F312844

General Info

Members Datasets Scaffolds Average Seq Length
204 127 408 159

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0064846|Ga0466965_0064846_792_1283
Length 163
Sequence MDLVAIEQIRQLKYRYFRSLDMKDWDEFGDCLAEDVVARYGTQAMDKPLHFDNRADVVEFMSGSLGNGIISVHIASHPEIEVAGDPGDTATGSWGFEDTVIVPDFKVMIRGGGYYRDEYRKDPDGKWRIASTSYDRIYEAMTSLDDTPSFKLIANRWDPALRH

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
9 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
25 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
34 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
35 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
37 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
38 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
45 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
46 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
47 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
48 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
49 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
50 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
51 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
52 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
53 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
54 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
55 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
56 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
57 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
58 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
59 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
60 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
71 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
72 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
73 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
74 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
75 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
76 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
77 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
78 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
79 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
80 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
81 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
82 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
83 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
84 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
85 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
86 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
87 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
88 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
89 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
90 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
91 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
97 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
98 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
101 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
102 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
103 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
104 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
105 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
106 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
107 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
108 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
109 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
110 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
111 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
112 2643221576 Nocardioides sp. Root614 Isolate Unclassified
113 2643221590 Nocardioides sp. Root682 Isolate Unclassified
114 2643221604 Nocardioides sp. Root190 Isolate Unclassified
115 2643221617 Nocardioides sp. Root79 Isolate Unclassified
116 2643221620 Nocardioides sp. Root240 Isolate Unclassified
117 2643221692 Nocardia sp. Root136 Isolate Unclassified
118 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
119 2738541305 Nocardioides sp. CF167 Isolate Unclassified
120 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
121 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
122 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
123 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
124 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
125 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
126 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
127 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.67
Metatranscriptomes 0
Isolates 8.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 37.25
Nodule 0
Rhizoplane 8.33
Rhizosphere 37.75
Stem 0
Stem Tuber 0
Unclassified 1.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0064846 3300044683 Bacteria 1829
2 Ga0055540_1000003 3300003792 Bacteria 428375
3 Ga0070682_100218496 3300005337 Bacteria 1355
4 Ga0070667_100027482 3300005367 Bacteria 4734
5 Ga0070667_100415740 3300005367 Bacteria 1225
6 Ga0070698_100735259 3300005471 Bacteria 929
7 Ga0070665_101602251 3300005548 Bacteria 659
8 Ga0068856_100217218 3300005614 Bacteria 1927
9 Ga0068859_100142310 3300005617 Bacteria 2472
10 Ga0068860_100000410 3300005843 Bacteria 55852
11 Ga0075365_10000073 3300006038 Bacteria 30164
12 Ga0075365_10039800 3300006038 Bacteria 3063
13 Ga0075365_10046132 3300006038 Bacteria 2861
14 Ga0075365_10076623 3300006038 Bacteria 2258
15 Ga0075365_10092318 3300006038 Bacteria 2064
16 Ga0075365_10098596 3300006038 Bacteria 1999
17 Ga0075365_10100014 3300006038 Bacteria 1985
18 Ga0075365_10121765 3300006038 Bacteria 1800
19 Ga0075365_10127663 3300006038 Bacteria 1758
20 Ga0075365_10194067 3300006038 Bacteria 1421
21 Ga0075365_10250893 3300006038 Bacteria 1243
22 Ga0075365_10261249 3300006038 Bacteria 1217
23 Ga0075365_10729293 3300006038 Bacteria 700
24 Ga0075368_10008023 3300006042 Bacteria 3745
25 Ga0075368_10009338 3300006042 Bacteria 3526
26 Ga0075363_100000722 3300006048 Bacteria 11225
27 Ga0075363_100003246 3300006048 Bacteria 6877
28 Ga0075363_100130855 3300006048 Bacteria 1407
29 Ga0075363_100173736 3300006048 Bacteria 1224
30 Ga0075363_100292803 3300006048 Bacteria 944
31 Ga0075363_100300393 3300006048 Bacteria 931
32 Ga0075363_100382184 3300006048 Bacteria 826
33 Ga0075364_10036312 3300006051 Bacteria 3185
34 Ga0075364_10040378 3300006051 Unclassified 3026
35 Ga0075364_10051810 3300006051 Bacteria 2681
36 Ga0075364_10167011 3300006051 Bacteria 1487
37 Ga0075364_10191350 3300006051 Bacteria 1386
38 Ga0075364_10219416 3300006051 Bacteria 1290
39 Ga0075364_10510828 3300006051 Bacteria 821
40 Ga0075364_10742489 3300006051 Bacteria 670
41 Ga0075362_10001593 3300006177 Bacteria 7354
42 Ga0075362_10030114 3300006177 Bacteria 2343
43 Ga0075367_10001944 3300006178 Bacteria 9175
44 Ga0075367_10022548 3300006178 Bacteria 3533
45 Ga0075367_10076943 3300006178 Bacteria 2014
46 Ga0075367_10223773 3300006178 Bacteria 1178
47 Ga0075367_10375616 3300006178 Bacteria 898
48 Ga0097621_100811700 3300006237 Bacteria 867
49 Ga0075370_10049996 3300006353 Bacteria 2371
50 Ga0075370_10056863 3300006353 Bacteria 2223
51 Ga0075370_10090473 3300006353 Bacteria 1765
52 Ga0097620_100142307 3300006931 Bacteria 2472
53 Ga0105243_10000320 3300009148 Bacteria 52858
54 Ga0105237_10067954 3300009545 Bacteria 3558
55 Ga0105238_11552804 3300009551 Bacteria 691
56 Ga0105249_10219863 3300009553 Bacteria 1869
57 Ga0105239_10026045 3300010375 Bacteria 6439
58 Ga0105239_11887764 3300010375 Bacteria 693
59 Ga0157322_1030166 3300012490 Bacteria 574
60 Ga0209051_1000011 3300025303 Bacteria 610828
61 Ga0207705_10322228 3300025909 Bacteria 1188
62 Ga0207671_10022425 3300025914 Bacteria 4775
63 Ga0207709_10002606 3300025935 Bacteria 11242
64 Ga0207667_10274939 3300025949 Bacteria 1722
65 Ga0207712_10126867 3300025961 Bacteria 1938
66 Ga0207658_10000502 3300025986 Bacteria 35835
67 Ga0207658_10017284 3300025986 Bacteria 4969
68 Ga0207702_10043311 3300026078 Bacteria 3779
69 Ga0209813_10000204 3300027866 Bacteria 18367
70 Ga0209813_10004352 3300027866 Bacteria 3379
71 Ga0207428_10781306 3300027907 Bacteria 679
72 Ga0268264_10000155 3300028381 Bacteria 156029
73 Ga0316181_1130103 3300030744 Bacteria 1254
74 Ga0316182_1189128 3300030745 Bacteria 3867
75 Ga0265327_10000630 3300031251 Bacteria 57536
76 Ga0307416_100526526 3300032002 Bacteria 1251
77 Ga0395899_0404036 3300037312 Bacteria 903
78 Ga0395900_0049084 3300037418 Bacteria 4348
79 Ga0395900_1139872 3300037418 Bacteria 696
80 Ga0395898_0089843 3300037466 Bacteria 2956
81 Ga0395905_0686781 3300037471 Bacteria 926
82 Ga0436364_0746801 3300037853 Bacteria 1154
83 Ga0436365_1439766 3300039437 Bacteria 1332
84 Ga0439465_0044845 3300041413 Unclassified 1437
85 Ga0439465_0271258 3300041413 Bacteria 631
86 Ga0451793_1394118 3300041452 Bacteria 3022
87 Ga0451804_0609326 3300041463 Bacteria 715
88 Ga0451833_0124552 3300041491 Bacteria 7970
89 Ga0451839_0764649 3300041496 Bacteria 662
90 Ga0451843_1366306 3300041509 Bacteria 639
91 Ga0451853_0619883 3300041512 Bacteria 813
92 Ga0439431_0004455 3300041997 Bacteria 3080
93 Ga0439442_005328 3300042002 Bacteria 2574
94 Ga0439445_0035545 3300042004 Bacteria 1309
95 Ga0439432_056207 3300042006 Bacteria 1220
96 Ga0450906_041611 3300042145 Bacteria 811
97 Ga0439446_0001844 3300042156 Bacteria 4962
98 Ga0439434_0001447 3300042435 Bacteria 6821
99 Ga0466972_0075110 3300044658 Bacteria 1611
100 Ga0466972_0133640 3300044658 Bacteria 1168
101 Ga0466965_0013005 3300044683 Bacteria 3921
102 Ga0466966_0089288 3300044684 Bacteria 1915
103 Ga0466963_0444726 3300044694 Bacteria 914
104 Ga0466971_0030519 3300044719 Bacteria 2412
105 Ga0466971_0063715 3300044719 Bacteria 1669
106 Ga0466970_0036955 3300044765 Bacteria 2587
107 Ga0466970_0055906 3300044765 Bacteria 2108
108 Ga0466957_0090152 3300044842 Bacteria 1920
109 Ga0466957_0559416 3300044842 Bacteria 797
110 Ga0466960_0046919 3300044901 Bacteria 2070
111 Ga0466959_0675883 3300045049 Bacteria 693
112 Ga0466958_0015072 3300045836 Bacteria 4423
113 Ga0466967_0132036 3300045976 Bacteria 2319
114 Ga0466967_0507522 3300045976 Bacteria 1184
115 Ga0496100_0001764 3300048903 Bacteria 10792
116 Ga0496101_0000099 3300048904 Bacteria 90235
117 Ga0496102_0006622 3300048905 Bacteria 9899
118 Ga0496103_0001890 3300048906 Bacteria 13618
119 Ga0496106_0007217 3300048909 Bacteria 8209
120 Ga0496107_0001279 3300048910 Bacteria 15392
121 Ga0496108_0006154 3300048911 Bacteria 9705
122 Ga0496109_0009440 3300048912 Bacteria 8317
123 Ga0496110_0005267 3300048913 Bacteria 10123
124 Ga0496110_0123490 3300048913 Bacteria 2334
125 Ga0496110_0316950 3300048913 Bacteria 1420
126 Ga0496114_0000774 3300048917 Bacteria 23896
127 Ga0496114_0440929 3300048917 Bacteria 1153
128 Ga0496114_0640543 3300048917 Bacteria 935
129 Ga0496115_0084568 3300048918 Bacteria 2587
130 Ga0496116_0002510 3300048919 Bacteria 19213
131 Ga0496116_0138082 3300048919 Bacteria 1376
132 Ga0496117_0002964 3300048920 Bacteria 20489
133 Ga0496117_0031052 3300048920 Bacteria 4086
134 Ga0496118_0004554 3300048921 Bacteria 16346
135 Ga0496118_0028057 3300048921 Bacteria 4749
136 Ga0496119_0010192 3300048922 Bacteria 7936
137 Ga0496119_0164546 3300048922 Bacteria 1176
138 Ga0496120_0067750 3300048923 Bacteria 1971
139 Ga0496121_0000016 3300048924 Bacteria 562911
140 Ga0496122_0000284 3300048925 Bacteria 113244
141 Ga0496123_0003476 3300048926 Bacteria 17611
142 Ga0496124_0000015 3300048927 Bacteria 460700
143 Ga0496125_0000021 3300048928 Bacteria 460688
144 Ga0496126_0000015 3300048929 Bacteria 663212
145 Ga0501034_0310387 3300049571 Bacteria 1512
146 Ga0501036_0310426 3300049572 Bacteria 1318
147 Ga0501039_0299483 3300049575 Bacteria 1264
148 Ga0501042_0882416 3300049578 Bacteria 651
149 Ga0501070_0711605 3300049586 Bacteria 794
150 Ga0501070_1141361 3300049586 Bacteria 600
151 Ga0501071_0355176 3300049587 Bacteria 1116
152 Ga0501071_0920412 3300049587 Bacteria 675
153 Ga0501076_0051829 3300049592 Bacteria 3249
154 Ga0501079_0747369 3300049741 Bacteria 770
155 nmdc:mga03683_126972_c1 3300050489 Bacteria 1138
156 nmdc:mga03683_691_c1 3300050489 Bacteria 9692
157 nmdc:mga03n38_12101_c1 3300050490 Bacteria 3236
158 nmdc:mga03n38_18037_c1 3300050490 Bacteria 2778
159 nmdc:mga03n38_23006_c1 3300050490 Bacteria 2530
160 nmdc:mga03n38_235200_c1 3300050490 Bacteria 962
161 nmdc:mga03n38_43_c1 3300050490 Bacteria 26736
162 nmdc:mga03n38_450701_c1 3300050490 Bacteria 716
163 nmdc:mga00v17_250_c1 3300050491 Bacteria 31587
164 nmdc:mga00v17_25576_c1 3300050491 Unclassified 3432
165 nmdc:mga00v17_310584_c1 3300050491 Bacteria 1024
166 nmdc:mga00v17_416396_c1 3300050491 Bacteria 873
167 nmdc:mga00v17_536833_c1 3300050491 Bacteria 757
168 nmdc:mga0yw44_127775_c1 3300050492 Bacteria 1643
169 nmdc:mga0yw44_144_c1 3300050492 Bacteria 24507
170 nmdc:mga0yw44_200404_c1 3300050492 Bacteria 1318
171 nmdc:mga0yw44_232326_c1 3300050492 Bacteria 1224
172 nmdc:mga0yw44_289569_c1 3300050492 Bacteria 1096
173 nmdc:mga0yw44_340090_c1 3300050492 Bacteria 1009
174 nmdc:mga0yw44_560841_c1 3300050492 Bacteria 776
175 nmdc:mga0yw44_671231_c1 3300050492 Bacteria 704
176 nmdc:mga0yw44_8137_c1 3300050492 Bacteria 5208
177 nmdc:mga06z11_363_c1 3300050494 Bacteria 17120
178 nmdc:mga04h51_10554_c1 3300050495 Bacteria 2540
179 nmdc:mga04h51_175_c1 3300050495 Bacteria 18436
180 nmdc:mga04h51_188130_c1 3300050495 Unclassified 806
181 nmdc:mga07m45_140918_c1 3300050496 Bacteria 1396
182 nmdc:mga07m45_168235_c1 3300050496 Bacteria 1273
183 nmdc:mga07m45_654_c1 3300050496 Bacteria 14712
184 Ga0500644_0093148 3300053088 Bacteria 1132
185 Ga0500554_064055 3300053102 Bacteria 1185
186 Ga0500604_0075128 3300053151 Bacteria 1084
187 Ga0466962_0243838 3300061719 Bacteria 882
188 2552112877 2551306166 Bacteria 9731570
189 2643891661 2643221576 Bacteria 5214352
190 2643960709 2643221590 Bacteria 5214697
191 2644035453 2643221604 Bacteria 5014917
192 2644098797 2643221617 Bacteria 5139111
193 2644114678 2643221620 Bacteria 5134593
194 2644516466 2643221692 Bacteria 7282860
195 2738667046 2738541264 Bacteria 5935393
196 2738869746 2738541305 Bacteria 4910150
197 2739145890 2738541356 Bacteria 5935017
198 2739204741 2738543005 Bacteria 5278128
199 2739240466 2738543011 Bacteria 5731169
200 2744956439 2744054611 Bacteria 5611514
201 2812333068 2811994874 Bacteria 5367947
202 2889303768 2889300758 Bacteria 5690814
203 2928147351 2928142448 Bacteria 5288925
204 2939747553 2939743619 Bacteria 5762299
205 Ga0466965_0064846
206 Ga0055540_1000003
207 Ga0070682_100218496
208 Ga0070667_100027482
209 Ga0070667_100415740
210 Ga0070698_100735259
211 Ga0070665_101602251
212 Ga0068856_100217218
213 Ga0068859_100142310
214 Ga0068860_100000410
215 Ga0075365_10000073
216 Ga0075365_10039800
217 Ga0075365_10046132
218 Ga0075365_10076623
219 Ga0075365_10092318
220 Ga0075365_10098596
221 Ga0075365_10100014
222 Ga0075365_10121765
223 Ga0075365_10127663
224 Ga0075365_10194067
225 Ga0075365_10250893
226 Ga0075365_10261249
227 Ga0075365_10729293
228 Ga0075368_10008023
229 Ga0075368_10009338
230 Ga0075363_100000722
231 Ga0075363_100003246
232 Ga0075363_100130855
233 Ga0075363_100173736
234 Ga0075363_100292803
235 Ga0075363_100300393
236 Ga0075363_100382184
237 Ga0075364_10036312
238 Ga0075364_10040378
239 Ga0075364_10051810
240 Ga0075364_10167011
241 Ga0075364_10191350
242 Ga0075364_10219416
243 Ga0075364_10510828
244 Ga0075364_10742489
245 Ga0075362_10001593
246 Ga0075362_10030114
247 Ga0075367_10001944
248 Ga0075367_10022548
249 Ga0075367_10076943
250 Ga0075367_10223773
251 Ga0075367_10375616
252 Ga0097621_100811700
253 Ga0075370_10049996
254 Ga0075370_10056863
255 Ga0075370_10090473
256 Ga0097620_100142307
257 Ga0105243_10000320
258 Ga0105237_10067954
259 Ga0105238_11552804
260 Ga0105249_10219863
261 Ga0105239_10026045
262 Ga0105239_11887764
263 Ga0157322_1030166
264 Ga0209051_1000011
265 Ga0207705_10322228
266 Ga0207671_10022425
267 Ga0207709_10002606
268 Ga0207667_10274939
269 Ga0207712_10126867
270 Ga0207658_10000502
271 Ga0207658_10017284
272 Ga0207702_10043311
273 Ga0209813_10000204
274 Ga0209813_10004352
275 Ga0207428_10781306
276 Ga0268264_10000155
277 Ga0316181_1130103
278 Ga0316182_1189128
279 Ga0265327_10000630
280 Ga0307416_100526526
281 Ga0395899_0404036
282 Ga0395900_0049084
283 Ga0395900_1139872
284 Ga0395898_0089843
285 Ga0395905_0686781
286 Ga0436364_0746801
287 Ga0436365_1439766
288 Ga0439465_0044845
289 Ga0439465_0271258
290 Ga0451793_1394118
291 Ga0451804_0609326
292 Ga0451833_0124552
293 Ga0451839_0764649
294 Ga0451843_1366306
295 Ga0451853_0619883
296 Ga0439431_0004455
297 Ga0439442_005328
298 Ga0439445_0035545
299 Ga0439432_056207
300 Ga0450906_041611
301 Ga0439446_0001844
302 Ga0439434_0001447
303 Ga0466972_0075110
304 Ga0466972_0133640
305 Ga0466965_0013005
306 Ga0466966_0089288
307 Ga0466963_0444726
308 Ga0466971_0030519
309 Ga0466971_0063715
310 Ga0466970_0036955
311 Ga0466970_0055906
312 Ga0466957_0090152
313 Ga0466957_0559416
314 Ga0466960_0046919
315 Ga0466959_0675883
316 Ga0466958_0015072
317 Ga0466967_0132036
318 Ga0466967_0507522
319 Ga0496100_0001764
320 Ga0496101_0000099
321 Ga0496102_0006622
322 Ga0496103_0001890
323 Ga0496106_0007217
324 Ga0496107_0001279
325 Ga0496108_0006154
326 Ga0496109_0009440
327 Ga0496110_0005267
328 Ga0496110_0123490
329 Ga0496110_0316950
330 Ga0496114_0000774
331 Ga0496114_0440929
332 Ga0496114_0640543
333 Ga0496115_0084568
334 Ga0496116_0002510
335 Ga0496116_0138082
336 Ga0496117_0002964
337 Ga0496117_0031052
338 Ga0496118_0004554
339 Ga0496118_0028057
340 Ga0496119_0010192
341 Ga0496119_0164546
342 Ga0496120_0067750
343 Ga0496121_0000016
344 Ga0496122_0000284
345 Ga0496123_0003476
346 Ga0496124_0000015
347 Ga0496125_0000021
348 Ga0496126_0000015
349 Ga0501034_0310387
350 Ga0501036_0310426
351 Ga0501039_0299483
352 Ga0501042_0882416
353 Ga0501070_0711605
354 Ga0501070_1141361
355 Ga0501071_0355176
356 Ga0501071_0920412
357 Ga0501076_0051829
358 Ga0501079_0747369
359 nmdc:mga03683_126972_c1
360 nmdc:mga03683_691_c1
361 nmdc:mga03n38_12101_c1
362 nmdc:mga03n38_18037_c1
363 nmdc:mga03n38_23006_c1
364 nmdc:mga03n38_235200_c1
365 nmdc:mga03n38_43_c1
366 nmdc:mga03n38_450701_c1
367 nmdc:mga00v17_250_c1
368 nmdc:mga00v17_25576_c1
369 nmdc:mga00v17_310584_c1
370 nmdc:mga00v17_416396_c1
371 nmdc:mga00v17_536833_c1
372 nmdc:mga0yw44_127775_c1
373 nmdc:mga0yw44_144_c1
374 nmdc:mga0yw44_200404_c1
375 nmdc:mga0yw44_232326_c1
376 nmdc:mga0yw44_289569_c1
377 nmdc:mga0yw44_340090_c1
378 nmdc:mga0yw44_560841_c1
379 nmdc:mga0yw44_671231_c1
380 nmdc:mga0yw44_8137_c1
381 nmdc:mga06z11_363_c1
382 nmdc:mga04h51_10554_c1
383 nmdc:mga04h51_175_c1
384 nmdc:mga04h51_188130_c1
385 nmdc:mga07m45_140918_c1
386 nmdc:mga07m45_168235_c1
387 nmdc:mga07m45_654_c1
388 Ga0500644_0093148
389 Ga0500554_064055
390 Ga0500604_0075128
391 Ga0466962_0243838
392 2552112877
393 2643891661
394 2643960709
395 2644035453
396 2644098797
397 2644114678
398 2644516466
399 2738667046
400 2738869746
401 2739145890
402 2739204741
403 2739240466
404 2744956439
405 2812333068
406 2889303768
407 2928147351
408 2939747553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13577

SnoaL_4

SnoaL-like domain

1

133

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ef8-assembly1.cif.gz_A crystal structure of putative scytalone dehydratase (yp_496742.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.914 2 138
4leh-assembly1.cif.gz_C crystal structure of a bile-acid 7-alpha dehydratase (closci_03134) from clostridium scindens atcc 35704 at 2.90 a resolution 0.9041 4 153
4l8p-assembly1.cif.gz_A crystal structure of a bile-acid 7-alpha dehydratase (clohir_00079) from clostridium hiranonis dsm 13275 at 1.60 a resolution 0.9006 3 153
4l8o-assembly1.cif.gz_A crystal structure of a bile-acid 7-alpha dehydratase (clohylem_06634) from clostridium hylemonae dsm 15053 at 2.20 a resolution 0.8973 4 153
4gb5-assembly1.cif.gz_A crystal structure of kfla4162 protein from kribbella flavida 0.8779 8 138
ID Description Score Start End Superfamily
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9505 7 147 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9184 7 147 3.10.450.50
4lehA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9049 5 151 3.10.450.50
af_P9WL25_11_145_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8999 8 138 3.10.450.50
5stdA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8742 4 138 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A0Q8HPW0-F1-model_v4 Bile-acid 7-alpha-dehydratase 0.9721 4 155
AF-A0A7C4DC29-F1-model_v4 Nuclear transport factor 2 family protein 0.9715 4 141
AF-A0A523ZHR1-F1-model_v4 Nuclear transport factor 2 family protein 0.9697 4 142
AF-A0A8A6RSP1-F1-model_v4 deleted 0.9613 4 152
AF-A0A1G6QGR5-F1-model_v4 SnoaL-like domain-containing protein 0.9596 4 152

Map