F312980

General Info

Members Datasets Scaffolds Average Seq Length
204 115 408 136

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0000059|Ga0495686_0000059_144103_144513
Length 136
Sequence VKIDREALEAEIEEKFVSASGPGGQNVNKVASAVQLRFNIKRSALFDDEEKWRIRRALGSRVTTDGDIMIFAQTQRSQQRNREEARDRLAEMLEKAVVKPKKRVATKPSKAAKQRRLDGKXXXXDVKRNRGRVDSD

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
77 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
78 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
79 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
84 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
85 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
86 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
87 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
90 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
99 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
100 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
101 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
102 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
103 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
104 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
105 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
106 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
107 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
108 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
109 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
110 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
111 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
112 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
113 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
114 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
115 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.57
Metatranscriptomes 0
Isolates 3.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.82
Nodule 0
Rhizoplane 0.49
Rhizosphere 86.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0000059 3300047472 Bacteria 239388
2 Ga0070676_10073604 3300005328 Bacteria 2056
3 Ga0070670_100540495 3300005331 Bacteria 1039
4 Ga0070680_100320310 3300005336 Bacteria 1316
5 Ga0070680_100718281 3300005336 Bacteria 860
6 Ga0070682_100261457 3300005337 Bacteria 1253
7 Ga0070682_101001290 3300005337 Bacteria 694
8 Ga0070660_100064707 3300005339 Bacteria 2845
9 Ga0070660_100339187 3300005339 Bacteria 1237
10 Ga0070660_100777490 3300005339 Bacteria 805
11 Ga0070660_100849962 3300005339 Bacteria 768
12 Ga0070660_101933841 3300005339 Bacteria 503
13 Ga0070661_100316185 3300005344 Bacteria 1219
14 Ga0070669_100222683 3300005353 Bacteria 1492
15 Ga0070659_100038166 3300005366 Bacteria 3746
16 Ga0070659_100055658 3300005366 Bacteria 3118
17 Ga0070659_100108046 3300005366 Bacteria 2244
18 Ga0070659_101738692 3300005366 Bacteria 558
19 Ga0070701_10186387 3300005438 Bacteria 1218
20 Ga0070663_100011070 3300005455 Bacteria 5647
21 Ga0070663_100086758 3300005455 Bacteria 2312
22 Ga0070662_100013352 3300005457 Bacteria 5466
23 Ga0070662_100085254 3300005457 Bacteria 2361
24 Ga0070681_10699825 3300005458 Bacteria 929
25 Ga0070698_100686150 3300005471 Bacteria 966
26 Ga0070679_100050905 3300005530 Bacteria 4126
27 Ga0070679_100147115 3300005530 Bacteria 2333
28 Ga0070679_100390086 3300005530 Bacteria 1339
29 Ga0070679_100584269 3300005530 Bacteria 1060
30 Ga0070684_100177742 3300005535 Bacteria 1935
31 Ga0068853_100029781 3300005539 Bacteria 4605
32 Ga0068853_100081081 3300005539 Bacteria 2840
33 Ga0068853_101724602 3300005539 Bacteria 607
34 Ga0068855_100314907 3300005563 Bacteria 1731
35 Ga0068855_101084928 3300005563 Bacteria 838
36 Ga0070664_100030403 3300005564 Bacteria 4506
37 Ga0070664_101800600 3300005564 Bacteria 581
38 Ga0068857_100046630 3300005577 Bacteria 3846
39 Ga0068857_100112053 3300005577 Bacteria 2453
40 Ga0068857_100179898 3300005577 Bacteria 1924
41 Ga0068857_101386103 3300005577 Bacteria 684
42 Ga0068857_102125861 3300005577 Bacteria 551
43 Ga0068854_100005934 3300005578 Bacteria 7737
44 Ga0068856_100070350 3300005614 Bacteria 3461
45 Ga0068856_102351177 3300005614 Bacteria 541
46 Ga0068852_100063123 3300005616 Bacteria 3225
47 Ga0068852_101332071 3300005616 Bacteria 740
48 Ga0068851_10030909 3300005834 Bacteria 2657
49 Ga0068870_10374646 3300005840 Bacteria 920
50 Ga0075366_10013830 3300006195 Bacteria 4599
51 Ga0097621_100107823 3300006237 Bacteria 2351
52 Ga0097621_100324938 3300006237 Bacteria 1363
53 Ga0075370_10202511 3300006353 Bacteria 1171
54 Ga0105243_10515200 3300009148 Bacteria 1136
55 Ga0105246_10000083 3300011119 Bacteria 40197
56 Ga0157373_10022862 3300013100 Bacteria 4534
57 Ga0157373_10974341 3300013100 Bacteria 632
58 Ga0157373_11187873 3300013100 Bacteria 575
59 Ga0157370_10386068 3300013104 Bacteria 1289
60 Ga0157369_10779338 3300013105 Bacteria 983
61 Ga0157372_10120424 3300013307 Bacteria 3014
62 Ga0157380_10053619 3300014326 Bacteria 3198
63 Ga0157380_10797181 3300014326 Bacteria 961
64 Ga0157380_10873672 3300014326 Bacteria 923
65 Ga0157380_12598913 3300014326 Bacteria 572
66 Ga0157377_10199650 3300014745 Bacteria 1269
67 Ga0157376_12424128 3300014969 Bacteria 564
68 Ga0213873_10000021 3300021358 Bacteria 113830
69 Ga0213876_10000050 3300021384 Bacteria 144836
70 Ga0207656_10088175 3300025321 Bacteria 1404
71 Ga0207682_10042317 3300025893 Bacteria 1861
72 Ga0207645_10044212 3300025907 Bacteria 2851
73 Ga0207643_10248723 3300025908 Bacteria 1095
74 Ga0207705_10003114 3300025909 Bacteria 12655
75 Ga0207707_10474549 3300025912 Bacteria 1069
76 Ga0207660_10111644 3300025917 Bacteria 2058
77 Ga0207660_10350885 3300025917 Bacteria 1182
78 Ga0207657_10019415 3300025919 Bacteria 6455
79 Ga0207657_10298423 3300025919 Bacteria 1276
80 Ga0207657_10735216 3300025919 Bacteria 765
81 Ga0207657_10986318 3300025919 Bacteria 647
82 Ga0207649_10313473 3300025920 Bacteria 1150
83 Ga0207649_11637944 3300025920 Bacteria 509
84 Ga0207652_10003381 3300025921 Bacteria 13180
85 Ga0207652_10212575 3300025921 Bacteria 1742
86 Ga0207652_10892999 3300025921 Bacteria 785
87 Ga0207681_10153753 3300025923 Bacteria 1727
88 Ga0207690_10011832 3300025932 Bacteria 5218
89 Ga0207690_10079212 3300025932 Bacteria 2289
90 Ga0207690_10687139 3300025932 Bacteria 841
91 Ga0207690_10761397 3300025932 Bacteria 799
92 Ga0207706_10019850 3300025933 Bacteria 6041
93 Ga0207706_10054973 3300025933 Bacteria 3512
94 Ga0207709_10327091 3300025935 Bacteria 1149
95 Ga0207661_10583973 3300025944 Bacteria 1025
96 Ga0207679_10030185 3300025945 Bacteria 3783
97 Ga0207679_10568759 3300025945 Bacteria 1019
98 Ga0207667_11317436 3300025949 Bacteria 698
99 Ga0207640_10001711 3300025981 Bacteria 11766
100 Ga0207640_10668522 3300025981 Bacteria 887
101 Ga0207639_10021753 3300026041 Bacteria 4610
102 Ga0207639_10559175 3300026041 Bacteria 1051
103 Ga0207678_10003188 3300026067 Bacteria 14838
104 Ga0207678_10082817 3300026067 Bacteria 2745
105 Ga0207702_10091474 3300026078 Bacteria 2664
106 Ga0207702_11470987 3300026078 Bacteria 675
107 Ga0207674_10039278 3300026116 Bacteria 4908
108 Ga0207674_10212432 3300026116 Bacteria 1884
109 Ga0209974_10044826 3300027876 Bacteria 1476
110 Ga0307408_100188696 3300031548 Bacteria 1659
111 Ga0307408_100795881 3300031548 Bacteria 858
112 Ga0307408_100916333 3300031548 Bacteria 803
113 Ga0307508_10009530 3300031616 Bacteria 8923
114 Ga0307405_10345680 3300031731 Bacteria 1145
115 Ga0307405_11133427 3300031731 Bacteria 674
116 Ga0307413_10077756 3300031824 Bacteria 2114
117 Ga0307413_10202707 3300031824 Bacteria 1434
118 Ga0307413_10663531 3300031824 Bacteria 862
119 Ga0307413_11032876 3300031824 Bacteria 706
120 Ga0307410_10136863 3300031852 Bacteria 1806
121 Ga0307410_10231571 3300031852 Bacteria 1427
122 Ga0307407_10044357 3300031903 Bacteria 2505
123 Ga0307407_10157992 3300031903 Bacteria 1481
124 Ga0307407_10198159 3300031903 Bacteria 1344
125 Ga0307407_10242585 3300031903 Bacteria 1230
126 Ga0307407_10446536 3300031903 Bacteria 938
127 Ga0307412_10024646 3300031911 Bacteria 3715
128 Ga0307412_10156517 3300031911 Bacteria 1687
129 Ga0307412_10831843 3300031911 Bacteria 804
130 Ga0307412_11100340 3300031911 Bacteria 707
131 Ga0307409_100084500 3300031995 Bacteria 2577
132 Ga0307409_100117928 3300031995 Bacteria 2241
133 Ga0307409_100119858 3300031995 Bacteria 2226
134 Ga0307409_100882104 3300031995 Bacteria 907
135 Ga0307409_100940009 3300031995 Bacteria 880
136 Ga0307416_100020046 3300032002 Bacteria 4760
137 Ga0307416_100408959 3300032002 Bacteria 1397
138 Ga0307416_100539951 3300032002 Bacteria 1237
139 Ga0307414_10060797 3300032004 Bacteria 2673
140 Ga0307414_10063389 3300032004 Bacteria 2627
141 Ga0307414_10282003 3300032004 Bacteria 1396
142 Ga0307414_10453328 3300032004 Bacteria 1125
143 Ga0307414_11830133 3300032004 Bacteria 566
144 Ga0307411_10486634 3300032005 Bacteria 1040
145 Ga0307411_10684548 3300032005 Bacteria 891
146 Ga0307415_100024649 3300032126 Bacteria 3761
147 Ga0307415_100214468 3300032126 Bacteria 1538
148 Ga0307415_100371120 3300032126 Bacteria 1212
149 Ga0307415_100556582 3300032126 Bacteria 1013
150 Ga0307415_100742635 3300032126 Bacteria 890
151 Ga0307415_100908492 3300032126 Bacteria 812
152 Ga0307415_102003996 3300032126 Bacteria 564
153 Ga0436365_0526794 3300039437 Bacteria 17369
154 Ga0436362_0254302 3300039453 Bacteria 32546
155 Ga0451849_0446728 3300041505 Bacteria 804
156 Ga0451853_1739792 3300041512 Bacteria 1347
157 Ga0439462_0000965 3300042015 Bacteria 6115
158 Ga0451577_0789426 3300042876 Bacteria 858
159 Ga0451576_0463723 3300045051 Bacteria 1330
160 Ga0495653_0080485 3300046463 Bacteria 2410
161 Ga0495620_0087660 3300046515 Bacteria 1252
162 Ga0495598_0002220 3300046537 Bacteria 3990
163 Ga0495598_0153238 3300046537 Bacteria 806
164 Ga0495621_0001867 3300046539 Bacteria 5535
165 Ga0495621_0130191 3300046539 Bacteria 978
166 Ga0495656_0213896 3300046615 Bacteria 962
167 Ga0495671_0351028 3300046692 Bacteria 707
168 Ga0496105_0588599 3300048908 Bacteria 865
169 Ga0496125_0255028 3300048928 Bacteria 1104
170 Ga0501031_0233032 3300049568 Bacteria 1198
171 Ga0501033_0292329 3300049570 Bacteria 1149
172 Ga0501034_0310901 3300049571 Bacteria 1510
173 Ga0501034_0448529 3300049571 Bacteria 1208
174 Ga0501043_0549676 3300049579 Bacteria 858
175 Ga0501043_0633412 3300049579 Bacteria 787
176 Ga0501047_0981657 3300049581 Bacteria 658
177 Ga0501069_0275034 3300049585 Bacteria 985
178 Ga0501035_0419519 3300049822 Bacteria 1111
179 Ga0501035_0510879 3300049822 Bacteria 988
180 Ga0501044_0948115 3300049823 Bacteria 734
181 Ga0501044_1013786 3300049823 Bacteria 702
182 nmdc:mga0k408_148910_c1 3300050493 Bacteria 1393
183 nmdc:mga0k408_401262_c1 3300050493 Bacteria 816
184 nmdc:mga0k408_68322_c1 3300050493 Bacteria 2073
185 nmdc:mga07m45_302458_c1 3300050496 Bacteria 930
186 Ga0500643_007702 3300053087 Bacteria 4308
187 Ga0500643_103426 3300053087 Bacteria 772
188 Ga0500607_000152 3300053121 Bacteria 59345
189 Ga0500618_009245 3300053125 Bacteria 2700
190 Ga0500618_015540 3300053125 Bacteria 1921
191 Ga0500559_0000524 3300053136 Bacteria 26811
192 Ga0500559_0007928 3300053136 Bacteria 4681
193 Ga0500590_050555 3300053148 Bacteria 2114
194 Ga0500624_000065 3300053157 Bacteria 63944
195 Ga0500636_0063641 3300053177 Bacteria 2149
196 Ga0500637_0088706 3300053178 Bacteria 1789
197 Ga0500645_001889 3300053730 Bacteria 10000
198 2643951320 2643221588 Bacteria 3692460
199 2848299594 2848297114 Bacteria 3608511
200 2882808983 2882806704 Bacteria 3007728
201 2895882276 2895880812 Bacteria 11255272
202 2896186377 2896184354 Bacteria 3258548
203 2896253724 2896253425 Bacteria 3418029
204 3000867270 3000865235 Bacteria 3106258
205 Ga0495686_0000059
206 Ga0070676_10073604
207 Ga0070670_100540495
208 Ga0070680_100320310
209 Ga0070680_100718281
210 Ga0070682_100261457
211 Ga0070682_101001290
212 Ga0070660_100064707
213 Ga0070660_100339187
214 Ga0070660_100777490
215 Ga0070660_100849962
216 Ga0070660_101933841
217 Ga0070661_100316185
218 Ga0070669_100222683
219 Ga0070659_100038166
220 Ga0070659_100055658
221 Ga0070659_100108046
222 Ga0070659_101738692
223 Ga0070701_10186387
224 Ga0070663_100011070
225 Ga0070663_100086758
226 Ga0070662_100013352
227 Ga0070662_100085254
228 Ga0070681_10699825
229 Ga0070698_100686150
230 Ga0070679_100050905
231 Ga0070679_100147115
232 Ga0070679_100390086
233 Ga0070679_100584269
234 Ga0070684_100177742
235 Ga0068853_100029781
236 Ga0068853_100081081
237 Ga0068853_101724602
238 Ga0068855_100314907
239 Ga0068855_101084928
240 Ga0070664_100030403
241 Ga0070664_101800600
242 Ga0068857_100046630
243 Ga0068857_100112053
244 Ga0068857_100179898
245 Ga0068857_101386103
246 Ga0068857_102125861
247 Ga0068854_100005934
248 Ga0068856_100070350
249 Ga0068856_102351177
250 Ga0068852_100063123
251 Ga0068852_101332071
252 Ga0068851_10030909
253 Ga0068870_10374646
254 Ga0075366_10013830
255 Ga0097621_100107823
256 Ga0097621_100324938
257 Ga0075370_10202511
258 Ga0105243_10515200
259 Ga0105246_10000083
260 Ga0157373_10022862
261 Ga0157373_10974341
262 Ga0157373_11187873
263 Ga0157370_10386068
264 Ga0157369_10779338
265 Ga0157372_10120424
266 Ga0157380_10053619
267 Ga0157380_10797181
268 Ga0157380_10873672
269 Ga0157380_12598913
270 Ga0157377_10199650
271 Ga0157376_12424128
272 Ga0213873_10000021
273 Ga0213876_10000050
274 Ga0207656_10088175
275 Ga0207682_10042317
276 Ga0207645_10044212
277 Ga0207643_10248723
278 Ga0207705_10003114
279 Ga0207707_10474549
280 Ga0207660_10111644
281 Ga0207660_10350885
282 Ga0207657_10019415
283 Ga0207657_10298423
284 Ga0207657_10735216
285 Ga0207657_10986318
286 Ga0207649_10313473
287 Ga0207649_11637944
288 Ga0207652_10003381
289 Ga0207652_10212575
290 Ga0207652_10892999
291 Ga0207681_10153753
292 Ga0207690_10011832
293 Ga0207690_10079212
294 Ga0207690_10687139
295 Ga0207690_10761397
296 Ga0207706_10019850
297 Ga0207706_10054973
298 Ga0207709_10327091
299 Ga0207661_10583973
300 Ga0207679_10030185
301 Ga0207679_10568759
302 Ga0207667_11317436
303 Ga0207640_10001711
304 Ga0207640_10668522
305 Ga0207639_10021753
306 Ga0207639_10559175
307 Ga0207678_10003188
308 Ga0207678_10082817
309 Ga0207702_10091474
310 Ga0207702_11470987
311 Ga0207674_10039278
312 Ga0207674_10212432
313 Ga0209974_10044826
314 Ga0307408_100188696
315 Ga0307408_100795881
316 Ga0307408_100916333
317 Ga0307508_10009530
318 Ga0307405_10345680
319 Ga0307405_11133427
320 Ga0307413_10077756
321 Ga0307413_10202707
322 Ga0307413_10663531
323 Ga0307413_11032876
324 Ga0307410_10136863
325 Ga0307410_10231571
326 Ga0307407_10044357
327 Ga0307407_10157992
328 Ga0307407_10198159
329 Ga0307407_10242585
330 Ga0307407_10446536
331 Ga0307412_10024646
332 Ga0307412_10156517
333 Ga0307412_10831843
334 Ga0307412_11100340
335 Ga0307409_100084500
336 Ga0307409_100117928
337 Ga0307409_100119858
338 Ga0307409_100882104
339 Ga0307409_100940009
340 Ga0307416_100020046
341 Ga0307416_100408959
342 Ga0307416_100539951
343 Ga0307414_10060797
344 Ga0307414_10063389
345 Ga0307414_10282003
346 Ga0307414_10453328
347 Ga0307414_11830133
348 Ga0307411_10486634
349 Ga0307411_10684548
350 Ga0307415_100024649
351 Ga0307415_100214468
352 Ga0307415_100371120
353 Ga0307415_100556582
354 Ga0307415_100742635
355 Ga0307415_100908492
356 Ga0307415_102003996
357 Ga0436365_0526794
358 Ga0436362_0254302
359 Ga0451849_0446728
360 Ga0451853_1739792
361 Ga0439462_0000965
362 Ga0451577_0789426
363 Ga0451576_0463723
364 Ga0495653_0080485
365 Ga0495620_0087660
366 Ga0495598_0002220
367 Ga0495598_0153238
368 Ga0495621_0001867
369 Ga0495621_0130191
370 Ga0495656_0213896
371 Ga0495671_0351028
372 Ga0496105_0588599
373 Ga0496125_0255028
374 Ga0501031_0233032
375 Ga0501033_0292329
376 Ga0501034_0310901
377 Ga0501034_0448529
378 Ga0501043_0549676
379 Ga0501043_0633412
380 Ga0501047_0981657
381 Ga0501069_0275034
382 Ga0501035_0419519
383 Ga0501035_0510879
384 Ga0501044_0948115
385 Ga0501044_1013786
386 nmdc:mga0k408_148910_c1
387 nmdc:mga0k408_401262_c1
388 nmdc:mga0k408_68322_c1
389 nmdc:mga07m45_302458_c1
390 Ga0500643_007702
391 Ga0500643_103426
392 Ga0500607_000152
393 Ga0500618_009245
394 Ga0500618_015540
395 Ga0500559_0000524
396 Ga0500559_0007928
397 Ga0500590_050555
398 Ga0500624_000065
399 Ga0500636_0063641
400 Ga0500637_0088706
401 Ga0500645_001889
402 2643951320
403 2848299594
404 2882808983
405 2895882276
406 2896186377
407 2896253724
408 3000867270

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00472

RF-1

RF-1 domain

1

133

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d8l-assembly1.cif.gz_Y yeast mitochondrial small subunit assembly intermediate (state 3) 0.8569 15 98
7pnw-assembly1.cif.gz_1 mouse mitochondrial ribosome small subunit lacking m5u modification 0.8079 10 102
6h4n-assembly1.cif.gz_x structure of a hibernating 100s ribosome reveals an inactive conformation of the ribosomal protein s1 - 70s hibernating e. coli ribosome 0.8008 36 97
8apo-assembly1.cif.gz_BA structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites 0.7985 14 98
6nf8-assembly1.cif.gz_k structure of human mitochondrial translation initiation factor 3 bound to the small ribosomal subunit -class i 0.7698 14 109
ID Description Score Start End Superfamily
af_A0A0R0GKX2_1_61_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8321 40 97 3.30.160.20
af_Q5AI30_155_260_3.30.1460.20 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.8312 10 98 3.30.1460.20
af_Q54WN8_1070_1196_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8006 14 112 3.30.160.20
af_A0A0R0GKX2_1_61_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7873 40 97 3.30.160.20
af_Q8IEJ8_191_280_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.772 15 99 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A352HBL5-F1-model_v4 deleted 0.8884 7 101
AF-A0A3D2E370-F1-model_v4 deleted 0.8761 7 90
AF-A0A7Z9SFB3-F1-model_v4 Aminoacyl-tRNA hydrolase 0.8756 13 104 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-A0A3D2AY38-F1-model_v4 Aminoacyl-tRNA hydrolase 0.8571 13 105 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-A0A352HBL5-F1-model_v4 deleted 0.854 7 101

Map