F312629

General Info

Members Datasets Scaffolds Average Seq Length
204 145 408 249

Family's Representative Sequence

Representative Sequence 3300025938|Ga0207704_10095286|Ga0207704_100952862
Length 273
Sequence MNFTHLPNHPITQFEVNVMRIPFIAGNWKMFKTVQESVVFVKELRLIVHDVTDVEIVVAPPFTAVHAAAEAARNTNIGVAAQDLFWEREGAFTGEVAPGMIKEAGAEYVIVGHSERRRLFGETDAVVNKKTAAAIASGLTAIVCVGETLEERERNETLAVLDRQIAEGLKGLSPAEVRELVVAYEPVWAIGTGRNATTQQAQDAHAHVRTRLAEAFGKDAAEHCHVIYGGSVKPDNIRGLIAEPDVDGALVGGASLDVKSFASIVTQSRAATV

Samples

Sample ID Description Type Environment
1 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
144 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.98
Rhizosphere 99.02
Stem 0
Stem Tuber 0
Unclassified 1.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207704_10095286 3300025938 Bacteria 1967
2 JGI25406J46586_10000005 3300003203 Bacteria 118289
3 Ga0065707_10115100 3300005295 Bacteria 2276
4 Ga0070683_100093754 3300005329 Unclassified 2821
5 Ga0070683_100110807 3300005329 Bacteria 2589
6 Ga0070690_100181769 3300005330 Bacteria 1454
7 Ga0068869_100387510 3300005334 Bacteria 1147
8 Ga0070666_10137697 3300005335 Bacteria 1699
9 Ga0070680_100191223 3300005336 Unclassified 1724
10 Ga0068868_100020479 3300005338 Bacteria 4971
11 Ga0068868_100370887 3300005338 Bacteria 1230
12 Ga0070675_100000453 3300005354 Bacteria 28021
13 Ga0070675_100336872 3300005354 Bacteria 1335
14 Ga0070675_100437191 3300005354 Bacteria 1172
15 Ga0070671_100068651 3300005355 Bacteria 2957
16 Ga0070674_100073118 3300005356 Bacteria 2430
17 Ga0070667_100060218 3300005367 Bacteria 3212
18 Ga0070709_10153050 3300005434 Bacteria 1596
19 Ga0070713_100032724 3300005436 Bacteria 4157
20 Ga0070701_10253672 3300005438 Bacteria 1063
21 Ga0070711_100021530 3300005439 Bacteria 4171
22 Ga0070708_100048003 3300005445 Bacteria 3773
23 Ga0070681_10029345 3300005458 Bacteria 5523
24 Ga0068867_100240326 3300005459 Bacteria 1468
25 Ga0070706_100000435 3300005467 Bacteria 50153
26 Ga0070707_100005935 3300005468 Bacteria 11398
27 Ga0070707_100007536 3300005468 Bacteria 10110
28 Ga0070707_100051398 3300005468 Bacteria 3951
29 Ga0070698_100016137 3300005471 Bacteria 7887
30 Ga0070698_100693896 3300005471 Bacteria 960
31 Ga0070699_100327642 3300005518 Bacteria 1377
32 Ga0070684_100245846 3300005535 Bacteria 1635
33 Ga0070697_100002470 3300005536 Bacteria 14215
34 Ga0070697_100006094 3300005536 Bacteria 9327
35 Ga0070697_100010208 3300005536 Bacteria 7324
36 Ga0070697_100233391 3300005536 Bacteria 1569
37 Ga0070672_100058898 3300005543 Bacteria 3021
38 Ga0070672_100175315 3300005543 Bacteria 1785
39 Ga0070665_100039172 3300005548 Bacteria 4767
40 Ga0070704_100054904 3300005549 Bacteria 2822
41 Ga0070704_100161578 3300005549 Bacteria 1772
42 Ga0070664_100025963 3300005564 Bacteria 4856
43 Ga0068859_100283405 3300005617 Bacteria 1750
44 Ga0068859_100796547 3300005617 Bacteria 1033
45 Ga0068858_100180201 3300005842 Bacteria 1995
46 Ga0068858_100338117 3300005842 Bacteria 1441
47 Ga0068860_100032907 3300005843 Bacteria 4979
48 Ga0068860_100556124 3300005843 Bacteria 1150
49 Ga0068862_100374324 3300005844 Bacteria 1327
50 Ga0070712_100526480 3300006175 Bacteria 993
51 Ga0097621_100013886 3300006237 Bacteria 6014
52 Ga0097621_100636741 3300006237 Bacteria 977
53 Ga0068871_100002885 3300006358 Bacteria 11792
54 Ga0068871_100061877 3300006358 Bacteria 3058
55 Ga0075428_100183119 3300006844 Bacteria 2267
56 Ga0075431_100065462 3300006847 Bacteria 3753
57 Ga0075433_10262248 3300006852 Bacteria 1532
58 Ga0075433_10818937 3300006852 Bacteria 813
59 Ga0075434_100016570 3300006871 Bacteria 7086
60 Ga0075434_100059979 3300006871 Bacteria 3783
61 Ga0075434_100670477 3300006871 Bacteria 1055
62 Ga0068865_100071014 3300006881 Bacteria 2468
63 Ga0075436_100003507 3300006914 Bacteria 10754
64 Ga0097620_100283424 3300006931 Bacteria 1750
65 Ga0097620_100796613 3300006931 Bacteria 1033
66 Ga0075435_100007710 3300007076 Bacteria 7694
67 Ga0075435_100017869 3300007076 Bacteria 5375
68 Ga0099794_10000203 3300007265 Bacteria 21534
69 Ga0099794_10184736 3300007265 Bacteria 1065
70 Ga0099794_10454121 3300007265 Bacteria 672
71 Ga0111539_10006714 3300009094 Bacteria 14817
72 Ga0111539_10280542 3300009094 Bacteria 1939
73 Ga0111539_10328111 3300009094 Bacteria 1781
74 Ga0105245_10449163 3300009098 Bacteria 1297
75 Ga0114129_10084847 3300009147 Bacteria 4395
76 Ga0114129_10336095 3300009147 Bacteria 2004
77 Ga0105242_10423252 3300009176 Bacteria 1248
78 Ga0105242_10724040 3300009176 Bacteria 976
79 Ga0105248_10149187 3300009177 Bacteria 2638
80 Ga0105248_10292696 3300009177 Bacteria 1833
81 Ga0105238_10162441 3300009551 Bacteria 2209
82 Ga0105249_10387262 3300009553 Bacteria 1425
83 Ga0157370_10145834 3300013104 Unclassified 2204
84 Ga0157369_10146898 3300013105 Unclassified 2493
85 Ga0157374_10062359 3300013296 Bacteria 3494
86 Ga0157374_10698339 3300013296 Bacteria 1027
87 Ga0163162_10129916 3300013306 Bacteria 2627
88 Ga0157375_10067342 3300013308 Bacteria 3578
89 Ga0163163_10020854 3300014325 Bacteria 6177
90 Ga0157380_10024292 3300014326 Bacteria 4586
91 Ga0157380_11145569 3300014326 Bacteria 819
92 Ga0157377_10048278 3300014745 Bacteria 2388
93 Ga0157379_10196390 3300014968 Bacteria 1824
94 Ga0157376_10001942 3300014969 Bacteria 13816
95 Ga0157376_10103340 3300014969 Bacteria 2494
96 Ga0157376_10172460 3300014969 Bacteria 1971
97 Ga0157376_10187579 3300014969 Bacteria 1894
98 Ga0163161_10154421 3300017792 Bacteria 1746
99 Ga0207653_10024606 3300025885 Bacteria 1922
100 Ga0207685_10067859 3300025905 Bacteria 1435
101 Ga0207699_10044702 3300025906 Bacteria 2579
102 Ga0207645_10141799 3300025907 Bacteria 1566
103 Ga0207684_10000017 3300025910 Bacteria 385006
104 Ga0207684_10011164 3300025910 Bacteria 7865
105 Ga0207663_10020900 3300025916 Bacteria 3716
106 Ga0207660_10598236 3300025917 Bacteria 898
107 Ga0207649_10104763 3300025920 Bacteria 1879
108 Ga0207652_10071164 3300025921 Bacteria 3022
109 Ga0207646_10025035 3300025922 Bacteria 5463
110 Ga0207646_10045528 3300025922 Bacteria 3939
111 Ga0207646_10183492 3300025922 Bacteria 1890
112 Ga0207694_10117227 3300025924 Bacteria 2123
113 Ga0207659_10003168 3300025926 Bacteria 9836
114 Ga0207700_10021225 3300025928 Bacteria 4430
115 Ga0207700_10028455 3300025928 Bacteria 3930
116 Ga0207700_10069093 3300025928 Bacteria 2710
117 Ga0207664_10011799 3300025929 Bacteria 6228
118 Ga0207691_10009603 3300025940 Bacteria 9284
119 Ga0207711_10661386 3300025941 Bacteria 974
120 Ga0207661_10080982 3300025944 Bacteria 2681
121 Ga0207661_10086401 3300025944 Bacteria 2603
122 Ga0207661_10136874 3300025944 Bacteria 2104
123 Ga0207661_10239402 3300025944 Bacteria 1610
124 Ga0207679_10051175 3300025945 Bacteria 3023
125 Ga0207651_10014513 3300025960 Bacteria 4553
126 Ga0207640_10097021 3300025981 Bacteria 2057
127 Ga0207640_10254083 3300025981 Bacteria 1366
128 Ga0207658_10039356 3300025986 Bacteria 3411
129 Ga0207677_10314710 3300026023 Bacteria 1298
130 Ga0207648_10106619 3300026089 Bacteria 2459
131 Ga0207675_100078475 3300026118 Bacteria 3094
132 Ga0207675_100360486 3300026118 Bacteria 1426
133 Ga0207683_10445281 3300026121 Bacteria 1194
134 Ga0209588_1000041 3300027671 Bacteria 59777
135 Ga0209588_1125977 3300027671 Bacteria 818
136 Ga0207428_10114998 3300027907 Bacteria 2067
137 Ga0268265_10259522 3300028380 Bacteria 1544
138 Ga0268264_10064897 3300028381 Bacteria 3074
139 Ga0268264_10349599 3300028381 Bacteria 1407
140 Ga0265314_10089562 3300031711 Bacteria 2007
141 Ga0307413_10180159 3300031824 Bacteria 1506
142 Ga0373954_0128506 3300035118 Bacteria 1233
143 Ga0373955_0425420 3300035172 Bacteria 808
144 Ga0373925_0092081 3300037068 Bacteria 2319
145 Ga0451577_0194916 3300042876 Bacteria 1828
146 Ga0451577_0463553 3300042876 Bacteria 1151
147 Ga0453683_0002957 3300044673 Bacteria 12770
148 Ga0453684_0002361 3300044712 Bacteria 46138
149 Ga0453684_0398008 3300044712 Bacteria 1543
150 Ga0451576_0001014 3300045051 Bacteria 51909
151 Ga0451576_0190211 3300045051 Bacteria 2143
152 Ga0451576_0520298 3300045051 Bacteria 1250
153 Ga0495592_0045870 3300046454 Bacteria 3259
154 Ga0495653_0107445 3300046463 Bacteria 2011
155 Ga0495639_0177323 3300046475 Bacteria 1036
156 Ga0495662_0015445 3300046476 Bacteria 3706
157 Ga0495664_0017062 3300046477 Bacteria 4147
158 Ga0495628_0055476 3300046516 Bacteria 3121
159 Ga0495630_0040756 3300046517 Bacteria 3470
160 Ga0495640_0042583 3300046533 Bacteria 3166
161 Ga0495640_0195449 3300046533 Bacteria 1284
162 Ga0495586_0095582 3300046535 Bacteria 1645
163 Ga0495645_0004452 3300046543 Bacteria 9561
164 Ga0495645_0110004 3300046543 Bacteria 1951
165 Ga0495633_0071707 3300046558 Bacteria 1616
166 Ga0495667_0156291 3300046559 Bacteria 1467
167 Ga0495634_0164772 3300046642 Bacteria 1396
168 Ga0495634_0184316 3300046642 Bacteria 1305
169 Ga0495635_0024807 3300046663 Bacteria 4178
170 Ga0495635_0154396 3300046663 Bacteria 1563
171 Ga0495588_0249825 3300046674 Bacteria 935
172 Ga0495599_0045236 3300046678 Bacteria 2760
173 Ga0495646_0037345 3300046680 Bacteria 3005
174 Ga0495613_0065718 3300046689 Bacteria 2650
175 Ga0495674_0100083 3300047319 Bacteria 2467
176 Ga0495680_0050114 3300047322 Bacteria 3266
177 Ga0495684_0081934 3300047471 Bacteria 2448
178 Ga0495602_0297824 3300048088 Bacteria 1181
179 Ga0496108_0844200 3300048911 Bacteria 788
180 Ga0496112_0404360 3300048915 Bacteria 1305
181 Ga0501039_0239435 3300049575 Bacteria 1427
182 Ga0501048_0416240 3300049582 Bacteria 961
183 Ga0501068_0152897 3300049584 Bacteria 1451
184 Ga0501071_0102765 3300049587 Bacteria 2108
185 Ga0501072_0006143 3300049588 Bacteria 9157
186 Ga0501081_0069899 3300049743 Bacteria 2447
187 Ga0501081_0070158 3300049743 Bacteria 2442
188 Ga0501035_0468011 3300049822 Bacteria 1041
189 Ga0501045_0014316 3300049824 Bacteria 5620
190 nmdc:mga05p37_78222_c1 3300050507 Bacteria 4072
191 nmdc:mga05p37_87015_c1 3300050507 Bacteria 3851
192 nmdc:mga08y16_315864_c1 3300050511 Bacteria 1609
193 nmdc:mga08y16_49426_c1 3300050511 Bacteria 4402
194 nmdc:mga0n895_720134_c1 3300050512 Bacteria 993
195 nmdc:mga08x19_13845_c2 3300050514 Bacteria 4456
196 nmdc:mga0a205_12273_c1 3300050515 Bacteria 7925
197 nmdc:mga0a205_793217_c1 3300050515 Bacteria 795
198 Ga0501084_0225383 3300054114 Bacteria 1582
199 Ga0501084_0381470 3300054114 Bacteria 1191
200 Ga0590071_000253 3300059421 Bacteria 15521
201 Ga0590074_001207 3300059423 Bacteria 4085
202 Ga0590075_000732 3300059424 Bacteria 8718
203 Ga0590077_001296 3300059426 Bacteria 5952
204 Ga0501082_0812102 3300060353 Bacteria 818
205 Ga0207704_10095286
206 JGI25406J46586_10000005
207 Ga0065707_10115100
208 Ga0070683_100093754
209 Ga0070683_100110807
210 Ga0070690_100181769
211 Ga0068869_100387510
212 Ga0070666_10137697
213 Ga0070680_100191223
214 Ga0068868_100020479
215 Ga0068868_100370887
216 Ga0070675_100000453
217 Ga0070675_100336872
218 Ga0070675_100437191
219 Ga0070671_100068651
220 Ga0070674_100073118
221 Ga0070667_100060218
222 Ga0070709_10153050
223 Ga0070713_100032724
224 Ga0070701_10253672
225 Ga0070711_100021530
226 Ga0070708_100048003
227 Ga0070681_10029345
228 Ga0068867_100240326
229 Ga0070706_100000435
230 Ga0070707_100005935
231 Ga0070707_100007536
232 Ga0070707_100051398
233 Ga0070698_100016137
234 Ga0070698_100693896
235 Ga0070699_100327642
236 Ga0070684_100245846
237 Ga0070697_100002470
238 Ga0070697_100006094
239 Ga0070697_100010208
240 Ga0070697_100233391
241 Ga0070672_100058898
242 Ga0070672_100175315
243 Ga0070665_100039172
244 Ga0070704_100054904
245 Ga0070704_100161578
246 Ga0070664_100025963
247 Ga0068859_100283405
248 Ga0068859_100796547
249 Ga0068858_100180201
250 Ga0068858_100338117
251 Ga0068860_100032907
252 Ga0068860_100556124
253 Ga0068862_100374324
254 Ga0070712_100526480
255 Ga0097621_100013886
256 Ga0097621_100636741
257 Ga0068871_100002885
258 Ga0068871_100061877
259 Ga0075428_100183119
260 Ga0075431_100065462
261 Ga0075433_10262248
262 Ga0075433_10818937
263 Ga0075434_100016570
264 Ga0075434_100059979
265 Ga0075434_100670477
266 Ga0068865_100071014
267 Ga0075436_100003507
268 Ga0097620_100283424
269 Ga0097620_100796613
270 Ga0075435_100007710
271 Ga0075435_100017869
272 Ga0099794_10000203
273 Ga0099794_10184736
274 Ga0099794_10454121
275 Ga0111539_10006714
276 Ga0111539_10280542
277 Ga0111539_10328111
278 Ga0105245_10449163
279 Ga0114129_10084847
280 Ga0114129_10336095
281 Ga0105242_10423252
282 Ga0105242_10724040
283 Ga0105248_10149187
284 Ga0105248_10292696
285 Ga0105238_10162441
286 Ga0105249_10387262
287 Ga0157370_10145834
288 Ga0157369_10146898
289 Ga0157374_10062359
290 Ga0157374_10698339
291 Ga0163162_10129916
292 Ga0157375_10067342
293 Ga0163163_10020854
294 Ga0157380_10024292
295 Ga0157380_11145569
296 Ga0157377_10048278
297 Ga0157379_10196390
298 Ga0157376_10001942
299 Ga0157376_10103340
300 Ga0157376_10172460
301 Ga0157376_10187579
302 Ga0163161_10154421
303 Ga0207653_10024606
304 Ga0207685_10067859
305 Ga0207699_10044702
306 Ga0207645_10141799
307 Ga0207684_10000017
308 Ga0207684_10011164
309 Ga0207663_10020900
310 Ga0207660_10598236
311 Ga0207649_10104763
312 Ga0207652_10071164
313 Ga0207646_10025035
314 Ga0207646_10045528
315 Ga0207646_10183492
316 Ga0207694_10117227
317 Ga0207659_10003168
318 Ga0207700_10021225
319 Ga0207700_10028455
320 Ga0207700_10069093
321 Ga0207664_10011799
322 Ga0207691_10009603
323 Ga0207711_10661386
324 Ga0207661_10080982
325 Ga0207661_10086401
326 Ga0207661_10136874
327 Ga0207661_10239402
328 Ga0207679_10051175
329 Ga0207651_10014513
330 Ga0207640_10097021
331 Ga0207640_10254083
332 Ga0207658_10039356
333 Ga0207677_10314710
334 Ga0207648_10106619
335 Ga0207675_100078475
336 Ga0207675_100360486
337 Ga0207683_10445281
338 Ga0209588_1000041
339 Ga0209588_1125977
340 Ga0207428_10114998
341 Ga0268265_10259522
342 Ga0268264_10064897
343 Ga0268264_10349599
344 Ga0265314_10089562
345 Ga0307413_10180159
346 Ga0373954_0128506
347 Ga0373955_0425420
348 Ga0373925_0092081
349 Ga0451577_0194916
350 Ga0451577_0463553
351 Ga0453683_0002957
352 Ga0453684_0002361
353 Ga0453684_0398008
354 Ga0451576_0001014
355 Ga0451576_0190211
356 Ga0451576_0520298
357 Ga0495592_0045870
358 Ga0495653_0107445
359 Ga0495639_0177323
360 Ga0495662_0015445
361 Ga0495664_0017062
362 Ga0495628_0055476
363 Ga0495630_0040756
364 Ga0495640_0042583
365 Ga0495640_0195449
366 Ga0495586_0095582
367 Ga0495645_0004452
368 Ga0495645_0110004
369 Ga0495633_0071707
370 Ga0495667_0156291
371 Ga0495634_0164772
372 Ga0495634_0184316
373 Ga0495635_0024807
374 Ga0495635_0154396
375 Ga0495588_0249825
376 Ga0495599_0045236
377 Ga0495646_0037345
378 Ga0495613_0065718
379 Ga0495674_0100083
380 Ga0495680_0050114
381 Ga0495684_0081934
382 Ga0495602_0297824
383 Ga0496108_0844200
384 Ga0496112_0404360
385 Ga0501039_0239435
386 Ga0501048_0416240
387 Ga0501068_0152897
388 Ga0501071_0102765
389 Ga0501072_0006143
390 Ga0501081_0069899
391 Ga0501081_0070158
392 Ga0501035_0468011
393 Ga0501045_0014316
394 nmdc:mga05p37_78222_c1
395 nmdc:mga05p37_87015_c1
396 nmdc:mga08y16_315864_c1
397 nmdc:mga08y16_49426_c1
398 nmdc:mga0n895_720134_c1
399 nmdc:mga08x19_13845_c2
400 nmdc:mga0a205_12273_c1
401 nmdc:mga0a205_793217_c1
402 Ga0501084_0225383
403 Ga0501084_0381470
404 Ga0590071_000253
405 Ga0590074_001207
406 Ga0590075_000732
407 Ga0590077_001296
408 Ga0501082_0812102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

22

268

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b9b-assembly1.cif.gz_B triosephosphate isomerase of thermotoga maritima 0.9698 2 250
4y8f-assembly1.cif.gz_A-2 crystal structure of triosephosphate isomerase from clostridium perfringens 0.9688 1 249
4y96-assembly1.cif.gz_A crystal structure of triosephosphate isomerase from gemmata obscuriglobus 0.9677 1 252
7rmn-assembly1.cif.gz_B crystal structure of triosephosphate isomerase from verrucomicrobium spinosum 0.9652 1 250
2btm-assembly1.cif.gz_B does the his12-lys13 pair play a role in the adaptation of thermophilic tims to high temperatures? 0.9648 2 252
ID Description Score Start End Superfamily
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9677 1 252 3.20.20.70
af_P0A858_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9657 1 251 3.20.20.70
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9639 1 252 3.20.20.70
3taoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9639 1 251 3.20.20.70
af_Q4DV43_1_251_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9614 2 252 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V6GZS1-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9928 79 254 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A645DQY7-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9884 94 251 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-T2RDA1-F1-model_v4 deleted 0.9883 84 249
AF-X1GGX7-F1-model_v4 Triosephosphate isomerase 0.9879 94 251 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A2V6GZS1-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9872 79 254 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166

Map