F312807

General Info

Members Datasets Scaffolds Average Seq Length
204 130 204 324

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1601717|Ga0436363_1601717_1732_2805
Length 357
Sequence MGATTNERAPAADRLQGSGVKYFTQSLAVGLHMQQKSFGKLPPVSLLTLGGGGLGMVWGETTFDECVATVHAAVNAGINWIDLAPRYGDGKAELVVGEAFAGRLPEGVRVTSKCNLGNPSAADIEPLVRQSIDGSLERLRLSRLDLFFLHSNVVPDPNHMARWPDAASRMTLYATFVEQVRPLFERLVAESLIGAWGLTGIGHPDTIIKLLGERPAPAAVQCIANLLDSPGGLKFFDGPAKPRGVMAAARANGVGVMGIRAVQAGALTSALDRPLPDNHPEMRDYVRAAGFRRLAGGLGVTPALLAHRYALSLDIDTLVLGVKNRQELAECVAAAEAGPLPPDLQAQIDQTVDRKAC

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
74 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
115 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
119 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
120 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
121 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
122 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
125 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
126 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
127 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
130 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.86
Nodule 0
Rhizoplane 0
Rhizosphere 85.29
Stem 0
Stem Tuber 0
Unclassified 7.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10297569 3300003320 Bacteria 2296
2 Ga0070683_100147655 3300005329 Bacteria 2228
3 Ga0070682_100325623 3300005337 Unclassified 1137
4 Ga0070709_10054932 3300005434 Bacteria 2513
5 Ga0070714_100027828 3300005435 Bacteria 4684
6 Ga0070714_100075198 3300005435 Bacteria 2930
7 Ga0070714_100237043 3300005435 Bacteria 1683
8 Ga0070713_100007936 3300005436 Bacteria 7496
9 Ga0070713_100020242 3300005436 Bacteria 5097
10 Ga0070713_100050448 3300005436 Bacteria 3437
11 Ga0070713_100078743 3300005436 Bacteria 2806
12 Ga0070713_100129700 3300005436 Bacteria 2222
13 Ga0070710_10017234 3300005437 Bacteria 3692
14 Ga0070710_10058005 3300005437 Bacteria 2195
15 Ga0070711_100049020 3300005439 Bacteria 2891
16 Ga0070711_100095884 3300005439 Bacteria 2148
17 Ga0070711_100104056 3300005439 Unclassified 2070
18 Ga0070711_100165267 3300005439 Bacteria 1681
19 Ga0070711_100166675 3300005439 Bacteria 1675
20 Ga0070663_100305516 3300005455 Bacteria 1275
21 Ga0070678_100125882 3300005456 Bacteria 2028
22 Ga0070698_100141418 3300005471 Bacteria 2357
23 Ga0070699_100154606 3300005518 Bacteria 2030
24 Ga0070679_100103196 3300005530 Bacteria 2838
25 Ga0070679_100506879 3300005530 Bacteria 1151
26 Ga0070684_100066893 3300005535 Bacteria 3155
27 Ga0070697_100151956 3300005536 Bacteria 1952
28 Ga0070697_100212395 3300005536 Unclassified 1648
29 Ga0070697_100345629 3300005536 Bacteria 1284
30 Ga0068853_100484185 3300005539 Bacteria 1167
31 Ga0070686_100027963 3300005544 Bacteria 3416
32 Ga0070696_100145860 3300005546 Bacteria 1734
33 Ga0070665_100243535 3300005548 Bacteria 1799
34 Ga0068857_100085334 3300005577 Bacteria 2822
35 Ga0068857_100388980 3300005577 Bacteria 1296
36 Ga0068856_100013245 3300005614 Bacteria 7987
37 Ga0068852_100173029 3300005616 Bacteria 2025
38 Ga0068859_100040388 3300005617 Bacteria 4683
39 Ga0068861_100451861 3300005719 Bacteria 1151
40 Ga0068858_100108801 3300005842 Bacteria 2587
41 Ga0068858_100252986 3300005842 Bacteria 1674
42 Ga0068860_100226909 3300005843 Bacteria 1814
43 Ga0081455_10008795 3300005937 Bacteria 10452
44 Ga0081540_1003055 3300005983 Bacteria 13411
45 Ga0081540_1018815 3300005983 Bacteria 4222
46 Ga0070717_10011077 3300006028 Bacteria 6833
47 Ga0070717_10029536 3300006028 Bacteria 4399
48 Ga0070717_10035576 3300006028 Bacteria 4033
49 Ga0070717_10161253 3300006028 Bacteria 1945
50 Ga0070717_10191350 3300006028 Bacteria 1788
51 Ga0070715_10060698 3300006163 Bacteria 1659
52 Ga0070712_100045806 3300006175 Bacteria 3021
53 Ga0070712_100070644 3300006175 Bacteria 2495
54 Ga0070712_100075151 3300006175 Bacteria 2429
55 Ga0070712_100197730 3300006175 Bacteria 1577
56 Ga0075362_10006924 3300006177 Bacteria 4252
57 Ga0075369_10007016 3300006186 Bacteria 4279
58 Ga0075370_10100959 3300006353 Bacteria 1670
59 Ga0075436_100150268 3300006914 Bacteria 1639
60 Ga0075436_100170885 3300006914 Unclassified 1535
61 Ga0097620_100040389 3300006931 Bacteria 4683
62 Ga0114129_10483505 3300009147 Bacteria 1620
63 Ga0105241_10538760 3300009174 Bacteria 1046
64 Ga0105248_10094766 3300009177 Bacteria 3361
65 Ga0105238_10195878 3300009551 Bacteria 1996
66 Ga0105239_10677669 3300010375 Bacteria 1178
67 Ga0105246_10206075 3300011119 Bacteria 1532
68 Ga0157371_10155109 3300013102 Bacteria 1634
69 Ga0163162_10280024 3300013306 Bacteria 1800
70 Ga0163163_10214988 3300014325 Bacteria 1971
71 Ga0182008_10032105 3300014497 Bacteria 2639
72 Ga0213872_10057031 3300021361 Bacteria 1769
73 Ga0213874_10021887 3300021377 Bacteria 1768
74 Ga0213875_10086820 3300021388 Unclassified 1459
75 Ga0213871_10053446 3300021441 Bacteria 1112
76 Ga0207699_10099754 3300025906 Bacteria 1840
77 Ga0207684_10249899 3300025910 Bacteria 1530
78 Ga0207693_10000399 3300025915 Bacteria 39733
79 Ga0207693_10008560 3300025915 Bacteria 8375
80 Ga0207693_10008783 3300025915 Bacteria 8259
81 Ga0207693_10030063 3300025915 Unclassified 4289
82 Ga0207693_10036914 3300025915 Bacteria 3853
83 Ga0207693_10127805 3300025915 Bacteria 1998
84 Ga0207663_10025713 3300025916 Bacteria 3407
85 Ga0207652_10033725 3300025921 Bacteria 4312
86 Ga0207681_10130585 3300025923 Bacteria 1857
87 Ga0207700_10039041 3300025928 Bacteria 3452
88 Ga0207700_10059650 3300025928 Bacteria 2886
89 Ga0207700_10323406 3300025928 Bacteria 1337
90 Ga0207664_10019863 3300025929 Bacteria 4972
91 Ga0207664_10047275 3300025929 Bacteria 3379
92 Ga0207664_10127008 3300025929 Bacteria 2142
93 Ga0207664_10344873 3300025929 Bacteria 1317
94 Ga0207665_10089028 3300025939 Unclassified 2137
95 Ga0207665_10131679 3300025939 Bacteria 1776
96 Ga0207661_10200884 3300025944 Bacteria 1752
97 Ga0207667_10126556 3300025949 Bacteria 2632
98 Ga0207667_10437768 3300025949 Bacteria 1329
99 Ga0207712_10030200 3300025961 Bacteria 3642
100 Ga0207703_10246151 3300026035 Bacteria 1609
101 Ga0207708_10059073 3300026075 Bacteria 2926
102 Ga0207702_10016676 3300026078 Bacteria 6081
103 Ga0207702_10230690 3300026078 Bacteria 1730
104 Ga0207702_10294598 3300026078 Bacteria 1538
105 Ga0207641_10175569 3300026088 Unclassified 1959
106 Ga0207674_10019892 3300026116 Bacteria 7264
107 Ga0207674_10054522 3300026116 Bacteria 4070
108 Ga0207674_10353675 3300026116 Bacteria 1420
109 Ga0207675_100055224 3300026118 Bacteria 3705
110 Ga0207683_10333415 3300026121 Bacteria 1390
111 Ga0207698_10064296 3300026142 Bacteria 2875
112 Ga0268264_10127259 3300028381 Bacteria 2253
113 Ga0265338_10086895 3300028800 Bacteria 2600
114 Ga0373934_0005037 3300035086 Bacteria 4894
115 Ga0373934_0032333 3300035086 Bacteria 2052
116 Ga0373939_0036349 3300035114 Unclassified 1457
117 Ga0373945_0022024 3300035116 Bacteria 2193
118 Ga0373953_0036871 3300035117 Bacteria 1927
119 Ga0373953_0096447 3300035117 Bacteria 1241
120 Ga0373954_0036362 3300035118 Bacteria 2286
121 Ga0373956_0147161 3300035119 Unclassified 1107
122 Ga0373955_0005166 3300035172 Bacteria 5839
123 Ga0373955_0077264 3300035172 Bacteria 1874
124 Ga0373924_0021001 3300035410 Bacteria 2544
125 Ga0373931_0158133 3300035691 Bacteria 1326
126 Ga0373935_0040596 3300035692 Bacteria 2921
127 Ga0373935_0094054 3300035692 Bacteria 1966
128 Ga0373933_0014326 3300035724 Bacteria 4409
129 Ga0373933_0029210 3300035724 Bacteria 3186
130 Ga0373937_0009856 3300036401 Bacteria 8329
131 Ga0373937_0012706 3300036401 Bacteria 7410
132 Ga0373937_0028330 3300036401 Bacteria 5067
133 Ga0373937_0032525 3300036401 Bacteria 4731
134 Ga0373937_0199894 3300036401 Bacteria 1879
135 Ga0373937_0401429 3300036401 Bacteria 1301
136 Ga0373925_0010621 3300037068 Bacteria 6677
137 Ga0373925_0186312 3300037068 Bacteria 1645
138 Ga0395900_0001346 3300037418 Bacteria 29708
139 Ga0395898_0013557 3300037466 Bacteria 8391
140 Ga0436364_0674187 3300037853 Bacteria 9456
141 Ga0436364_0693093 3300037853 Unclassified 1460
142 Ga0436364_0853176 3300037853 Bacteria 15186
143 Ga0395901_0016302 3300038443 Bacteria 7568
144 Ga0395901_0128763 3300038443 Bacteria 2660
145 Ga0436365_0005923 3300039437 Bacteria 2533
146 Ga0436365_0204743 3300039437 Unclassified 1538
147 Ga0436365_1396199 3300039437 Bacteria 2621
148 Ga0436365_1533825 3300039437 Bacteria 1720
149 Ga0436360_0722358 3300039438 Bacteria 976
150 Ga0436361_0087436 3300039447 Bacteria 1805
151 Ga0436361_0153763 3300039447 Bacteria 1807
152 Ga0436363_0833249 3300039450 Unclassified 1799
153 Ga0436363_1563653 3300039450 Bacteria 1980
154 Ga0436363_1601717 3300039450 Plasmid 3118
155 Ga0436362_0035197 3300039453 Bacteria 3128
156 Ga0436362_0320531 3300039453 Bacteria 4304
157 Ga0436362_0478549 3300039453 Bacteria 1462
158 Ga0451577_0378881 3300042876 Bacteria 1284
159 Ga0466963_0008796 3300044694 Bacteria 6065
160 Ga0495629_0029485 3300046459 Bacteria 3890
161 Ga0495651_0044907 3300046462 Bacteria 3424
162 Ga0495653_0124998 3300046463 Bacteria 1828
163 Ga0495653_0172905 3300046463 Bacteria 1489
164 Ga0495664_0026941 3300046477 Bacteria 3349
165 Ga0495608_0017406 3300046511 Bacteria 4970
166 Ga0495628_0266216 3300046516 Bacteria 1276
167 Ga0495652_0193489 3300046529 Bacteria 1550
168 Ga0495640_0145163 3300046533 Bacteria 1527
169 Ga0495587_0010837 3300046536 Bacteria 5786
170 Ga0495587_0162209 3300046536 Bacteria 1272
171 Ga0495645_0016548 3300046543 Bacteria 5269
172 Ga0495667_0044977 3300046559 Bacteria 2924
173 Ga0495599_0024654 3300046678 Bacteria 3762
174 Ga0495599_0052518 3300046678 Bacteria 2553
175 Ga0495600_0023789 3300046809 Bacteria 3942
176 Ga0495604_0157745 3300047317 Bacteria 1606
177 Ga0495674_0032010 3300047319 Bacteria 4773
178 Ga0495674_0075101 3300047319 Bacteria 2909
179 Ga0495680_0041762 3300047322 Bacteria 3644
180 Ga0495680_0069050 3300047322 Unclassified 2698
181 Ga0495680_0213289 3300047322 Bacteria 1381
182 Ga0495602_0007106 3300048088 Bacteria 11751
183 Ga0495602_0336613 3300048088 Bacteria 1093
184 Ga0496119_0186377 3300048922 Bacteria 1084
185 Ga0496120_0098273 3300048923 Bacteria 1552
186 Ga0496126_0005266 3300048929 Bacteria 14858
187 Ga0501034_0205070 3300049571 Bacteria 1928
188 nmdc:mga03683_24310_c1 3300050489 Bacteria 2369
189 nmdc:mga0yw44_157781_c1 3300050492 Bacteria 1484
190 nmdc:mga0yw44_259823_c1 3300050492 Bacteria 1157
191 nmdc:mga06z11_115057_c1 3300050494 Bacteria 1494
192 nmdc:mga06z11_31548_c1 3300050494 Bacteria 2576
193 nmdc:mga04h51_124598_c1 3300050495 Bacteria 963
194 nmdc:mga07m45_107342_c1 3300050496 Bacteria 1606
195 nmdc:mga07m45_67282_c1 3300050496 Bacteria 2036
196 nmdc:mga06r32_153729_c2 3300050510 Bacteria 1987
197 nmdc:mga0sz30_657_c1 3300050516 Bacteria 12806
198 Ga0495601_0009955 3300053077 Bacteria 5634
199 Ga0495612_0007865 3300053078 Bacteria 4347
200 Ga0495595_0056889 3300053084 Bacteria 1823
201 Ga0495619_0056487 3300053085 Unclassified 2602
202 Ga0495619_0058394 3300053085 Bacteria 2561
203 Ga0500651_0021709 3300053093 Bacteria 4005
204 Ga0500634_0000003 3300053161 Bacteria 245536

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050495 nmdc:mga04h51_124598_c1 nmdc:mga04h51_124598_c1_80_952 287
2 3300035116 Ga0373945_0022024 Ga0373945_0022024_840_1733 296
3 3300035119 Ga0373956_0147161 Ga0373956_0147161_43_939 297
4 3300035692 Ga0373935_0040596 Ga0373935_0040596_32_928 297
5 3300050492 nmdc:mga0yw44_157781_c1 nmdc:mga0yw44_157781_c1_13_918 299
6 3300035691 Ga0373931_0158133 Ga0373931_0158133_401_1306 300
7 3300039438 Ga0436360_0722358 Ga0436360_0722358_29_937 301
8 3300009147 Ga0114129_10483505 Ga0114129_104835051 302
9 3300036401 Ga0373937_0401429 Ga0373937_0401429_368_1279 302
10 3300042876 Ga0451577_0378881 Ga0451577_0378881_21_935 302
11 3300048929 Ga0496126_0005266 Ga0496126_0005266_4516_5433 302
12 3300050510 nmdc:mga06r32_153729_c2 nmdc:mga06r32_153729_c2_64_978 302
13 3300053161 Ga0500634_0000003 Ga0500634_0000003_190920_191894 302
14 3300039437 Ga0436365_0204743 Ga0436365_0204743_481_1449 307
15 3300021388 Ga0213875_10086820 Ga0213875_100868201 308
16 3300037853 Ga0436364_0693093 Ga0436364_0693093_142_1119 308
17 3300050492 nmdc:mga0yw44_259823_c1 nmdc:mga0yw44_259823_c1_16_951 308
18 3300046536 Ga0495587_0162209 Ga0495587_0162209_265_1200 311
19 3300048088 Ga0495602_0336613 Ga0495602_0336613_116_1051 311
20 3300039437 Ga0436365_1396199 Ga0436365_1396199_226_1212 313
21 3300037853 Ga0436364_0853176 Ga0436364_0853176_10230_11255 318
22 3300005435 Ga0070714_100027828 Ga0070714_1000278285 320
23 3300005530 Ga0070679_100103196 Ga0070679_1001031962 320
24 3300006028 Ga0070717_10191350 Ga0070717_101913502 320
25 3300006175 Ga0070712_100045806 Ga0070712_1000458064 320
26 3300014497 Ga0182008_10032105 Ga0182008_100321052 320
27 3300025915 Ga0207693_10036914 Ga0207693_100369144 320
28 3300025921 Ga0207652_10033725 Ga0207652_100337252 320
29 3300025928 Ga0207700_10059650 Ga0207700_100596504 320
30 3300025929 Ga0207664_10047275 Ga0207664_100472754 320
31 3300026078 Ga0207702_10230690 Ga0207702_102306902 320
32 3300035086 Ga0373934_0032333 Ga0373934_0032333_1015_1980 320
33 3300035118 Ga0373954_0036362 Ga0373954_0036362_862_1827 320
34 3300035172 Ga0373955_0077264 Ga0373955_0077264_90_1055 320
35 3300035410 Ga0373924_0021001 Ga0373924_0021001_1105_2070 320
36 3300035724 Ga0373933_0014326 Ga0373933_0014326_1933_2898 320
37 3300036401 Ga0373937_0012706 Ga0373937_0012706_552_1517 320
38 3300046463 Ga0495653_0124998 Ga0495653_0124998_76_1041 320
39 3300047322 Ga0495680_0213289 Ga0495680_0213289_336_1301 320
40 3300048922 Ga0496119_0186377 Ga0496119_0186377_40_1002 320
41 3300048923 Ga0496120_0098273 Ga0496120_0098273_118_1080 320
42 3300053084 Ga0495595_0056889 Ga0495595_0056889_711_1676 320
43 3300005456 Ga0070678_100125882 Ga0070678_1001258821 321
44 3300005842 Ga0068858_100108801 Ga0068858_1001088013 321
45 3300009177 Ga0105248_10094766 Ga0105248_100947663 321
46 3300014325 Ga0163163_10214988 Ga0163163_102149882 321
47 3300026121 Ga0207683_10333415 Ga0207683_103334151 321
48 3300028800 Ga0265338_10086895 Ga0265338_100868953 321
49 3300035086 Ga0373934_0005037 Ga0373934_0005037_1338_2306 321
50 3300035117 Ga0373953_0036871 Ga0373953_0036871_795_1763 321
51 3300035172 Ga0373955_0005166 Ga0373955_0005166_4223_5191 321
52 3300036401 Ga0373937_0009856 Ga0373937_0009856_6024_6992 321
53 3300037853 Ga0436364_0674187 Ga0436364_0674187_8455_9423 321
54 3300039447 Ga0436361_0087436 Ga0436361_0087436_213_1178 321
55 3300046459 Ga0495629_0029485 Ga0495629_0029485_1239_2207 321
56 3300047322 Ga0495680_0069050 Ga0495680_0069050_649_1617 321
57 3300053085 Ga0495619_0056487 Ga0495619_0056487_1392_2360 321
58 3300005436 Ga0070713_100020242 Ga0070713_1000202424 322
59 3300005437 Ga0070710_10017234 Ga0070710_100172343 322
60 3300005439 Ga0070711_100049020 Ga0070711_1000490201 322
61 3300005471 Ga0070698_100141418 Ga0070698_1001414185 322
62 3300006028 Ga0070717_10035576 Ga0070717_100355763 322
63 3300006175 Ga0070712_100070644 Ga0070712_1000706442 322
64 3300021361 Ga0213872_10057031 Ga0213872_100570311 322
65 3300021441 Ga0213871_10053446 Ga0213871_100534461 322
66 3300025906 Ga0207699_10099754 Ga0207699_100997542 322
67 3300025915 Ga0207693_10000399 Ga0207693_1000039932 322
68 3300025916 Ga0207663_10025713 Ga0207663_100257132 322
69 3300039447 Ga0436361_0153763 Ga0436361_0153763_100_1068 322
70 3300039453 Ga0436362_0035197 Ga0436362_0035197_377_1348 322
71 3300050494 nmdc:mga06z11_115057_c1 nmdc:mga06z11_115057_c1_171_1145 322
72 3300050496 nmdc:mga07m45_107342_c1 nmdc:mga07m45_107342_c1_313_1287 322
73 3300039453 Ga0436362_0320531 Ga0436362_0320531_1165_2139 323
74 3300005436 Ga0070713_100129700 Ga0070713_1001297002 324
75 3300005439 Ga0070711_100095884 Ga0070711_1000958842 324
76 3300005439 Ga0070711_100104056 Ga0070711_1001040561 324
77 3300005536 Ga0070697_100151956 Ga0070697_1001519564 324
78 3300005536 Ga0070697_100345629 Ga0070697_1003456291 324
79 3300006028 Ga0070717_10011077 Ga0070717_100110773 324
80 3300006175 Ga0070712_100197730 Ga0070712_1001977301 324
81 3300006177 Ga0075362_10006924 Ga0075362_100069242 324
82 3300006186 Ga0075369_10007016 Ga0075369_100070162 324
83 3300006353 Ga0075370_10100959 Ga0075370_101009592 324
84 3300021377 Ga0213874_10021887 Ga0213874_100218872 324
85 3300025915 Ga0207693_10008560 Ga0207693_100085604 324
86 3300025915 Ga0207693_10030063 Ga0207693_100300633 324
87 3300036401 Ga0373937_0199894 Ga0373937_0199894_406_1383 324
88 3300039450 Ga0436363_1563653 Ga0436363_1563653_265_1242 324
89 3300039450 Ga0436363_1601717 Ga0436363_1601717_1732_2805 324
90 3300049571 Ga0501034_0205070 Ga0501034_0205070_118_1101 324
91 3300050489 nmdc:mga03683_24310_c1 nmdc:mga03683_24310_c1_135_1118 324
92 3300050494 nmdc:mga06z11_31548_c1 nmdc:mga06z11_31548_c1_804_1787 324
93 3300050496 nmdc:mga07m45_67282_c1 nmdc:mga07m45_67282_c1_158_1141 324
94 3300050516 nmdc:mga0sz30_657_c1 nmdc:mga0sz30_657_c1_7777_8760 324
95 3300053093 Ga0500651_0021709 Ga0500651_0021709_1166_2149 324
96 3300005337 Ga0070682_100325623 Ga0070682_1003256231 325
97 3300005434 Ga0070709_10054932 Ga0070709_100549323 325
98 3300005435 Ga0070714_100075198 Ga0070714_1000751983 325
99 3300005436 Ga0070713_100050448 Ga0070713_1000504482 325
100 3300005436 Ga0070713_100078743 Ga0070713_1000787433 325
101 3300005437 Ga0070710_10058005 Ga0070710_100580052 325
102 3300005439 Ga0070711_100165267 Ga0070711_1001652671 325
103 3300005439 Ga0070711_100166675 Ga0070711_1001666752 325
104 3300005518 Ga0070699_100154606 Ga0070699_1001546062 325
105 3300005536 Ga0070697_100212395 Ga0070697_1002123951 325
106 3300005544 Ga0070686_100027963 Ga0070686_1000279631 325
107 3300005546 Ga0070696_100145860 Ga0070696_1001458602 325
108 3300005617 Ga0068859_100040388 Ga0068859_1000403881 325
109 3300005719 Ga0068861_100451861 Ga0068861_1004518611 325
110 3300005842 Ga0068858_100252986 Ga0068858_1002529862 325
111 3300005843 Ga0068860_100226909 Ga0068860_1002269091 325
112 3300005983 Ga0081540_1018815 Ga0081540_10188154 325
113 3300006028 Ga0070717_10161253 Ga0070717_101612531 325
114 3300006163 Ga0070715_10060698 Ga0070715_100606981 325
115 3300006175 Ga0070712_100075151 Ga0070712_1000751513 325
116 3300006914 Ga0075436_100150268 Ga0075436_1001502682 325
117 3300006914 Ga0075436_100170885 Ga0075436_1001708851 325
118 3300006931 Ga0097620_100040389 Ga0097620_1000403891 325
119 3300009174 Ga0105241_10538760 Ga0105241_105387601 325
120 3300011119 Ga0105246_10206075 Ga0105246_102060752 325
121 3300013306 Ga0163162_10280024 Ga0163162_102800241 325
122 3300025910 Ga0207684_10249899 Ga0207684_102498991 325
123 3300025915 Ga0207693_10008783 Ga0207693_100087838 325
124 3300025915 Ga0207693_10127805 Ga0207693_101278051 325
125 3300025923 Ga0207681_10130585 Ga0207681_101305852 325
126 3300025928 Ga0207700_10323406 Ga0207700_103234061 325
127 3300025929 Ga0207664_10019863 Ga0207664_100198634 325
128 3300025929 Ga0207664_10127008 Ga0207664_101270082 325
129 3300025939 Ga0207665_10089028 Ga0207665_100890281 325
130 3300025939 Ga0207665_10131679 Ga0207665_101316792 325
131 3300025961 Ga0207712_10030200 Ga0207712_100302003 325
132 3300026035 Ga0207703_10246151 Ga0207703_102461511 325
133 3300026075 Ga0207708_10059073 Ga0207708_100590731 325
134 3300026088 Ga0207641_10175569 Ga0207641_101755692 325
135 3300026116 Ga0207674_10019892 Ga0207674_100198927 325
136 3300026118 Ga0207675_100055224 Ga0207675_1000552244 325
137 3300028381 Ga0268264_10127259 Ga0268264_101272592 325
138 3300035114 Ga0373939_0036349 Ga0373939_0036349_122_1102 325
139 3300035117 Ga0373953_0096447 Ga0373953_0096447_22_1002 325
140 3300035692 Ga0373935_0094054 Ga0373935_0094054_234_1214 325
141 3300035724 Ga0373933_0029210 Ga0373933_0029210_187_1167 325
142 3300036401 Ga0373937_0028330 Ga0373937_0028330_2866_3846 325
143 3300036401 Ga0373937_0032525 Ga0373937_0032525_1139_2119 325
144 3300037068 Ga0373925_0010621 Ga0373925_0010621_2365_3345 325
145 3300037068 Ga0373925_0186312 Ga0373925_0186312_168_1148 325
146 3300039437 Ga0436365_0005923 Ga0436365_0005923_1395_2375 325
147 3300039453 Ga0436362_0478549 Ga0436362_0478549_146_1132 325
148 3300046462 Ga0495651_0044907 Ga0495651_0044907_1163_2143 325
149 3300046463 Ga0495653_0172905 Ga0495653_0172905_170_1150 325
150 3300046477 Ga0495664_0026941 Ga0495664_0026941_902_1882 325
151 3300046511 Ga0495608_0017406 Ga0495608_0017406_1107_2087 325
152 3300046516 Ga0495628_0266216 Ga0495628_0266216_226_1206 325
153 3300046529 Ga0495652_0193489 Ga0495652_0193489_440_1420 325
154 3300046533 Ga0495640_0145163 Ga0495640_0145163_479_1459 325
155 3300046536 Ga0495587_0010837 Ga0495587_0010837_2796_3776 325
156 3300046543 Ga0495645_0016548 Ga0495645_0016548_2056_3036 325
157 3300046559 Ga0495667_0044977 Ga0495667_0044977_122_1102 325
158 3300046678 Ga0495599_0024654 Ga0495599_0024654_839_1819 325
159 3300046678 Ga0495599_0052518 Ga0495599_0052518_948_1928 325
160 3300046809 Ga0495600_0023789 Ga0495600_0023789_1791_2771 325
161 3300047317 Ga0495604_0157745 Ga0495604_0157745_54_1034 325
162 3300047319 Ga0495674_0032010 Ga0495674_0032010_1074_2054 325
163 3300047319 Ga0495674_0075101 Ga0495674_0075101_1613_2593 325
164 3300047322 Ga0495680_0041762 Ga0495680_0041762_1877_2857 325
165 3300048088 Ga0495602_0007106 Ga0495602_0007106_7888_8868 325
166 3300053077 Ga0495601_0009955 Ga0495601_0009955_2861_3841 325
167 3300053078 Ga0495612_0007865 Ga0495612_0007865_1429_2409 325
168 3300053085 Ga0495619_0058394 Ga0495619_0058394_164_1144 325
169 3300003320 rootH2_10297569 rootH2_102975692 326
170 3300005329 Ga0070683_100147655 Ga0070683_1001476552 326
171 3300005435 Ga0070714_100237043 Ga0070714_1002370432 326
172 3300005436 Ga0070713_100007936 Ga0070713_1000079363 326
173 3300005455 Ga0070663_100305516 Ga0070663_1003055162 326
174 3300005530 Ga0070679_100506879 Ga0070679_1005068791 326
175 3300005535 Ga0070684_100066893 Ga0070684_1000668933 326
176 3300005539 Ga0068853_100484185 Ga0068853_1004841851 326
177 3300005548 Ga0070665_100243535 Ga0070665_1002435352 326
178 3300005577 Ga0068857_100085334 Ga0068857_1000853343 326
179 3300005577 Ga0068857_100388980 Ga0068857_1003889802 326
180 3300005614 Ga0068856_100013245 Ga0068856_1000132452 326
181 3300005616 Ga0068852_100173029 Ga0068852_1001730293 326
182 3300005937 Ga0081455_10008795 Ga0081455_1000879511 326
183 3300005983 Ga0081540_1003055 Ga0081540_10030554 326
184 3300006028 Ga0070717_10029536 Ga0070717_100295362 326
185 3300009551 Ga0105238_10195878 Ga0105238_101958782 326
186 3300010375 Ga0105239_10677669 Ga0105239_106776691 326
187 3300013102 Ga0157371_10155109 Ga0157371_101551092 326
188 3300025928 Ga0207700_10039041 Ga0207700_100390414 326
189 3300025929 Ga0207664_10344873 Ga0207664_103448732 326
190 3300025944 Ga0207661_10200884 Ga0207661_102008842 326
191 3300025949 Ga0207667_10126556 Ga0207667_101265562 326
192 3300025949 Ga0207667_10437768 Ga0207667_104377682 326
193 3300026078 Ga0207702_10016676 Ga0207702_100166763 326
194 3300026078 Ga0207702_10294598 Ga0207702_102945982 326
195 3300026116 Ga0207674_10054522 Ga0207674_100545222 326
196 3300026116 Ga0207674_10353675 Ga0207674_103536752 326
197 3300026142 Ga0207698_10064296 Ga0207698_100642963 326
198 3300037418 Ga0395900_0001346 Ga0395900_0001346_6051_7037 326
199 3300037466 Ga0395898_0013557 Ga0395898_0013557_1332_2318 326
200 3300038443 Ga0395901_0016302 Ga0395901_0016302_6051_7037 326
201 3300038443 Ga0395901_0128763 Ga0395901_0128763_380_1366 326
202 3300039437 Ga0436365_1533825 Ga0436365_1533825_633_1622 326
203 3300039450 Ga0436363_0833249 Ga0436363_0833249_21_1010 326
204 3300044694 Ga0466963_0008796 Ga0466963_0008796_4418_5404 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

46

353

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lh6-assembly1.cif.gz_B the structure of bacteroides plebeius l-galactose dehydrogenase 0.8125 1 320
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.8091 3 315
4exa-assembly1.cif.gz_B crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.7995 3 302
7svq-assembly2.cif.gz_B crystal structure of l-galactose dehydrogenase from spinacia oleracea in complex with nad+ 0.798 2 319
4exa-assembly1.cif.gz_A crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.7952 3 302
ID Description Score Start End Superfamily
af_A0A0P0W8U8_11_146_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.837 1 117 3.20.20.100
af_A0A1D6KXU0_49_191_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8284 1 117 3.20.20.100
af_Q20127_83_403_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8131 1 319 3.20.20.100
af_Q2QQV2_1_312_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8064 1 319 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7958 1 326 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A523KVQ0-F1-model_v4 Aldo/keto reductase 0.9668 1 319
AF-A0A7X3QGN1-F1-model_v4 Aldo/keto reductase 0.9664 1 165
AF-A0A522CZ77-F1-model_v4 Aldo/keto reductase 0.9646 1 318 GO:0005829
GO:0016491
AF-A0A6G4WBC1-F1-model_v4 Aldo/keto reductase 0.9628 1 318 GO:0005829
GO:0016491
AF-A0A2S6TG57-F1-model_v4 General stress protein 69 (EC 1.1.1.-) 0.9623 1 235 GO:0016491

Feature Viewer

pLDDT pTM Quality
90.56 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map