F312762

General Info

Members Datasets Scaffolds Average Seq Length
204 147 408 71

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_1029773|Ga0373927_1029773_207_437
Length 76
Sequence MPDLPNVAGQEAIRAFQRAGFVLDRISGSHHVLKRPGHPFVLSVPVHGNKALKSGTLRTLIRTAGLTVDEFCDLLD

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
63 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
91 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
92 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
134 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
135 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
136 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
137 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
138 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
139 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
140 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
141 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
142 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
143 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
144 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
147 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.39
Nodule 0
Rhizoplane 0.49
Rhizosphere 87.75
Stem 0
Stem Tuber 0
Unclassified 9.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_1029773 3300035695 Bacteria 543
2 rootH1_10118330 3300003316 Bacteria 1026
3 rootH2_10011178 3300003320 Bacteria 2202
4 rootH1_10115397 3300003323 Bacteria 1450
5 Ga0070690_101107264 3300005330 Bacteria 628
6 Ga0070677_10339874 3300005333 Bacteria 775
7 Ga0070666_10119055 3300005335 Bacteria 1830
8 Ga0068868_102265958 3300005338 Bacteria 518
9 Ga0070687_100113297 3300005343 Bacteria 1539
10 Ga0070661_100014106 3300005344 Bacteria 5627
11 Ga0070661_100177672 3300005344 Bacteria 1619
12 Ga0070673_100281978 3300005364 Bacteria 1457
13 Ga0070688_100877873 3300005365 Bacteria 706
14 Ga0070659_100186118 3300005366 Bacteria 1706
15 Ga0070700_100325182 3300005441 Bacteria 1131
16 Ga0070663_101312059 3300005455 Bacteria 639
17 Ga0068853_100117232 3300005539 Bacteria 2371
18 Ga0070686_100341145 3300005544 Bacteria 1123
19 Ga0070686_100610667 3300005544 Bacteria 860
20 Ga0070695_101033021 3300005545 Bacteria 670
21 Ga0070696_100282159 3300005546 Bacteria 1266
22 Ga0068855_100027540 3300005563 Bacteria 6797
23 Ga0068857_100390999 3300005577 Bacteria 1293
24 Ga0068854_100275204 3300005578 Bacteria 1353
25 Ga0068854_100400560 3300005578 Bacteria 1136
26 Ga0068856_100061336 3300005614 Bacteria 3714
27 Ga0068852_100012725 3300005616 Bacteria 6406
28 Ga0068852_100305309 3300005616 Bacteria 1542
29 Ga0068859_101425204 3300005617 Bacteria 764
30 Ga0068862_100894252 3300005844 Bacteria 872
31 Ga0068862_100934487 3300005844 Bacteria 854
32 Ga0081539_10000729 3300005985 Bacteria 65907
33 Ga0097620_101425381 3300006931 Bacteria 764
34 Ga0105240_10015803 3300009093 Bacteria 10241
35 Ga0105240_11021518 3300009093 Bacteria 883
36 Ga0105241_10456134 3300009174 Bacteria 1132
37 Ga0105242_11314019 3300009176 Bacteria 747
38 Ga0105237_10177143 3300009545 Bacteria 2133
39 Ga0105238_10229742 3300009551 Bacteria 1832
40 Ga0105249_10268490 3300009553 Bacteria 1699
41 Ga0105239_10651861 3300010375 Bacteria 1203
42 Ga0157373_10203641 3300013100 Bacteria 1395
43 Ga0157373_11314618 3300013100 Bacteria 548
44 Ga0157371_10045467 3300013102 Bacteria 3124
45 Ga0157371_10362366 3300013102 Bacteria 1057
46 Ga0157378_11166111 3300013297 Bacteria 809
47 Ga0157378_12443401 3300013297 Bacteria 574
48 Ga0163162_11781503 3300013306 Bacteria 704
49 Ga0163162_13400040 3300013306 Bacteria 508
50 Ga0157372_10018542 3300013307 Bacteria 7484
51 Ga0157372_10218466 3300013307 Bacteria 2209
52 Ga0157372_10585102 3300013307 Bacteria 1301
53 Ga0157372_11920425 3300013307 Bacteria 680
54 Ga0157380_10171722 3300014326 Bacteria 1895
55 Ga0157380_12818739 3300014326 Bacteria 553
56 Ga0213874_10047474 3300021377 Bacteria 1306
57 Ga0213876_10000863 3300021384 Bacteria 20272
58 Ga0207680_10093201 3300025903 Bacteria 1921
59 Ga0207695_10305418 3300025913 Bacteria 1482
60 Ga0207695_10803754 3300025913 Bacteria 820
61 Ga0207671_10274652 3300025914 Bacteria 1328
62 Ga0207662_10004205 3300025918 Bacteria 7545
63 Ga0207649_10006909 3300025920 Bacteria 6168
64 Ga0207649_10488504 3300025920 Bacteria 935
65 Ga0207690_10039345 3300025932 Bacteria 3085
66 Ga0207667_10146485 3300025949 Bacteria 2431
67 Ga0207712_11454013 3300025961 Bacteria 614
68 Ga0207640_10111350 3300025981 Bacteria 1941
69 Ga0207640_10416421 3300025981 Bacteria 1098
70 Ga0207703_11830133 3300026035 Bacteria 583
71 Ga0207639_10070565 3300026041 Bacteria 2729
72 Ga0207708_10094566 3300026075 Bacteria 2307
73 Ga0207702_10019958 3300026078 Bacteria 5552
74 Ga0207674_11220403 3300026116 Bacteria 722
75 Ga0207675_101014390 3300026118 Bacteria 848
76 Ga0207698_10007404 3300026142 Bacteria 6876
77 Ga0207698_10357538 3300026142 Bacteria 1382
78 Ga0268265_10932299 3300028380 Bacteria 854
79 Ga0268264_11985534 3300028381 Bacteria 591
80 Ga0265318_10017031 3300028577 Bacteria 2990
81 Ga0265322_10188719 3300028654 Bacteria 590
82 Ga0265338_10074573 3300028800 Bacteria 2884
83 Ga0265338_11197044 3300028800 Bacteria 510
84 Ga0265330_10049181 3300031235 Bacteria 1853
85 Ga0265330_10114710 3300031235 Bacteria 1149
86 Ga0265332_10017818 3300031238 Bacteria 3133
87 Ga0265328_10064912 3300031239 Bacteria 1341
88 Ga0265320_10021699 3300031240 Bacteria 3449
89 Ga0265325_10012823 3300031241 Bacteria 4783
90 Ga0265325_10200709 3300031241 Bacteria 920
91 Ga0265329_10011615 3300031242 Bacteria 3195
92 Ga0265340_10052085 3300031247 Bacteria 1980
93 Ga0265340_10497154 3300031247 Bacteria 537
94 Ga0265339_10045049 3300031249 Bacteria 2429
95 Ga0265339_10197663 3300031249 Bacteria 993
96 Ga0265331_10011696 3300031250 Bacteria 4796
97 Ga0265327_10071381 3300031251 Bacteria 1737
98 Ga0265313_10011952 3300031595 Bacteria 5353
99 Ga0265314_10249229 3300031711 Bacteria 1020
100 Ga0265342_10112009 3300031712 Bacteria 1543
101 Ga0307416_101590350 3300032002 Unclassified 759
102 Ga0307416_102910881 3300032002 Unclassified 573
103 Ga0373937_1612119 3300036401 Unclassified 596
104 Ga0395899_0194977 3300037312 Bacteria 1415
105 Ga0395900_0207870 3300037418 Bacteria 1977
106 Ga0395898_0060559 3300037466 Bacteria 3678
107 Ga0395898_0071713 3300037466 Bacteria 3347
108 Ga0436364_1301055 3300037853 Bacteria 735
109 Ga0395901_0092390 3300038443 Bacteria 3168
110 Ga0395901_0183050 3300038443 Bacteria 2197
111 Ga0436365_1233543 3300039437 Unclassified 560
112 Ga0436365_1360649 3300039437 Bacteria 21586
113 Ga0436365_1526578 3300039437 Unclassified 872
114 Ga0436360_0760379 3300039438 Unclassified 575
115 Ga0436361_1149338 3300039447 Unclassified 647
116 Ga0436363_0678076 3300039450 Bacteria 751
117 Ga0436363_1636268 3300039450 Bacteria 1442
118 Ga0436362_0723235 3300039453 Bacteria 523
119 Ga0439433_0184907 3300041999 Bacteria 547
120 Ga0439446_0141124 3300042156 Bacteria 787
121 Ga0439435_0000920 3300042436 Bacteria 5094
122 Ga0466963_0023656 3300044694 Bacteria 3904
123 Ga0453684_0060261 3300044712 Bacteria 4884
124 Ga0466957_0754538 3300044842 Bacteria 689
125 Ga0466967_0000504 3300045976 Bacteria 19082
126 Ga0495638_0003991 3300046460 Bacteria 11345
127 Ga0495583_0129294 3300046506 Bacteria 1058
128 Ga0495606_0014573 3300046507 Bacteria 6119
129 Ga0495628_0635542 3300046516 Bacteria 759
130 Ga0495652_0919169 3300046529 Bacteria 576
131 Ga0495654_0390355 3300046530 Unclassified 554
132 Ga0495599_0121975 3300046678 Bacteria 1620
133 Ga0495589_0330969 3300046794 Bacteria 703
134 Ga0496115_0105317 3300048918 Bacteria 2315
135 Ga0496120_0314494 3300048923 Bacteria 713
136 Ga0501031_0010652 3300049568 Bacteria 5988
137 Ga0501031_0032586 3300049568 Bacteria 3397
138 Ga0501032_0116608 3300049569 Bacteria 1765
139 Ga0501032_0709881 3300049569 Bacteria 637
140 Ga0501033_0044539 3300049570 Bacteria 3303
141 Ga0501033_0108162 3300049570 Bacteria 2025
142 Ga0501033_0195896 3300049570 Bacteria 1444
143 Ga0501034_0052059 3300049571 Bacteria 4126
144 Ga0501034_0294558 3300049571 Bacteria 1560
145 Ga0501034_0380447 3300049571 Bacteria 1336
146 Ga0501034_0913171 3300049571 Bacteria 765
147 Ga0501034_1388590 3300049571 Bacteria 578
148 Ga0501036_0031337 3300049572 Bacteria 4493
149 Ga0501036_0178222 3300049572 Bacteria 1789
150 Ga0501036_0472774 3300049572 Bacteria 1044
151 Ga0501037_0080598 3300049573 Bacteria 2361
152 Ga0501037_0174664 3300049573 Bacteria 1526
153 Ga0501037_0316759 3300049573 Bacteria 1080
154 Ga0501038_0012331 3300049574 Bacteria 7809
155 Ga0501038_0077976 3300049574 Bacteria 2796
156 Ga0501038_0808329 3300049574 Unclassified 696
157 Ga0501039_0223660 3300049575 Bacteria 1479
158 Ga0501040_1100447 3300049576 Unclassified 576
159 Ga0501041_0743084 3300049577 Unclassified 628
160 Ga0501043_0062313 3300049579 Bacteria 2928
161 Ga0501043_0151680 3300049579 Bacteria 1813
162 Ga0501043_0513579 3300049579 Bacteria 894
163 Ga0501043_0538004 3300049579 Bacteria 869
164 Ga0501047_0038832 3300049581 Bacteria 4605
165 Ga0501047_0118490 3300049581 Bacteria 2529
166 Ga0501047_0259534 3300049581 Bacteria 1585
167 Ga0501048_0114735 3300049582 Bacteria 1903
168 Ga0501048_0409880 3300049582 Bacteria 969
169 Ga0501068_0242494 3300049584 Bacteria 1147
170 Ga0501070_0034000 3300049586 Bacteria 4264
171 Ga0501070_0044712 3300049586 Bacteria 3683
172 Ga0501070_0162668 3300049586 Bacteria 1840
173 Ga0501071_0529938 3300049587 Bacteria 904
174 Ga0501072_0315596 3300049588 Bacteria 1242
175 Ga0501073_0364615 3300049589 Bacteria 998
176 Ga0501074_0605417 3300049590 Bacteria 775
177 Ga0501076_0202203 3300049592 Bacteria 1622
178 Ga0501076_1552767 3300049592 Unclassified 543
179 Ga0501079_0974043 3300049741 Unclassified 668
180 Ga0501080_0070841 3300049742 Bacteria 3243
181 Ga0501035_0048149 3300049822 Bacteria 3823
182 Ga0501035_0092296 3300049822 Bacteria 2664
183 Ga0501035_0110302 3300049822 Bacteria 2411
184 Ga0501044_0021784 3300049823 Bacteria 6834
185 Ga0501044_0300108 3300049823 Bacteria 1535
186 Ga0501044_0788100 3300049823 Bacteria 830
187 Ga0501044_1386450 3300049823 Bacteria 568
188 Ga0501045_0852088 3300049824 Unclassified 670
189 Ga0495601_0360681 3300053077 Bacteria 944
190 Ga0495655_0000518 3300053083 Bacteria 6333
191 Ga0500646_0173147 3300053090 Unclassified 727
192 Ga0500641_0370887 3300053096 Unclassified 570
193 Ga0500648_224675 3300053097 Bacteria 915
194 Ga0500559_0033710 3300053136 Bacteria 2205
195 Ga0500564_111399 3300053138 Bacteria 1201
196 Ga0500573_0035475 3300053140 Bacteria 2878
197 Ga0500577_0109841 3300053142 Unclassified 1137
198 Ga0500590_221150 3300053148 Bacteria 781
199 Ga0500639_156072 3300053163 Bacteria 1045
200 Ga0500636_0045924 3300053177 Bacteria 2575
201 Ga0500596_000877 3300053735 Bacteria 5990
202 Ga0501082_1487082 3300060353 Unclassified 591
203 Ga0530510_0930696 3300061734 Unclassified 664
204 2824683356 2824679649 Bacteria 8248951
205 Ga0373927_1029773
206 rootH1_10118330
207 rootH2_10011178
208 rootH1_10115397
209 Ga0070690_101107264
210 Ga0070677_10339874
211 Ga0070666_10119055
212 Ga0068868_102265958
213 Ga0070687_100113297
214 Ga0070661_100014106
215 Ga0070661_100177672
216 Ga0070673_100281978
217 Ga0070688_100877873
218 Ga0070659_100186118
219 Ga0070700_100325182
220 Ga0070663_101312059
221 Ga0068853_100117232
222 Ga0070686_100341145
223 Ga0070686_100610667
224 Ga0070695_101033021
225 Ga0070696_100282159
226 Ga0068855_100027540
227 Ga0068857_100390999
228 Ga0068854_100275204
229 Ga0068854_100400560
230 Ga0068856_100061336
231 Ga0068852_100012725
232 Ga0068852_100305309
233 Ga0068859_101425204
234 Ga0068862_100894252
235 Ga0068862_100934487
236 Ga0081539_10000729
237 Ga0097620_101425381
238 Ga0105240_10015803
239 Ga0105240_11021518
240 Ga0105241_10456134
241 Ga0105242_11314019
242 Ga0105237_10177143
243 Ga0105238_10229742
244 Ga0105249_10268490
245 Ga0105239_10651861
246 Ga0157373_10203641
247 Ga0157373_11314618
248 Ga0157371_10045467
249 Ga0157371_10362366
250 Ga0157378_11166111
251 Ga0157378_12443401
252 Ga0163162_11781503
253 Ga0163162_13400040
254 Ga0157372_10018542
255 Ga0157372_10218466
256 Ga0157372_10585102
257 Ga0157372_11920425
258 Ga0157380_10171722
259 Ga0157380_12818739
260 Ga0213874_10047474
261 Ga0213876_10000863
262 Ga0207680_10093201
263 Ga0207695_10305418
264 Ga0207695_10803754
265 Ga0207671_10274652
266 Ga0207662_10004205
267 Ga0207649_10006909
268 Ga0207649_10488504
269 Ga0207690_10039345
270 Ga0207667_10146485
271 Ga0207712_11454013
272 Ga0207640_10111350
273 Ga0207640_10416421
274 Ga0207703_11830133
275 Ga0207639_10070565
276 Ga0207708_10094566
277 Ga0207702_10019958
278 Ga0207674_11220403
279 Ga0207675_101014390
280 Ga0207698_10007404
281 Ga0207698_10357538
282 Ga0268265_10932299
283 Ga0268264_11985534
284 Ga0265318_10017031
285 Ga0265322_10188719
286 Ga0265338_10074573
287 Ga0265338_11197044
288 Ga0265330_10049181
289 Ga0265330_10114710
290 Ga0265332_10017818
291 Ga0265328_10064912
292 Ga0265320_10021699
293 Ga0265325_10012823
294 Ga0265325_10200709
295 Ga0265329_10011615
296 Ga0265340_10052085
297 Ga0265340_10497154
298 Ga0265339_10045049
299 Ga0265339_10197663
300 Ga0265331_10011696
301 Ga0265327_10071381
302 Ga0265313_10011952
303 Ga0265314_10249229
304 Ga0265342_10112009
305 Ga0307416_101590350
306 Ga0307416_102910881
307 Ga0373937_1612119
308 Ga0395899_0194977
309 Ga0395900_0207870
310 Ga0395898_0060559
311 Ga0395898_0071713
312 Ga0436364_1301055
313 Ga0395901_0092390
314 Ga0395901_0183050
315 Ga0436365_1233543
316 Ga0436365_1360649
317 Ga0436365_1526578
318 Ga0436360_0760379
319 Ga0436361_1149338
320 Ga0436363_0678076
321 Ga0436363_1636268
322 Ga0436362_0723235
323 Ga0439433_0184907
324 Ga0439446_0141124
325 Ga0439435_0000920
326 Ga0466963_0023656
327 Ga0453684_0060261
328 Ga0466957_0754538
329 Ga0466967_0000504
330 Ga0495638_0003991
331 Ga0495583_0129294
332 Ga0495606_0014573
333 Ga0495628_0635542
334 Ga0495652_0919169
335 Ga0495654_0390355
336 Ga0495599_0121975
337 Ga0495589_0330969
338 Ga0496115_0105317
339 Ga0496120_0314494
340 Ga0501031_0010652
341 Ga0501031_0032586
342 Ga0501032_0116608
343 Ga0501032_0709881
344 Ga0501033_0044539
345 Ga0501033_0108162
346 Ga0501033_0195896
347 Ga0501034_0052059
348 Ga0501034_0294558
349 Ga0501034_0380447
350 Ga0501034_0913171
351 Ga0501034_1388590
352 Ga0501036_0031337
353 Ga0501036_0178222
354 Ga0501036_0472774
355 Ga0501037_0080598
356 Ga0501037_0174664
357 Ga0501037_0316759
358 Ga0501038_0012331
359 Ga0501038_0077976
360 Ga0501038_0808329
361 Ga0501039_0223660
362 Ga0501040_1100447
363 Ga0501041_0743084
364 Ga0501043_0062313
365 Ga0501043_0151680
366 Ga0501043_0513579
367 Ga0501043_0538004
368 Ga0501047_0038832
369 Ga0501047_0118490
370 Ga0501047_0259534
371 Ga0501048_0114735
372 Ga0501048_0409880
373 Ga0501068_0242494
374 Ga0501070_0034000
375 Ga0501070_0044712
376 Ga0501070_0162668
377 Ga0501071_0529938
378 Ga0501072_0315596
379 Ga0501073_0364615
380 Ga0501074_0605417
381 Ga0501076_0202203
382 Ga0501076_1552767
383 Ga0501079_0974043
384 Ga0501080_0070841
385 Ga0501035_0048149
386 Ga0501035_0092296
387 Ga0501035_0110302
388 Ga0501044_0021784
389 Ga0501044_0300108
390 Ga0501044_0788100
391 Ga0501044_1386450
392 Ga0501045_0852088
393 Ga0495601_0360681
394 Ga0495655_0000518
395 Ga0500646_0173147
396 Ga0500641_0370887
397 Ga0500648_224675
398 Ga0500559_0033710
399 Ga0500564_111399
400 Ga0500573_0035475
401 Ga0500577_0109841
402 Ga0500590_221150
403 Ga0500639_156072
404 Ga0500636_0045924
405 Ga0500596_000877
406 Ga0501082_1487082
407 Ga0530510_0930696
408 2824683356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07927

HicA_toxin

HicA toxin of bacterial toxin-antitoxin,

9

66

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1whz-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.9354 7 76
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.9154 9 69
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.8873 9 69
1whz-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.8854 7 76
5yrz-assembly1.cif.gz_D toxin-antitoxin complex from streptococcus pneumoniae 0.8493 9 69
ID Description Score Start End Superfamily
af_Q54V25_1_59_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.9294 9 69 3.30.920.30
1whzA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.9176 10 76 3.30.920.30
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.9153 9 69 3.30.920.30
af_Q54V25_1_59_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.9149 9 69 3.30.920.30
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8873 9 69 3.30.920.30
ID Description Score Start End GO Terms
AF-A0A7V5VNJ5-F1-model_v4 Addiction module toxin, HicA family 0.9849 9 78 GO:0003729
GO:0004519
AF-A0A2V8Q1K9-F1-model_v4 Toxin-antitoxin system, toxin component, HicA family protein 0.9815 9 78 GO:0003729
GO:0004519
AF-A0A2V9K0J2-F1-model_v4 Addiction module toxin, HicA family 0.9805 9 77 GO:0003729
GO:0004519
AF-A0A365H3Y7-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.9746 9 78 GO:0003729
GO:0004519
AF-A0A7Y4UI36-F1-model_v4 Addiction module toxin, HicA family 0.9716 6 78 GO:0003729
GO:0004519

Map