031852 Bacteria 2690
50 Ga0307406_10002770 3300031901 Bacteria 9569
51 Ga0307406_10042138 3300031901 Bacteria 2849
52 Ga0307407_10008295 3300031903 Bacteria 4760
53 Ga0307407_10070930 3300031903 Bacteria 2073
54 Ga0307407_10119187 3300031903 Bacteria 1670
55 Ga0307412_10000183 3300031911 Bacteria 43985
56 Ga0307412_10033943 3300031911 Bacteria 3247
57 Ga0307412_10069169 3300031911 Bacteria 2402
58 Ga0307412_10084499 3300031911 Bacteria 2203
59 Ga0307412_10085811 3300031911 Bacteria 2189
60 Ga0307412_10086785 3300031911 Bacteria 2178
61 Ga0307412_10091873 3300031911 Bacteria 2125
62 Ga0307409_100002948 3300031995 Bacteria 9054
63 Ga0307416_100014842 3300032002 Bacteria 5356
64 Ga0307416_100086129 3300032002 Bacteria 2677
65 Ga0307414_10054878 3300032004 Bacteria 2787
66 Ga0307414_10073250 3300032004 Bacteria 2477
67 Ga0307414_10141759 3300032004 Bacteria 1883
68 Ga0307415_100041807 3300032126 Bacteria 3046
69 Ga0395899_0015760 3300037312 Bacteria 5763
70 Ga0395900_0067569 3300037418 Bacteria 3672
71 Ga0395900_0158785 3300037418 Bacteria 2307
72 Ga0395898_0184577 3300037466 Bacteria 1993
73 Ga0395901_0088917 3300038443 Bacteria 3232
74 Ga0395901_0138760 3300038443 Bacteria 2555
75 Ga0439436_0000640 3300041404 Bacteria 9326
76 Ga0439436_0007462 3300041404 Bacteria 3364
77 Ga0439438_002548 3300041405 Bacteria 7726
78 Ga0439439_0001391 3300041406 Bacteria 4790
79 Ga0439461_0014954 3300041410 Bacteria 1482
80 Ga0439466_0011591 3300041411 Bacteria 3259
81 Ga0439465_0004268 3300041413 Bacteria 4649
82 Ga0439433_0000103 3300041999 Bacteria 11926
83 Ga0439433_0002315 3300041999 Bacteria 4030
84 Ga0439442_000295 3300042002 Bacteria 12082
85 Ga0439442_000359 3300042002 Bacteria 10776
86 Ga0439442_000533 3300042002 Bacteria 8417
87 Ga0439442_001707 3300042002 Bacteria 4309
88 Ga0439432_001363 3300042006 Bacteria 9249
89 Ga0439449_0001922 3300042007 Bacteria 8156
90 Ga0439449_0004580 3300042007 Bacteria 5343
91 Ga0439449_0009279 3300042007 Bacteria 3729
92 Ga0439452_006282 3300042010 Bacteria 3730
93 Ga0439462_0008048 3300042015 Bacteria 2652
94 Ga0450920_000225 3300042122 Bacteria 8504
95 Ga0450920_000714 3300042122 Bacteria 5348
96 Ga0450908_003385 3300042184 Bacteria 3097
97 Ga0450908_007765 3300042184 Bacteria 2016
98 Ga0439434_0000234 3300042435 Bacteria 15532
99 Ga0439434_0001181 3300042435 Bacteria 7517
100 Ga0450918_000820 3300042531 Bacteria 6526
101 Ga0466960_0053816 3300044901 Bacteria 1952
102 Ga0495580_0007774 3300046472 Bacteria 8590
103 Ga0495582_0011040 3300046473 Bacteria 4973
104 Ga0495639_0003045 3300046475 Bacteria 7296
105 Ga0495662_0002676 3300046476 Bacteria 8999
106 Ga0495664_0003270 3300046477 Bacteria 8807
107 Ga0495594_0103249 3300046499 Bacteria 1604
108 Ga0495665_0002445 3300046531 Bacteria 10030
109 Ga0495665_0008559 3300046531 Bacteria 5552
110 Ga0495586_0002284 3300046535 Bacteria 10425
111 Ga0495586_0003554 3300046535 Bacteria 8351
112 Ga0495587_0000831 3300046536 Bacteria 20411
113 Ga0495645_0001753 3300046543 Bacteria 14748
114 Ga0495667_0002277 3300046559 Bacteria 12858
115 Ga0495656_0054024 3300046615 Bacteria 1727
116 Ga0495668_0013470 3300046616 Bacteria 4821
117 Ga0495588_0006552 3300046674 Bacteria 5251
118 Ga0495588_0011896 3300046674 Bacteria 4097
119 Ga0495588_0045877 3300046674 Bacteria 2241
120 Ga0495623_0008507 3300046679 Bacteria 6665
121 Ga0495600_0131280 3300046809 Bacteria 1628
122 Ga0495581_0001883 3300047315 Bacteria 11736
123 Ga0495581_0005310 3300047315 Bacteria 7453
124 Ga0495604_0042663 3300047317 Bacteria 3554
125 Ga0495675_0003696 3300047444 Bacteria 9250
126 Ga0495681_0033791 3300047470 Bacteria 2556
127 Ga0495593_0028267 3300047673 Bacteria 3081
128 Ga0496101_0016922 3300048904 Bacteria 4936
129 Ga0496102_0037404 3300048905 Bacteria 4378
130 Ga0496102_0071858 3300048905 Bacteria 3177
131 Ga0496102_0094621 3300048905 Bacteria 2768
132 Ga0496102_0208477 3300048905 Bacteria 1842
133 Ga0496102_0214080 3300048905 Bacteria 1816
134 Ga0496102_0294483 3300048905 Bacteria 1529
135 Ga0496103_0023637 3300048906 Bacteria 3707
136 Ga0496103_0053100 3300048906 Bacteria 2511
137 Ga0496106_0016982 3300048909 Bacteria 5385
138 Ga0496106_0038948 3300048909 Bacteria 3559
139 Ga0496106_0051127 3300048909 Bacteria 3116
140 Ga0496107_0011825 3300048910 Bacteria 6095
141 Ga0496108_0253665 3300048911 Bacteria 1531
142 Ga0496109_0071747 3300048912 Bacteria 3180
143 Ga0496110_0040251 3300048913 Bacteria 4073
144 Ga0496111_0019041 3300048914 Bacteria 4762
145 Ga0496112_0016440 3300048915 Bacteria 6932
146 Ga0496112_0022169 3300048915 Bacteria 6052
147 Ga0496112_0068044 3300048915 Bacteria 3516
148 Ga0496113_0125326 3300048916 Bacteria 2011
149 Ga0496114_0008555 3300048917 Bacteria 8113
150 Ga0496114_0017350 3300048917 Bacteria 5810
151 Ga0496114_0147739 3300048917 Bacteria 2038
152 Ga0496124_0051112 3300048927 Bacteria 3518
153 Ga0501325_000951 3300049541 Bacteria 1629
154 Ga0501032_0010567 3300049569 Bacteria 6656
155 Ga0501032_0099611 3300049569 Bacteria 1925
156 Ga0501037_0025350 3300049573 Bacteria 4381
157 Ga0501038_0091682 3300049574 Bacteria 2545
158 Ga0501070_0010212 3300049586 Bacteria 7944
159 Ga0501044_0070083 3300049823 Bacteria 3568
160 nmdc:mga09592_185473_c1 3300050508 Bacteria 1800
161 2808890960 2808606370 Bacteria 4942454
162 2691513233 2690315906 Bacteria 4517044
163 2775656406 2775506735 Bacteria 4556596
164 2808829316 2808606357 Bacteria 4466944
165 2808830477 2808606357 Bacteria 4466944
166 2808851671 2808606360 Bacteria 4404006
167 2808852255 2808606360 Bacteria 4404006
168 2808875849 2808606366 Bacteria 4415912
169 2808894740 2808606370 Bacteria 4942454
170 2808895691 2808606371 Bacteria 4251511
171 2812317766 2811994871 Bacteria 4497550
172 2812318953 2811994871 Bacteria 4497550
173 2837269357 2837268691 Bacteria 7850704
174 2844852002 2844849076 Bacteria 4091819
175 2857480866 2857479173 Bacteria 2469263
176 2857633350 2857632687 Bacteria 2448521
177 2857740479 2857740372 Bacteria 4782044
178 2868092180 2868088558 Bacteria 7609351
179 2870803207 2870801768 Bacteria 2710986
180 2870805252 2870804320 Bacteria 2552467
181 2904499379 2904497146 Bacteria 4731781
182 2904778482 2904776348 Bacteria 4658726
183 2910810382 2910809715 Bacteria 4982797
184 2919035839 2919034639 Bacteria 4763403
185 2919060535 2919059106 Bacteria 4991624
186 2919392159 2919391150 Bacteria 4884741
187 2919538949 2919538618 Bacteria 4677069
188 2932427530 2932426870 Bacteria 4547726
189 2933418881 2933418574 Bacteria 4476724
190 2939599787 2939598168 Bacteria 4687164
191 2939648189 2939647034 Bacteria 4681660
192 2939677112 2939674588 Bacteria 4844420
193 2945919834 2945916053 Bacteria 4555517
194 2945924264 2945920336 Bacteria 4501603
195 2945944017 2945941187 Bacteria 4682474
196 2945957798 2945956166 Bacteria 5110334
197 2946039194 2946037020 Bacteria 4900426
198 2946039973 2946037020 Bacteria 4900426
199 2946063560 2946059875 Bacteria 4386623
200 2954001204 2953998280 Bacteria 4812144
201 2966921858 2966921586 Bacteria 3092803
202 2974303468 2974302888 Bacteria 4369871
203 8001784167 8001781756 Bacteria 9586736
204 8054111739 8054107350 Bacteria 5022511
205 LJQas_1000325
206 LJQas_1001891
207 JGI25152J39213_1000411
208 Ga0070668_100235868
209 Ga0070671_100080092
210 Ga0070673_100005033
211 Ga0081539_10000272
212 Ga0105244_10000921
213 Ga0105246_10000335
214 Ga0105246_10009592
215 Ga0105246_10056428
216 Ga0157370_10288107
217 Ga0157369_10024129
218 Ga0157369_10043804
219 Ga0163162_10034182
220 Ga0157375_10120137
221 Ga0207425_1006140
222 Ga0209129_1000059
223 Ga0209025_1000782
224 Ga0207697_10003837
225 Ga0207655_1018563
226 Ga0207645_10000498
227 Ga0207650_10237756
228 Ga0207659_10038112
229 Ga0207669_10143004
230 Ga0207691_10002486
231 Ga0207683_10002731
232 Ga0207428_10002560
233 Ga0307408_100003478
234 Ga0307408_100039938
235 Ga0307408_100115469
236 Ga0307408_100201384
237 Ga0307405_10001166
238 Ga0307405_10002128
239 Ga0307405_10004349
240 Ga0307405_10020623
241 Ga0307405_10025087
242 Ga0307405_10036356
243 Ga0307405_10074437
244 Ga0307405_10117249
245 Ga0307413_10033010
246 Ga0307413_10082595
247 Ga0307413_10095019
248 Ga0307413_10101999
249 Ga0307410_10004871
250 Ga0307410_10010053
251 Ga0307410_10016044
252 Ga0307410_10020841
253 Ga0307410_10055453
254 Ga0307406_10002770
255 Ga0307406_10042138
256 Ga0307407_10008295
257 Ga0307407_10070930
258 Ga0307407_10119187
259 Ga0307412_10000183
260 Ga0307412_10033943
261 Ga0307412_10069169
262 Ga0307412_10084499
263 Ga0307412_10085811
264 Ga0307412_10086785
265 Ga0307412_10091873
266 Ga0307409_100002948
267 Ga0307416_100014842
268 Ga0307416_100086129
269 Ga0307414_10054878
270 Ga0307414_10073250
271 Ga0307414_10141759
272 Ga0307415_100041807
273 Ga0395899_0015760
274 Ga0395900_0067569
275 Ga0395900_0158785
276 Ga0395898_0184577
277 Ga0395901_0088917
278 Ga0395901_0138760
279 Ga0439436_0000640
280 Ga0439436_0007462
281 Ga0439438_002548
282 Ga0439439_0001391
283 Ga0439461_0014954
284 Ga0439466_0011591
285 Ga0439465_0004268
286 Ga0439433_0000103
287 Ga0439433_0002315
288 Ga0439442_000295
289 Ga0439442_000359
290 Ga0439442_000533
291 Ga0439442_001707
292 Ga0439432_001363
293 Ga0439449_0001922
294 Ga0439449_0004580
295 Ga0439449_0009279
296 Ga0439452_006282
297 Ga0439462_0008048
298 Ga0450920_000225
299 Ga0450920_000714
300 Ga0450908_003385
301 Ga0450908_007765
302 Ga0439434_0000234
303 Ga0439434_0001181
304 Ga0450918_000820
305 Ga0466960_0053816
306 Ga0495580_0007774
307 Ga0495582_0011040
308 Ga0495639_0003045
309 Ga0495662_0002676
310 Ga0495664_0003270
311 Ga0495594_0103249
312 Ga0495665_0002445
313 Ga0495665_0008559
314 Ga0495586_0002284
315 Ga0495586_0003554
316 Ga0495587_0000831
317 Ga0495645_0001753
318 Ga0495667_0002277
319 Ga0495656_0054024
320 Ga0495668_0013470
321 Ga0495588_0006552
322 Ga0495588_0011896
323 Ga0495588_0045877
324 Ga0495623_0008507
325 Ga0495600_0131280
326 Ga0495581_0001883
327 Ga0495581_0005310
328 Ga0495604_0042663
329 Ga0495675_0003696
330 Ga0495681_0033791
331 Ga0495593_0028267
332 Ga0496101_0016922
333 Ga0496102_0037404
334 Ga0496102_0071858
335 Ga0496102_0094621
336 Ga0496102_0208477
337 Ga0496102_0214080
338 Ga0496102_0294483
339 Ga0496103_0023637
340 Ga0496103_0053100
341 Ga0496106_0016982
342 Ga0496106_0038948
343 Ga0496106_0051127
344 Ga0496107_0011825
345 Ga0496108_0253665
346 Ga0496109_0071747
347 Ga0496110_0040251
348 Ga0496111_0019041
349 Ga0496112_0016440
350 Ga0496112_0022169
351 Ga0496112_0068044
352 Ga0496113_0125326
353 Ga0496114_0008555
354 Ga0496114_0017350
355 Ga0496114_0147739
356 Ga0496124_0051112
357 Ga0501325_000951
358 Ga0501032_0010567
359 Ga0501032_0099611
360 Ga0501037_0025350
361 Ga0501038_0091682
362 Ga0501070_0010212
363 Ga0501044_0070083
364 nmdc:mga09592_185473_c1
365 2808890960
366 2691513233
367 2775656406
368 2808829316
369 2808830477
370 2808851671
371 2808852255
372 2808875849
373 2808894740
374 2808895691
375 2812317766
376 2812318953
377 2837269357
378 2844852002
379 2857480866
380 2857633350
381 2857740479
382 2868092180
383 2870803207
384 2870805252
385 2904499379
386 2904778482
387 2910810382
388 2919035839
389 2919060535
390 2919392159
391 2919538949
392 2932427530
393 2933418881
394 2939599787
395 2939648189
396 2939677112
397 2945919834
398 2945924264
399 2945944017
400 2945957798
401 2946039194
402 2946039973
403 2946063560
404 2954001204
405 2966921858
406 2974303468
407 8001784167
408 8054111739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20511

PMI_typeI_cat

Phosphomannose isomerase type I, catalytic domain

20

169

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zv0-assembly1.cif.gz_A crystal structure of e264a mutant of phosphomannose isomerase from salmonella typhimurium 0.9192 2 416
5zt4-assembly1.cif.gz_A crystal structure of h99a mutant of phosphomannose isomerase from salmonella typhimurium 0.9186 2 416
5zt5-assembly1.cif.gz_A crystal structure of e134a mutant of phosphomannose isomerase from salmonella typhimurium 0.9171 2 413
5zuw-assembly1.cif.gz_A crystal structure of h99q mutant of phosphomannose isomerase from salmonella typhimurium 0.9136 2 413
5zvx-assembly1.cif.gz_A crystal structure of k86a mutant of phosphomannose isomerase from salmonella typhimurium 0.9131 2 416
ID Description Score Start End Superfamily
af_O05898_1_302_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.936 1 313 2.60.120.10
af_O05898_1_302_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.933 1 313 2.60.120.10
af_Q9FZH5_278_436_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9267 259 414 2.60.120.10
5zt6A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9267 5 294 2.60.120.10
5zt6A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9168 5 294 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1E5KHB0-F1-model_v4 deleted 0.9894 1 420
AF-A0A1E5KHB0-F1-model_v4 deleted 0.987 1 420
AF-A0A4R7LQD5-F1-model_v4 mannose-6-phosphate isomerase (EC 5.3.1.8) 0.9826 1 416 GO:0004476
GO:0005829
GO:0005975
GO:0008270
GO:0009298
AF-A0A0U3R5S3-F1-model_v4 deleted 0.9774 1 416
AF-A0A542R9S2-F1-model_v4 deleted 0.9739 1 416

Map