F312532

General Info

Members Datasets Scaffolds Average Seq Length
204 116 408 274

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10204040|Ga0157374_102040402
Length 310
Sequence LLILGLWDFVIDPDRCRKRNLKIPISLNLKISKRPLIKKGSLMPKRRIIFRWIKIVLMLYGLIGIAIYYLQDRILFHPEKMEKHHSYDFRIPHKEINIAYNDSCNINIIQFTTAIKPKGVVLYFHGNRKNIAWYARYAPNFTSNGYEVWMMDYPGYGKSTGTLTEQFLYNYAEQLYRLATARFGKDSIVLYGKSMGTGIAAWLASRKNCKELILETPYYSMTSLCAHYFPIYPVGRMIHYKIPSYQYLQEVIVPVTIFHGTSDGVIPYNNAIKLQPFLKPGDQFITINGGSHNNLNDFPLFHQKLDSLLH

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
99 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
100 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 0
Rhizosphere 98.04
Stem 0
Stem Tuber 0
Unclassified 7.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10204040 3300013296 Bacteria 1937
2 Ga0065714_10088757 3300005288 Bacteria 2004
3 Ga0065704_10120117 3300005289 Bacteria 1788
4 Ga0065712_10109652 3300005290 Bacteria 1851
5 Ga0065715_10029400 3300005293 Bacteria 2672
6 Ga0065707_10101540 3300005295 Bacteria 2859
7 Ga0070658_10043277 3300005327 Bacteria 3638
8 Ga0070670_100046702 3300005331 Bacteria 3724
9 Ga0070670_100051903 3300005331 Bacteria 3521
10 Ga0070670_100194452 3300005331 Unclassified 1762
11 Ga0068869_100031121 3300005334 Bacteria 3753
12 Ga0068869_100034310 3300005334 Bacteria 3588
13 Ga0070666_10000143 3300005335 Bacteria 48999
14 Ga0070666_10165446 3300005335 Bacteria 1547
15 Ga0070682_100000005 3300005337 Bacteria 386439
16 Ga0068868_100001434 3300005338 Bacteria 16445
17 Ga0070689_100081811 3300005340 Bacteria 2535
18 Ga0070668_100091249 3300005347 Bacteria 2401
19 Ga0070668_100199040 3300005347 Bacteria 1644
20 Ga0070669_100209065 3300005353 Bacteria 1538
21 Ga0070671_100065222 3300005355 Unclassified 3033
22 Ga0070671_100256525 3300005355 Bacteria 1486
23 Ga0070673_100073921 3300005364 Bacteria 2745
24 Ga0070673_100088432 3300005364 Bacteria 2527
25 Ga0070688_100103220 3300005365 Bacteria 1883
26 Ga0070667_100006513 3300005367 Bacteria 9709
27 Ga0070701_10040185 3300005438 Bacteria 2376
28 Ga0070678_100012996 3300005456 Bacteria 5200
29 Ga0068867_100043948 3300005459 Bacteria 3272
30 Ga0068867_100102673 3300005459 Unclassified 2186
31 Ga0068867_100367895 3300005459 Bacteria 1204
32 Ga0070685_10008350 3300005466 Bacteria 5316
33 Ga0070685_10115582 3300005466 Bacteria 1659
34 Ga0070685_10326231 3300005466 Bacteria 1042
35 Ga0070698_100001279 3300005471 Bacteria 28081
36 Ga0070698_100002592 3300005471 Bacteria 19910
37 Ga0070698_100044781 3300005471 Bacteria 4528
38 Ga0070699_100090417 3300005518 Bacteria 2676
39 Ga0068853_100123189 3300005539 Bacteria 2315
40 Ga0070672_100063325 3300005543 Bacteria 2920
41 Ga0070672_100336908 3300005543 Bacteria 1284
42 Ga0070672_100519122 3300005543 Bacteria 1032
43 Ga0070665_100233317 3300005548 Bacteria 1840
44 Ga0070704_100137914 3300005549 Bacteria 1900
45 Ga0070704_100247186 3300005549 Bacteria 1463
46 Ga0070664_100293135 3300005564 Bacteria 1469
47 Ga0068857_100097715 3300005577 Bacteria 2633
48 Ga0068852_100006437 3300005616 Bacteria 8486
49 Ga0068852_100357547 3300005616 Bacteria 1427
50 Ga0068859_100000099 3300005617 Bacteria 80240
51 Ga0068859_100030076 3300005617 Bacteria 5449
52 Ga0068859_100248581 3300005617 Bacteria 1869
53 Ga0068859_100600883 3300005617 Bacteria 1193
54 Ga0068859_100902811 3300005617 Bacteria 968
55 Ga0068864_100008709 3300005618 Bacteria 8369
56 Ga0068864_100300436 3300005618 Bacteria 1503
57 Ga0068851_10009952 3300005834 Bacteria 4427
58 Ga0068851_10124618 3300005834 Bacteria 1388
59 Ga0068870_10120699 3300005840 Bacteria 1509
60 Ga0068863_100002277 3300005841 Bacteria 19080
61 Ga0068863_100059916 3300005841 Bacteria 3601
62 Ga0068863_100157978 3300005841 Bacteria 2171
63 Ga0068858_100003774 3300005842 Bacteria 14974
64 Ga0068860_100062674 3300005843 Bacteria 3533
65 Ga0068862_100105511 3300005844 Bacteria 2469
66 Ga0068862_100429857 3300005844 Bacteria 1241
67 Ga0097621_100002450 3300006237 Bacteria 12708
68 Ga0097621_100004097 3300006237 Bacteria 10111
69 Ga0097621_100006375 3300006237 Bacteria 8373
70 Ga0097621_100007848 3300006237 Bacteria 7654
71 Ga0097621_100678476 3300006237 Bacteria 947
72 Ga0068871_100001412 3300006358 Bacteria 16072
73 Ga0068871_100001627 3300006358 Bacteria 15132
74 Ga0068871_100004396 3300006358 Bacteria 9796
75 Ga0068871_100045591 3300006358 Bacteria 3529
76 Ga0068871_100046880 3300006358 Bacteria 3483
77 Ga0068871_100204072 3300006358 Bacteria 1708
78 Ga0068871_100522852 3300006358 Bacteria 1072
79 Ga0075428_100000685 3300006844 Bacteria 34851
80 Ga0075428_100000697 3300006844 Bacteria 34709
81 Ga0075428_100038235 3300006844 Bacteria 5280
82 Ga0075430_100027948 3300006846 Bacteria 4791
83 Ga0075430_100045080 3300006846 Bacteria 3726
84 Ga0075431_100084149 3300006847 Bacteria 3284
85 Ga0075429_100010566 3300006880 Bacteria 7984
86 Ga0097620_100000099 3300006931 Bacteria 80240
87 Ga0097620_100030075 3300006931 Bacteria 5449
88 Ga0097620_100248582 3300006931 Bacteria 1869
89 Ga0097620_100600931 3300006931 Bacteria 1193
90 Ga0097620_100902866 3300006931 Bacteria 968
91 Ga0114129_10369714 3300009147 Bacteria 1895
92 Ga0105241_10001380 3300009174 Bacteria 18536
93 Ga0105242_10017146 3300009176 Bacteria 5639
94 Ga0105242_10029348 3300009176 Bacteria 4386
95 Ga0105248_10030848 3300009177 Bacteria 5989
96 Ga0105237_10001023 3300009545 Bacteria 37620
97 Ga0105249_10006091 3300009553 Bacteria 10457
98 Ga0105249_10021445 3300009553 Bacteria 5783
99 Ga0105249_10554732 3300009553 Bacteria 1200
100 Ga0105239_10174048 3300010375 Bacteria 2408
101 Ga0157370_10127068 3300013104 Unclassified 2379
102 Ga0157370_10175870 3300013104 Bacteria 1990
103 Ga0157374_10139824 3300013296 Bacteria 2350
104 Ga0157378_10003494 3300013297 Bacteria 13950
105 Ga0157378_10004116 3300013297 Bacteria 12844
106 Ga0157378_10019172 3300013297 Bacteria 6012
107 Ga0157378_10031569 3300013297 Bacteria 4678
108 Ga0163162_10000124 3300013306 Bacteria 68603
109 Ga0163162_10000994 3300013306 Bacteria 26396
110 Ga0163162_10059643 3300013306 Bacteria 3848
111 Ga0163162_10197781 3300013306 Bacteria 2139
112 Ga0163162_10331455 3300013306 Bacteria 1654
113 Ga0163162_10365855 3300013306 Bacteria 1575
114 Ga0163162_10606424 3300013306 Bacteria 1221
115 Ga0157372_10457729 3300013307 Bacteria 1487
116 Ga0157375_10017191 3300013308 Bacteria 6520
117 Ga0157375_10109864 3300013308 Bacteria 2854
118 Ga0157375_10157245 3300013308 Bacteria 2412
119 Ga0157375_10158469 3300013308 Unclassified 2404
120 Ga0163163_10001603 3300014325 Bacteria 19013
121 Ga0163163_10453446 3300014325 Bacteria 1343
122 Ga0163163_10649129 3300014325 Bacteria 1119
123 Ga0163163_10684088 3300014325 Bacteria 1089
124 Ga0157380_10142902 3300014326 Bacteria 2058
125 Ga0157380_10468607 3300014326 Bacteria 1215
126 Ga0157377_10086001 3300014745 Bacteria 1847
127 Ga0157379_10020384 3300014968 Bacteria 5861
128 Ga0157379_10159190 3300014968 Bacteria 2038
129 Ga0157379_10213875 3300014968 Bacteria 1746
130 Ga0157376_10000404 3300014969 Bacteria 28086
131 Ga0157376_10077372 3300014969 Bacteria 2846
132 Ga0157376_10103591 3300014969 Bacteria 2492
133 Ga0157376_10118293 3300014969 Bacteria 2344
134 Ga0163161_10005954 3300017792 Bacteria 8455
135 Ga0163161_10065329 3300017792 Unclassified 2655
136 Ga0207656_10016136 3300025321 Bacteria 2903
137 Ga0207682_10021727 3300025893 Unclassified 2525
138 Ga0207680_10001105 3300025903 Bacteria 12710
139 Ga0207705_10206936 3300025909 Bacteria 1488
140 Ga0207654_10018960 3300025911 Bacteria 3619
141 Ga0207671_10003880 3300025914 Bacteria 14605
142 Ga0207652_10038355 3300025921 Bacteria 4061
143 Ga0207650_10048808 3300025925 Bacteria 3123
144 Ga0207650_10345443 3300025925 Unclassified 1223
145 Ga0207644_10218157 3300025931 Bacteria 1511
146 Ga0207686_10000722 3300025934 Bacteria 20514
147 Ga0207670_10331393 3300025936 Bacteria 1200
148 Ga0207691_10112105 3300025940 Bacteria 2425
149 Ga0207691_10131687 3300025940 Bacteria 2208
150 Ga0207691_10437575 3300025940 Bacteria 1113
151 Ga0207689_10005694 3300025942 Bacteria 11078
152 Ga0207689_10011346 3300025942 Bacteria 7643
153 Ga0207651_10015441 3300025960 Bacteria 4437
154 Ga0207712_10012136 3300025961 Bacteria 5504
155 Ga0207712_10017073 3300025961 Bacteria 4710
156 Ga0207712_10017365 3300025961 Bacteria 4672
157 Ga0207658_10029891 3300025986 Unclassified 3853
158 Ga0207658_10129910 3300025986 Bacteria 2022
159 Ga0207703_10002892 3300026035 Bacteria 14620
160 Ga0207639_10372412 3300026041 Bacteria 1280
161 Ga0207641_10000133 3300026088 Bacteria 109199
162 Ga0207641_10000783 3300026088 Bacteria 33947
163 Ga0207641_10006390 3300026088 Bacteria 9936
164 Ga0207641_10162967 3300026088 Bacteria 2028
165 Ga0207648_10104367 3300026089 Bacteria 2486
166 Ga0207648_10148989 3300026089 Bacteria 2064
167 Ga0207648_10424174 3300026089 Bacteria 1208
168 Ga0207676_10007555 3300026095 Bacteria 7712
169 Ga0207674_10043469 3300026116 Bacteria 4633
170 Ga0207675_100031505 3300026118 Bacteria 4939
171 Ga0207683_10015154 3300026121 Bacteria 6560
172 Ga0207683_10091730 3300026121 Unclassified 2706
173 Ga0207683_10396367 3300026121 Unclassified 1270
174 Ga0207698_10016962 3300026142 Bacteria 4927
175 Ga0207698_10580428 3300026142 Bacteria 1103
176 Ga0268264_10002332 3300028381 Bacteria 16777
177 Ga0268264_10068678 3300028381 Bacteria 2996
178 Ga0307515_10000024 3300028794 Bacteria 393119
179 Ga0265340_10151228 3300031247 Bacteria 1058
180 Ga0307509_10156726 3300031507 Bacteria 2182
181 Ga0265313_10052988 3300031595 Bacteria 1933
182 Ga0307508_10000162 3300031616 Bacteria 80675
183 Ga0373937_0384120 3300036401 Unclassified 1332
184 Ga0439465_0088975 3300041413 Bacteria 1054
185 Ga0439443_038171 3300042003 Unclassified 813
186 Ga0450923_002452 3300042125 Bacteria 2663
187 Ga0466969_0003430 3300044656 Bacteria 8431
188 Ga0466966_0000054 3300044684 Bacteria 82352
189 Ga0453684_0058184 3300044712 Bacteria 4994
190 Ga0466959_0000012 3300045049 Bacteria 168961
191 Ga0495668_0000106 3300046616 Bacteria 133476
192 Ga0495672_0013705 3300047320 Bacteria 5578
193 Ga0495672_0026218 3300047320 Bacteria 3721
194 Ga0501034_0012164 3300049571 Bacteria 8899
195 Ga0501036_0281097 3300049572 Bacteria 1393
196 Ga0501043_0223205 3300049579 Bacteria 1457
197 Ga0501225_0003122 3300049705 Bacteria 5063
198 Ga0501044_0197628 3300049823 Unclassified 1970
199 nmdc:mga05p37_311587_c1 3300050507 Bacteria 1865
200 nmdc:mga09592_4352_c1 3300050508 Bacteria 11446
201 nmdc:mga09592_79673_c1 3300050508 Unclassified 2789
202 nmdc:mga0qj67_20055_c1 3300050509 Bacteria 5115
203 nmdc:mga06r32_83276_c1 3300050510 Unclassified 3117
204 Ga0500611_000029 3300053727 Bacteria 89288
205 Ga0157374_10204040
206 Ga0065714_10088757
207 Ga0065704_10120117
208 Ga0065712_10109652
209 Ga0065715_10029400
210 Ga0065707_10101540
211 Ga0070658_10043277
212 Ga0070670_100046702
213 Ga0070670_100051903
214 Ga0070670_100194452
215 Ga0068869_100031121
216 Ga0068869_100034310
217 Ga0070666_10000143
218 Ga0070666_10165446
219 Ga0070682_100000005
220 Ga0068868_100001434
221 Ga0070689_100081811
222 Ga0070668_100091249
223 Ga0070668_100199040
224 Ga0070669_100209065
225 Ga0070671_100065222
226 Ga0070671_100256525
227 Ga0070673_100073921
228 Ga0070673_100088432
229 Ga0070688_100103220
230 Ga0070667_100006513
231 Ga0070701_10040185
232 Ga0070678_100012996
233 Ga0068867_100043948
234 Ga0068867_100102673
235 Ga0068867_100367895
236 Ga0070685_10008350
237 Ga0070685_10115582
238 Ga0070685_10326231
239 Ga0070698_100001279
240 Ga0070698_100002592
241 Ga0070698_100044781
242 Ga0070699_100090417
243 Ga0068853_100123189
244 Ga0070672_100063325
245 Ga0070672_100336908
246 Ga0070672_100519122
247 Ga0070665_100233317
248 Ga0070704_100137914
249 Ga0070704_100247186
250 Ga0070664_100293135
251 Ga0068857_100097715
252 Ga0068852_100006437
253 Ga0068852_100357547
254 Ga0068859_100000099
255 Ga0068859_100030076
256 Ga0068859_100248581
257 Ga0068859_100600883
258 Ga0068859_100902811
259 Ga0068864_100008709
260 Ga0068864_100300436
261 Ga0068851_10009952
262 Ga0068851_10124618
263 Ga0068870_10120699
264 Ga0068863_100002277
265 Ga0068863_100059916
266 Ga0068863_100157978
267 Ga0068858_100003774
268 Ga0068860_100062674
269 Ga0068862_100105511
270 Ga0068862_100429857
271 Ga0097621_100002450
272 Ga0097621_100004097
273 Ga0097621_100006375
274 Ga0097621_100007848
275 Ga0097621_100678476
276 Ga0068871_100001412
277 Ga0068871_100001627
278 Ga0068871_100004396
279 Ga0068871_100045591
280 Ga0068871_100046880
281 Ga0068871_100204072
282 Ga0068871_100522852
283 Ga0075428_100000685
284 Ga0075428_100000697
285 Ga0075428_100038235
286 Ga0075430_100027948
287 Ga0075430_100045080
288 Ga0075431_100084149
289 Ga0075429_100010566
290 Ga0097620_100000099
291 Ga0097620_100030075
292 Ga0097620_100248582
293 Ga0097620_100600931
294 Ga0097620_100902866
295 Ga0114129_10369714
296 Ga0105241_10001380
297 Ga0105242_10017146
298 Ga0105242_10029348
299 Ga0105248_10030848
300 Ga0105237_10001023
301 Ga0105249_10006091
302 Ga0105249_10021445
303 Ga0105249_10554732
304 Ga0105239_10174048
305 Ga0157370_10127068
306 Ga0157370_10175870
307 Ga0157374_10139824
308 Ga0157378_10003494
309 Ga0157378_10004116
310 Ga0157378_10019172
311 Ga0157378_10031569
312 Ga0163162_10000124
313 Ga0163162_10000994
314 Ga0163162_10059643
315 Ga0163162_10197781
316 Ga0163162_10331455
317 Ga0163162_10365855
318 Ga0163162_10606424
319 Ga0157372_10457729
320 Ga0157375_10017191
321 Ga0157375_10109864
322 Ga0157375_10157245
323 Ga0157375_10158469
324 Ga0163163_10001603
325 Ga0163163_10453446
326 Ga0163163_10649129
327 Ga0163163_10684088
328 Ga0157380_10142902
329 Ga0157380_10468607
330 Ga0157377_10086001
331 Ga0157379_10020384
332 Ga0157379_10159190
333 Ga0157379_10213875
334 Ga0157376_10000404
335 Ga0157376_10077372
336 Ga0157376_10103591
337 Ga0157376_10118293
338 Ga0163161_10005954
339 Ga0163161_10065329
340 Ga0207656_10016136
341 Ga0207682_10021727
342 Ga0207680_10001105
343 Ga0207705_10206936
344 Ga0207654_10018960
345 Ga0207671_10003880
346 Ga0207652_10038355
347 Ga0207650_10048808
348 Ga0207650_10345443
349 Ga0207644_10218157
350 Ga0207686_10000722
351 Ga0207670_10331393
352 Ga0207691_10112105
353 Ga0207691_10131687
354 Ga0207691_10437575
355 Ga0207689_10005694
356 Ga0207689_10011346
357 Ga0207651_10015441
358 Ga0207712_10012136
359 Ga0207712_10017073
360 Ga0207712_10017365
361 Ga0207658_10029891
362 Ga0207658_10129910
363 Ga0207703_10002892
364 Ga0207639_10372412
365 Ga0207641_10000133
366 Ga0207641_10000783
367 Ga0207641_10006390
368 Ga0207641_10162967
369 Ga0207648_10104367
370 Ga0207648_10148989
371 Ga0207648_10424174
372 Ga0207676_10007555
373 Ga0207674_10043469
374 Ga0207675_100031505
375 Ga0207683_10015154
376 Ga0207683_10091730
377 Ga0207683_10396367
378 Ga0207698_10016962
379 Ga0207698_10580428
380 Ga0268264_10002332
381 Ga0268264_10068678
382 Ga0307515_10000024
383 Ga0265340_10151228
384 Ga0307509_10156726
385 Ga0265313_10052988
386 Ga0307508_10000162
387 Ga0373937_0384120
388 Ga0439465_0088975
389 Ga0439443_038171
390 Ga0450923_002452
391 Ga0466969_0003430
392 Ga0466966_0000054
393 Ga0453684_0058184
394 Ga0466959_0000012
395 Ga0495668_0000106
396 Ga0495672_0013705
397 Ga0495672_0026218
398 Ga0501034_0012164
399 Ga0501036_0281097
400 Ga0501043_0223205
401 Ga0501225_0003122
402 Ga0501044_0197628
403 nmdc:mga05p37_311587_c1
404 nmdc:mga09592_4352_c1
405 nmdc:mga09592_79673_c1
406 nmdc:mga0qj67_20055_c1
407 nmdc:mga06r32_83276_c1
408 Ga0500611_000029

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

119

237

0.87

PF12146

Hydrolase_4

Serine aminopeptidase, S33

115

247

0.85

PF20408

Abhydrolase_11

Alpha/beta hydrolase domain

117

296

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wwh-assembly2.cif.gz_B crystal structure of the geobacillus thermoglucosidasius feruloyl esterase gthfae 0.8207 50 266
7q4h-assembly1.cif.gz_B a thermostable lipase from thermoanaerobacter thermohydrosulfuricus in complex with pmsf 0.8101 48 267
7q4j-assembly1.cif.gz_B a thermostable lipase from thermoanaerobacter thermohydrosulfuricus in complex a monoacylglycerol intermediate 0.8042 48 267
6ii2-assembly2.cif.gz_B crystal structure of alpha-beta hydrolase (abh) and makes caterpillars floppy (mcf)-like effectors of vibrio vulnificus mo6-24/o 0.8005 51 266
6lzh-assembly1.cif.gz_B crystal structure of alpha/beta hydrolase grgf from penicillium sp. sh18 0.7977 47 267
ID Description Score Start End Superfamily
af_A4IBU0_143_388_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9101 70 266 3.40.50.1820
af_O76462_74_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9085 46 252 3.40.50.1820
af_Q4E4T5_64_355_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8947 51 267 3.40.50.1820
af_Q4D5S0_57_247_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8787 73 249 3.40.50.1820
af_C0H4R4_26_229_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8784 52 253 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4Q3T3E2-F1-model_v4 Alpha/beta fold hydrolase 0.9904 1 268 GO:0016020
GO:0016787
AF-A0A3B7MT36-F1-model_v4 Alpha/beta fold hydrolase 0.9852 2 267 GO:0016020
GO:0016787
AF-A0A3B7MT36-F1-model_v4 Alpha/beta fold hydrolase 0.9708 2 267 GO:0016020
GO:0016787
AF-A0A3D1RGH8-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9706 1 266 GO:0016020
AF-A0A7C3GGG3-F1-model_v4 Alpha/beta fold hydrolase 0.9674 7 267 GO:0016787

Map