F312426

General Info

Members Datasets Scaffolds Average Seq Length
204 161 202 161

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10025759|Ga0105240_100257596
Length 186
Sequence MRQNIDFGPVPPQTRIGHVHLKVSDLERAIAFYRDVLGFQETQRYGRQAAFLSAGGYHHHIGLNTWESAGGSPPPAGSTGLFHLAILYPSRADLADALRRLLEAGIPLEGASDHGVSEALYLRDPDGNGVELYWDRPQDQWPRGKDGQIQMSTDPLNLDDLLRELSDRADGPGRPSTRKQSVDSAP

Samples

Sample ID Description Type Environment
1 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
2 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.61
Metatranscriptomes 4.41
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 5.39
Rhizosphere 90.69
Stem 0
Stem Tuber 0
Unclassified 2.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10075123 3300003316 Bacteria 3753
2 rootH2_10272918 3300003320 Bacteria 1623
3 rootH1_10302527 3300003323 Bacteria 2021
4 Ga0070690_100017161 3300005330 Bacteria 4348
5 Ga0068869_100092366 3300005334 Unclassified 2278
6 Ga0070689_100010806 3300005340 Bacteria 6524
7 Ga0070692_10054608 3300005345 Bacteria 2086
8 Ga0070668_100343657 3300005347 Bacteria 1261
9 Ga0070669_100046185 3300005353 Bacteria 3175
10 Ga0070673_100041794 3300005364 Bacteria 3530
11 Ga0070673_100372705 3300005364 Bacteria 1271
12 Ga0070688_100034476 3300005365 Bacteria 3066
13 Ga0070688_100157691 3300005365 Bacteria 1557
14 Ga0070667_100481702 3300005367 Bacteria 1136
15 Ga0070713_100513940 3300005436 Bacteria 1131
16 Ga0070701_10765381 3300005438 Bacteria 655
17 Ga0070711_100090341 3300005439 Bacteria 2206
18 Ga0070711_100839370 3300005439 Unclassified 781
19 Ga0070678_100242279 3300005456 Bacteria 1508
20 Ga0068867_100301861 3300005459 Unclassified 1320
21 Ga0070685_11184397 3300005466 Archaea 580
22 Ga0070686_100644445 3300005544 Archaea 839
23 Ga0070695_100809845 3300005545 Bacteria 751
24 Ga0070695_100875046 3300005545 Unclassified 724
25 Ga0070665_100331696 3300005548 Bacteria 1526
26 Ga0070665_100851298 3300005548 Bacteria 925
27 Ga0070665_102201917 3300005548 Archaea 555
28 Ga0068855_100009609 3300005563 Bacteria 11670
29 Ga0068852_100235578 3300005616 Bacteria 1747
30 Ga0068852_100676522 3300005616 Bacteria 1041
31 Ga0068859_101403689 3300005617 Bacteria 770
32 Ga0068866_10288043 3300005718 Unclassified 1020
33 Ga0068861_100164998 3300005719 Archaea 1831
34 Ga0068861_101587350 3300005719 Bacteria 644
35 Ga0068860_100992821 3300005843 Archaea 857
36 Ga0068862_101460957 3300005844 Bacteria 688
37 Ga0081455_10003431 3300005937 Bacteria 18219
38 Ga0070717_10789047 3300006028 Bacteria 864
39 Ga0070712_100542838 3300006175 Bacteria 979
40 Ga0070712_101062121 3300006175 Unclassified 702
41 Ga0097621_100479438 3300006237 Bacteria 1124
42 Ga0075428_100400288 3300006844 Bacteria 1472
43 Ga0075434_100016807 3300006871 Bacteria 7041
44 Ga0075434_100108332 3300006871 Bacteria 2788
45 Ga0097620_101403867 3300006931 Bacteria 770
46 Ga0075435_100008945 3300007076 Bacteria 7218
47 Ga0075435_100393904 3300007076 Bacteria 1191
48 Ga0105240_10025759 3300009093 Bacteria 7724
49 Ga0111539_10127287 3300009094 Bacteria 2983
50 Ga0105245_10437287 3300009098 Bacteria 1314
51 Ga0105241_11043338 3300009174 Bacteria 767
52 Ga0105248_10020936 3300009177 Bacteria 7249
53 Ga0157373_10001639 3300013100 Bacteria 17082
54 Ga0157374_10079789 3300013296 Bacteria 3102
55 Ga0157374_10322505 3300013296 Bacteria 1531
56 Ga0157378_11026370 3300013297 Bacteria 860
57 Ga0163162_11292771 3300013306 Unclassified 829
58 Ga0157375_10088648 3300013308 Bacteria 3149
59 Ga0163163_10044168 3300014325 Bacteria 4371
60 Ga0163163_10831842 3300014325 Bacteria 987
61 Ga0157376_10012329 3300014969 Bacteria 6341
62 Ga0157376_10424022 3300014969 Bacteria 1292
63 Ga0163161_10678753 3300017792 Bacteria 856
64 Ga0207673_1000766 3300025290 Bacteria 3467
65 Ga0209050_1000093 3300025298 Bacteria 250654
66 Ga0207695_10040777 3300025913 Bacteria 4973
67 Ga0207693_10473071 3300025915 Bacteria 979
68 Ga0207663_10094588 3300025916 Bacteria 1991
69 Ga0207649_10997210 3300025920 Bacteria 659
70 Ga0207646_10315078 3300025922 Bacteria 1413
71 Ga0207681_10278356 3300025923 Bacteria 1316
72 Ga0207650_10043589 3300025925 Bacteria 3294
73 Ga0207700_10219527 3300025928 Unclassified 1611
74 Ga0207700_10321345 3300025928 Bacteria 1341
75 Ga0207665_10547749 3300025939 Unclassified 898
76 Ga0207711_11458090 3300025941 Bacteria 627
77 Ga0207689_10031234 3300025942 Bacteria 4436
78 Ga0207679_12024387 3300025945 Bacteria 524
79 Ga0207667_10112994 3300025949 Bacteria 2800
80 Ga0207651_10118893 3300025960 Archaea 2000
81 Ga0207658_10244474 3300025986 Bacteria 1522
82 Ga0207702_10453862 3300026078 Bacteria 1244
83 Ga0207648_10478789 3300026089 Unclassified 1137
84 Ga0207674_10175671 3300026116 Bacteria 2094
85 Ga0207675_100031600 3300026118 Bacteria 4932
86 Ga0207683_10283165 3300026121 Bacteria 1515
87 Ga0207698_10603109 3300026142 Bacteria 1083
88 Ga0209999_1068732 3300027543 Bacteria 678
89 Ga0268266_10211712 3300028379 Bacteria 1778
90 Ga0265337_1005878 3300028556 Bacteria 4804
91 Ga0265337_1031215 3300028556 Bacteria 1583
92 Ga0265319_1034234 3300028563 Bacteria 1749
93 Ga0265319_1087779 3300028563 Bacteria 983
94 Ga0265318_10029064 3300028577 Bacteria 2157
95 Ga0265338_10002888 3300028800 Bacteria 25044
96 Ga0265338_10033443 3300028800 Bacteria 4989
97 Ga0265338_10087684 3300028800 Bacteria 2584
98 Ga0265338_10125112 3300028800 Bacteria 2041
99 Ga0265338_10318540 3300028800 Bacteria 1126
100 Ga0265324_10027991 3300029957 Bacteria 1989
101 Ga0265332_10084097 3300031238 Bacteria 1349
102 Ga0265332_10200942 3300031238 Bacteria 828
103 Ga0265320_10000204 3300031240 Bacteria 48100
104 Ga0265320_10005998 3300031240 Bacteria 7720
105 Ga0265320_10017462 3300031240 Bacteria 3983
106 Ga0265325_10136229 3300031241 Bacteria 1171
107 Ga0265340_10012667 3300031247 Bacteria 4451
108 Ga0265331_10008481 3300031250 Bacteria 5843
109 Ga0265316_10685061 3300031344 Bacteria 723
110 Ga0265313_10000197 3300031595 Bacteria 64794
111 Ga0265342_10043389 3300031712 Bacteria 2714
112 Ga0316576_10085250 3300031727 Bacteria 2348
113 Ga0316577_10014212 3300031733 Bacteria 4369
114 Ga0316574_0115190 3300035398 Bacteria 1724
115 Ga0373933_0798928 3300035724 Unclassified 621
116 Ga0373937_0198448 3300036401 Bacteria 1886
117 Ga0316584_0028285 3300036712 Bacteria 4132
118 Ga0395899_0472365 3300037312 Bacteria 818
119 Ga0395899_0762605 3300037312 Bacteria 601
120 Ga0395900_0055565 3300037418 Bacteria 4077
121 Ga0395900_0588013 3300037418 Bacteria 1055
122 Ga0395900_1005410 3300037418 Bacteria 754
123 Ga0395898_0001520 3300037466 Bacteria 31974
124 Ga0395898_0117690 3300037466 Bacteria 2546
125 Ga0395898_0410076 3300037466 Bacteria 1292
126 Ga0395905_0231164 3300037471 Bacteria 1729
127 Ga0395901_0012420 3300038443 Bacteria 8641
128 Ga0395901_0249415 3300038443 Bacteria 1850
129 Ga0400483_035209 3300039062 Bacteria 2036
130 Ga0451791_1906348 3300041451 Bacteria 613
131 Ga0451845_0460971 3300041501 Bacteria 793
132 Ga0451577_0016142 3300042876 Bacteria 6923
133 Ga0451577_0498219 3300042876 Unclassified 1106
134 Ga0451577_0660117 3300042876 Unclassified 948
135 Ga0451577_0714189 3300042876 Bacteria 907
136 Ga0451577_0746974 3300042876 Bacteria 885
137 Ga0453683_0531901 3300044673 Bacteria 764
138 Ga0453684_0005683 3300044712 Bacteria 24458
139 Ga0451576_0370678 3300045051 Bacteria 1500
140 Ga0451576_1014216 3300045051 Bacteria 870
141 Ga0495592_0353556 3300046454 Bacteria 941
142 Ga0495653_0665582 3300046463 Unclassified 635
143 Ga0495582_0148079 3300046473 Bacteria 1332
144 Ga0495664_0081293 3300046477 Bacteria 1943
145 Ga0495630_0009363 3300046517 Bacteria 7041
146 Ga0495630_0212627 3300046517 Unclassified 1476
147 Ga0495652_0036726 3300046529 Bacteria 4257
148 Ga0495652_0500181 3300046529 Bacteria 843
149 Ga0495587_0372797 3300046536 Bacteria 794
150 Ga0495645_0001977 3300046543 Bacteria 13937
151 Ga0495668_0449485 3300046616 Bacteria 709
152 Ga0495625_0500664 3300046660 Bacteria 743
153 Ga0495588_0346191 3300046674 Bacteria 781
154 Ga0495599_0041377 3300046678 Bacteria 2894
155 Ga0495623_0056539 3300046679 Bacteria 2470
156 Ga0495613_0221766 3300046689 Bacteria 1327
157 Ga0495649_0147845 3300046694 Bacteria 1235
158 Ga0495600_0154053 3300046809 Bacteria 1487
159 Ga0495604_0029465 3300047317 Bacteria 4367
160 Ga0495636_0321674 3300047318 Bacteria 726
161 Ga0495672_0001214 3300047320 Bacteria 26001
162 Ga0495675_0575083 3300047444 Bacteria 641
163 Ga0495684_0062343 3300047471 Bacteria 2836
164 Ga0495602_0265083 3300048088 Bacteria 1272
165 Ga0496102_0004512 3300048905 Bacteria 11761
166 Ga0496105_0663487 3300048908 Bacteria 804
167 Ga0496107_0642636 3300048910 Bacteria 782
168 Ga0496108_0800218 3300048911 Bacteria 813
169 Ga0496109_0214936 3300048912 Bacteria 1808
170 Ga0496110_0102405 3300048913 Bacteria 2568
171 Ga0496111_0098084 3300048914 Bacteria 2152
172 Ga0496111_0099014 3300048914 Bacteria 2141
173 Ga0496112_0078959 3300048915 Bacteria 3255
174 Ga0496112_0268540 3300048915 Bacteria 1654
175 Ga0501306_001790 3300049127 Bacteria 2091
176 Ga0501309_025827 3300049129 Bacteria 846
177 Ga0501310_016335 3300049130 Bacteria 889
178 Ga0501305_012206 3300049161 Bacteria 1172
179 Ga0501311_023506 3300049527 Bacteria 853
180 Ga0501316_001457 3300049532 Bacteria 2013
181 Ga0501317_001365 3300049533 Bacteria 2094
182 Ga0501318_036385 3300049534 Bacteria 689
183 Ga0501321_017212 3300049537 Bacteria 867
184 Ga0501033_0314445 3300049570 Bacteria 1101
185 Ga0501046_0049787 3300049580 Bacteria 3313
186 Ga0501047_0000448 3300049581 Bacteria 45549
187 Ga0501075_0010133 3300049591 Bacteria 6615
188 Ga0501076_0655110 3300049592 Bacteria 867
189 Ga0501257_013830 3300049686 Unclassified 1852
190 Ga0501080_0144115 3300049742 Bacteria 2202
191 Ga0501080_0400170 3300049742 Bacteria 1235
192 Ga0501083_0354975 3300049744 Bacteria 953
193 nmdc:mga05p37_146717_c1 3300050507 Bacteria 2888
194 nmdc:mga08y16_498880_c1 3300050511 Bacteria 1237
195 nmdc:mga0n895_128679_c1 3300050512 Bacteria 2557
196 nmdc:mga0n895_1836500_c1 3300050512 Bacteria 566
197 nmdc:mga0rr50_115544_c1 3300050513 Bacteria 2130
198 nmdc:mga0rr50_846234_c1 3300050513 Bacteria 780
199 nmdc:mga0a205_130756_c1 3300050515 Bacteria 2411
200 nmdc:mga0a205_603421_c1 3300050515 Unclassified 951
201 Ga0495595_0208644 3300053084 Bacteria 973
202 Ga0500595_101646 3300053119 Bacteria 823

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041501 Ga0451845_0460971 Ga0451845_0460971_45_488 137
2 3300003323 rootH1_10302527 rootH1_103025273 143
3 3300028800 Ga0265338_10002888 Ga0265338_1000288822 143
4 3300031247 Ga0265340_10012667 Ga0265340_100126673 144
5 3300005937 Ga0081455_10003431 Ga0081455_100034317 146
6 3300013296 Ga0157374_10322505 Ga0157374_103225051 146
7 3300028556 Ga0265337_1005878 Ga0265337_10058782 146
8 3300028563 Ga0265319_1034234 Ga0265319_10342342 146
9 3300031238 Ga0265332_10084097 Ga0265332_100840973 146
10 3300031240 Ga0265320_10000204 Ga0265320_1000020445 146
11 3300031250 Ga0265331_10008481 Ga0265331_100084813 146
12 3300031595 Ga0265313_10000197 Ga0265313_1000019733 146
13 3300031712 Ga0265342_10043389 Ga0265342_100433893 146
14 3300046463 Ga0495653_0665582 Ga0495653_0665582_143_595 146
15 3300046529 Ga0495652_0500181 Ga0495652_0500181_21_473 146
16 3300048914 Ga0496111_0098084 Ga0496111_0098084_1029_1517 146
17 3300005365 Ga0070688_100157691 Ga0070688_1001576911 147
18 3300006028 Ga0070717_10789047 Ga0070717_107890471 147
19 3300048908 Ga0496105_0663487 Ga0496105_0663487_119_607 147
20 3300028800 Ga0265338_10087684 Ga0265338_100876843 148
21 3300037312 Ga0395899_0472365 Ga0395899_0472365_288_767 148
22 3300037418 Ga0395900_0055565 Ga0395900_0055565_1561_2040 148
23 3300037466 Ga0395898_0117690 Ga0395898_0117690_15_494 148
24 3300037471 Ga0395905_0231164 Ga0395905_0231164_133_612 148
25 3300038443 Ga0395901_0012420 Ga0395901_0012420_4269_4748 148
26 3300009177 Ga0105248_10020936 Ga0105248_100209363 149
27 3300013296 Ga0157374_10079789 Ga0157374_100797892 149
28 3300014325 Ga0163163_10044168 Ga0163163_100441684 149
29 3300014969 Ga0157376_10012329 Ga0157376_100123296 149
30 3300046473 Ga0495582_0148079 Ga0495582_0148079_15_515 149
31 3300046616 Ga0495668_0449485 Ga0495668_0449485_125_622 149
32 3300046674 Ga0495588_0346191 Ga0495588_0346191_29_529 149
33 3300047320 Ga0495672_0001214 Ga0495672_0001214_18090_18566 149
34 3300048911 Ga0496108_0800218 Ga0496108_0800218_15_512 149
35 3300048915 Ga0496112_0078959 Ga0496112_0078959_1938_2435 149
36 3300005330 Ga0070690_100017161 Ga0070690_1000171613 150
37 3300005334 Ga0068869_100092366 Ga0068869_1000923662 150
38 3300005340 Ga0070689_100010806 Ga0070689_1000108065 150
39 3300005345 Ga0070692_10054608 Ga0070692_100546083 150
40 3300005353 Ga0070669_100046185 Ga0070669_1000461853 150
41 3300005364 Ga0070673_100041794 Ga0070673_1000417943 150
42 3300005365 Ga0070688_100034476 Ga0070688_1000344763 150
43 3300005459 Ga0068867_100301861 Ga0068867_1003018612 150
44 3300005466 Ga0070685_11184397 Ga0070685_111843971 150
45 3300005544 Ga0070686_100644445 Ga0070686_1006444452 150
46 3300005548 Ga0070665_102201917 Ga0070665_1022019171 150
47 3300005616 Ga0068852_100235578 Ga0068852_1002355782 150
48 3300005719 Ga0068861_100164998 Ga0068861_1001649982 150
49 3300005843 Ga0068860_100992821 Ga0068860_1009928211 150
50 3300009098 Ga0105245_10437287 Ga0105245_104372871 150
51 3300013306 Ga0163162_11292771 Ga0163162_112927712 150
52 3300013308 Ga0157375_10088648 Ga0157375_100886483 150
53 3300025290 Ga0207673_1000766 Ga0207673_10007665 150
54 3300025923 Ga0207681_10278356 Ga0207681_102783562 150
55 3300025942 Ga0207689_10031234 Ga0207689_100312342 150
56 3300025960 Ga0207651_10118893 Ga0207651_101188933 150
57 3300026089 Ga0207648_10478789 Ga0207648_104787892 150
58 3300026118 Ga0207675_100031600 Ga0207675_1000316002 150
59 3300037418 Ga0395900_0588013 Ga0395900_0588013_374_901 150
60 3300037466 Ga0395898_0001520 Ga0395898_0001520_15766_16293 150
61 3300044673 Ga0453683_0531901 Ga0453683_0531901_147_635 150
62 3300006175 Ga0070712_100542838 Ga0070712_1005428381 151
63 3300025915 Ga0207693_10473071 Ga0207693_104730712 151
64 3300025920 Ga0207649_10997210 Ga0207649_109972101 151
65 3300025945 Ga0207679_12024387 Ga0207679_120243871 151
66 3300028563 Ga0265319_1087779 Ga0265319_10877791 151
67 3300028800 Ga0265338_10033443 Ga0265338_100334433 151
68 3300031240 Ga0265320_10017462 Ga0265320_100174625 151
69 3300036712 Ga0316584_0028285 Ga0316584_0028285_17_523 151
70 3300047318 Ga0495636_0321674 Ga0495636_0321674_211_699 151
71 3300048905 Ga0496102_0004512 Ga0496102_0004512_585_1043 151
72 3300048910 Ga0496107_0642636 Ga0496107_0642636_64_522 151
73 3300048912 Ga0496109_0214936 Ga0496109_0214936_369_827 151
74 3300048913 Ga0496110_0102405 Ga0496110_0102405_1136_1594 151
75 3300048914 Ga0496111_0099014 Ga0496111_0099014_955_1413 151
76 3300048915 Ga0496112_0268540 Ga0496112_0268540_246_704 151
77 3300049591 Ga0501075_0010133 Ga0501075_0010133_5064_5525 151
78 3300049592 Ga0501076_0655110 Ga0501076_0655110_376_837 151
79 3300049742 Ga0501080_0144115 Ga0501080_0144115_1062_1523 151
80 3300050512 nmdc:mga0n895_1836500_c1 nmdc:mga0n895_1836500_c1_51_509 151
81 3300006844 Ga0075428_100400288 Ga0075428_1004002882 152
82 3300006871 Ga0075434_100108332 Ga0075434_1001083321 152
83 3300027543 Ga0209999_1068732 Ga0209999_10687321 152
84 3300031344 Ga0265316_10685061 Ga0265316_106850611 152
85 3300031727 Ga0316576_10085250 Ga0316576_100852502 152
86 3300031733 Ga0316577_10014212 Ga0316577_100142122 152
87 3300049580 Ga0501046_0049787 Ga0501046_0049787_2401_2898 152
88 3300049581 Ga0501047_0000448 Ga0501047_0000448_17491_17988 152
89 3300049742 Ga0501080_0400170 Ga0501080_0400170_459_956 152
90 3300050507 nmdc:mga05p37_146717_c1 nmdc:mga05p37_146717_c1_328_813 152
91 3300050515 nmdc:mga0a205_603421_c1 nmdc:mga0a205_603421_c1_428_913 152
92 3300006237 Ga0097621_100479438 Ga0097621_1004794382 153
93 3300026116 Ga0207674_10175671 Ga0207674_101756712 153
94 3300028556 Ga0265337_1031215 Ga0265337_10312152 153
95 3300037312 Ga0395899_0762605 Ga0395899_0762605_77_550 153
96 3300037418 Ga0395900_1005410 Ga0395900_1005410_154_627 153
97 3300037466 Ga0395898_0410076 Ga0395898_0410076_21_494 153
98 3300038443 Ga0395901_0249415 Ga0395901_0249415_71_544 153
99 iso_pu_bacteria 2854681122 2854683956 153
100 3300005545 Ga0070695_100875046 Ga0070695_1008750461 156
101 3300025922 Ga0207646_10315078 Ga0207646_103150782 156
102 3300036401 Ga0373937_0198448 Ga0373937_0198448_620_1099 156
103 3300046454 Ga0495592_0353556 Ga0495592_0353556_199_678 156
104 3300046477 Ga0495664_0081293 Ga0495664_0081293_643_1122 156
105 3300046529 Ga0495652_0036726 Ga0495652_0036726_2129_2608 156
106 3300046536 Ga0495587_0372797 Ga0495587_0372797_135_614 156
107 3300046543 Ga0495645_0001977 Ga0495645_0001977_1883_2362 156
108 3300046678 Ga0495599_0041377 Ga0495599_0041377_247_726 156
109 3300046679 Ga0495623_0056539 Ga0495623_0056539_675_1154 156
110 3300046689 Ga0495613_0221766 Ga0495613_0221766_561_1040 156
111 3300046809 Ga0495600_0154053 Ga0495600_0154053_19_498 156
112 3300047317 Ga0495604_0029465 Ga0495604_0029465_1540_2019 156
113 3300047471 Ga0495684_0062343 Ga0495684_0062343_1116_1595 156
114 3300048088 Ga0495602_0265083 Ga0495602_0265083_488_967 156
115 3300053084 Ga0495595_0208644 Ga0495595_0208644_338_817 156
116 3300006871 Ga0075434_100016807 Ga0075434_1000168071 157
117 3300007076 Ga0075435_100008945 Ga0075435_1000089451 157
118 3300007076 Ga0075435_100393904 Ga0075435_1003939042 157
119 3300014325 Ga0163163_10831842 Ga0163163_108318422 157
120 3300035398 Ga0316574_0115190 Ga0316574_0115190_396_878 157
121 3300039062 Ga0400483_035209 Ga0400483_035209_1427_1912 157
122 3300042876 Ga0451577_0016142 Ga0451577_0016142_283_771 157
123 3300049537 Ga0501321_017212 Ga0501321_017212_81_614 157
124 3300050512 nmdc:mga0n895_128679_c1 nmdc:mga0n895_128679_c1_249_725 157
125 3300050513 nmdc:mga0rr50_115544_c1 nmdc:mga0rr50_115544_c1_131_607 157
126 3300050515 nmdc:mga0a205_130756_c1 nmdc:mga0a205_130756_c1_231_707 157
127 3300005718 Ga0068866_10288043 Ga0068866_102880431 158
128 3300009094 Ga0111539_10127287 Ga0111539_101272873 158
129 3300014969 Ga0157376_10424022 Ga0157376_104240222 158
130 3300045051 Ga0451576_1014216 Ga0451576_1014216_232_714 158
131 3300049686 Ga0501257_013830 Ga0501257_013830_1054_1548 158
132 3300050511 nmdc:mga08y16_498880_c1 nmdc:mga08y16_498880_c1_422_904 158
133 3300005367 Ga0070667_100481702 Ga0070667_1004817021 159
134 3300005439 Ga0070711_100090341 Ga0070711_1000903413 159
135 3300005545 Ga0070695_100809845 Ga0070695_1008098451 159
136 3300005548 Ga0070665_100851298 Ga0070665_1008512982 159
137 3300005616 Ga0068852_100676522 Ga0068852_1006765222 159
138 3300013297 Ga0157378_11026370 Ga0157378_110263702 159
139 3300017792 Ga0163161_10678753 Ga0163161_106787532 159
140 3300025916 Ga0207663_10094588 Ga0207663_100945882 159
141 3300025986 Ga0207658_10244474 Ga0207658_102444742 159
142 3300028800 Ga0265338_10125112 Ga0265338_101251122 159
143 3300050513 nmdc:mga0rr50_846234_c1 nmdc:mga0rr50_846234_c1_198_689 159
144 3300003316 rootH1_10075123 rootH1_100751234 160
145 3300003320 rootH2_10272918 rootH2_102729183 160
146 3300005347 Ga0070668_100343657 Ga0070668_1003436572 160
147 3300005364 Ga0070673_100372705 Ga0070673_1003727052 160
148 3300005436 Ga0070713_100513940 Ga0070713_1005139401 160
149 3300005438 Ga0070701_10765381 Ga0070701_107653811 160
150 3300005439 Ga0070711_100839370 Ga0070711_1008393701 160
151 3300005456 Ga0070678_100242279 Ga0070678_1002422792 160
152 3300005548 Ga0070665_100331696 Ga0070665_1003316962 160
153 3300005563 Ga0068855_100009609 Ga0068855_1000096093 160
154 3300005617 Ga0068859_101403689 Ga0068859_1014036891 160
155 3300005719 Ga0068861_101587350 Ga0068861_1015873501 160
156 3300005844 Ga0068862_101460957 Ga0068862_1014609571 160
157 3300006175 Ga0070712_101062121 Ga0070712_1010621211 160
158 3300006931 Ga0097620_101403867 Ga0097620_1014038672 160
159 3300009093 Ga0105240_10025759 Ga0105240_100257596 160
160 3300009174 Ga0105241_11043338 Ga0105241_110433381 160
161 3300013100 Ga0157373_10001639 Ga0157373_1000163912 160
162 3300025298 Ga0209050_1000093 Ga0209050_1000093186 160
163 3300025913 Ga0207695_10040777 Ga0207695_100407776 160
164 3300025925 Ga0207650_10043589 Ga0207650_100435893 160
165 3300025928 Ga0207700_10219527 Ga0207700_102195272 160
166 3300025928 Ga0207700_10321345 Ga0207700_103213452 160
167 3300025939 Ga0207665_10547749 Ga0207665_105477491 160
168 3300025941 Ga0207711_11458090 Ga0207711_114580901 160
169 3300025949 Ga0207667_10112994 Ga0207667_101129943 160
170 3300026078 Ga0207702_10453862 Ga0207702_104538621 160
171 3300026121 Ga0207683_10283165 Ga0207683_102831652 160
172 3300026142 Ga0207698_10603109 Ga0207698_106031092 160
173 3300028379 Ga0268266_10211712 Ga0268266_102117123 160
174 3300028577 Ga0265318_10029064 Ga0265318_100290643 160
175 3300028800 Ga0265338_10318540 Ga0265338_103185402 160
176 3300029957 Ga0265324_10027991 Ga0265324_100279912 160
177 3300031238 Ga0265332_10200942 Ga0265332_102009421 160
178 3300031240 Ga0265320_10005998 Ga0265320_100059982 160
179 3300031241 Ga0265325_10136229 Ga0265325_101362292 160
180 3300035724 Ga0373933_0798928 Ga0373933_0798928_78_575 160
181 3300041451 Ga0451791_1906348 Ga0451791_1906348_52_573 160
182 3300042876 Ga0451577_0498219 Ga0451577_0498219_398_898 160
183 3300042876 Ga0451577_0660117 Ga0451577_0660117_104_613 160
184 3300042876 Ga0451577_0714189 Ga0451577_0714189_200_715 160
185 3300042876 Ga0451577_0746974 Ga0451577_0746974_174_689 160
186 3300044712 Ga0453684_0005683 Ga0453684_0005683_8051_8584 160
187 3300045051 Ga0451576_0370678 Ga0451576_0370678_763_1278 160
188 3300046517 Ga0495630_0009363 Ga0495630_0009363_6128_6625 160
189 3300046517 Ga0495630_0212627 Ga0495630_0212627_204_728 160
190 3300046660 Ga0495625_0500664 Ga0495625_0500664_73_579 160
191 3300046694 Ga0495649_0147845 Ga0495649_0147845_155_661 160
192 3300047444 Ga0495675_0575083 Ga0495675_0575083_16_522 160
193 3300049127 Ga0501306_001790 Ga0501306_001790_1484_2002 160
194 3300049129 Ga0501309_025827 Ga0501309_025827_256_774 160
195 3300049130 Ga0501310_016335 Ga0501310_016335_85_603 160
196 3300049161 Ga0501305_012206 Ga0501305_012206_72_590 160
197 3300049527 Ga0501311_023506 Ga0501311_023506_265_783 160
198 3300049532 Ga0501316_001457 Ga0501316_001457_1425_1943 160
199 3300049533 Ga0501317_001365 Ga0501317_001365_1446_1964 160
200 3300049534 Ga0501318_036385 Ga0501318_036385_73_591 160
201 3300049570 Ga0501033_0314445 Ga0501033_0314445_28_516 160
202 3300049744 Ga0501083_0354975 Ga0501083_0354975_346_840 160
203 3300053119 Ga0500595_101646 Ga0500595_101646_38_523 160
204 iso_pu_bacteria 2894772417 2894776591 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

15

44

0.94

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

15

132

0.9

PF18029

Glyoxalase_6

Glyoxalase-like domain

18

133

0.86

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

17

120

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8he6-assembly1.cif.gz_B crystal structure of a fosfomycin and bleomycin resistant protein (all3014) from anabaena/nostoc cyanobacterium at 1.70 a resolution 0.8064 10 132
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8017 6 128
1lqo-assembly1.cif.gz_B crystal strutcure of the fosfomycin resistance protein a (fosa) containing bound thallium cations 0.7959 10 136
2i7r-assembly1.cif.gz_B conserved domain protein 0.795 10 132
1zsw-assembly1.cif.gz_A crystal structure of bacillus cereus metallo protein from glyoxalase family 0.7946 13 133
ID Description Score Start End Superfamily
af_O57457_206_298_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8462 104 131 2.30.29.30
af_D3ZDI6_185_278_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8451 104 129 2.30.29.30
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8288 10 138 3.10.180.10
af_Q2FZ81_10_141_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8185 12 148 3.10.180.10
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8174 10 138 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A431P746-F1-model_v4 deleted 1.001 84 159
AF-A0A4Q3WBU0-F1-model_v4 Glyoxalase 0.9813 76 160
AF-A0A838GBZ9-F1-model_v4 VOC family protein 0.9788 76 160
AF-A0A7V3CZX6-F1-model_v4 Glyoxalase 0.9726 88 159
AF-A0A2T4XH78-F1-model_v4 Glyoxalase 0.9702 79 159

Feature Viewer

pLDDT pTM Quality
88.86 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map