F312285

General Info

Members Datasets Scaffolds Average Seq Length
204 142 176 273

Family's Representative Sequence

Representative Sequence 3300005834|Ga0068851_10064536|Ga0068851_100645361
Length 287
Sequence LKNEKPIPDDMSPTQSDVFTDEEIDILLNDLQEKFGYDFTDYARASVRRRISRLFLLDKFASFADFRNRLTRNDRYITRFVQEVTVNVTEMFRDPTFYRLLREKVLPVLATHPFIRIWHAGCSTGEEVYSMAILLKEANLLNKSLLYATDINPEVLAQVARGIYPLGAIKQYSENYILAGGKEDFSSYYTAKYDLAKFDDELKSKMIVSTHNLVSDRSFNQFQLIICRNVLIYFNKRLQDKVFALFDASLERHGFLGLGAKEQIKFSDVGRKYQQLDAKEKIWKKMT

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
4 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
5 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
6 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
7 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
8 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
9 2738541278 Niastella sp. CF465 Isolate Unclassified
10 2738543023 Pedobacter sp. OK628 Isolate Unclassified
11 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
12 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
13 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
14 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
15 2818991444 Filimonas endophytica 3197 Isolate Unclassified
16 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
17 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
18 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
19 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
20 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
21 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
22 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
23 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
24 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
25 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
26 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
27 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
28 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
29 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
91 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
92 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
93 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
94 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
102 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
111 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
120 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
121 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
122 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
123 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
124 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
125 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
134 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
135 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
136 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
137 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
138 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
139 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
142 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.27
Metatranscriptomes 0
Isolates 13.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.31
Nodule 0.49
Rhizoplane 0.49
Rhizosphere 67.16
Stem 0
Stem Tuber 0
Unclassified 22.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_7667592 2162886011 Bacteria 1349
2 JGI25154J39366_1000022 3300002738 Bacteria 219590
3 JGI25153J46596_10011973 3300003215 Bacteria 3792
4 rootH1_10125256 3300003316 Bacteria 1161
5 rootH2_10001604 3300003320 Bacteria 1307
6 rootH2_10066192 3300003320 Unclassified 3172
7 rootL2_10011857 3300003322 Bacteria 3463
8 rootL2_10110624 3300003322 Bacteria 7146
9 rootL2_10193287 3300003322 Bacteria 5664
10 rootL2_10331632 3300003322 Bacteria 2453
11 rootH1_10000662 3300003323 Bacteria 213765
12 rootH1_10035709 3300003323 Bacteria 9467
13 rootH1_10057714 3300003323 Bacteria 4731
14 rootH1_10126265 3300003323 Bacteria 2604
15 rootH1_10138290 3300003323 Bacteria 3601
16 Ga0055531_10000359 3300003794 Bacteria 44255
17 Ga0065165_1001876 3300005262 Bacteria 20360
18 Ga0070670_100270124 3300005331 Bacteria 1484
19 Ga0070682_100000175 3300005337 Bacteria 47814
20 Ga0070668_100035160 3300005347 Unclassified 3820
21 Ga0070659_100066278 3300005366 Unclassified 2861
22 Ga0070663_100015130 3300005455 Bacteria 4969
23 Ga0070679_100024098 3300005530 Bacteria 5962
24 Ga0070684_100180329 3300005535 Bacteria 1920
25 Ga0068853_100120481 3300005539 Bacteria 2340
26 Ga0068856_100004666 3300005614 Bacteria 13611
27 Ga0068852_100066217 3300005616 Bacteria 3154
28 Ga0068852_100067449 3300005616 Bacteria 3128
29 Ga0068851_10064536 3300005834 Bacteria 1882
30 Ga0075431_100002027 3300006847 Bacteria 19344
31 Ga0105244_10000124 3300009036 Bacteria 78977
32 Ga0105240_10000047 3300009093 Bacteria 239067
33 Ga0105240_10281252 3300009093 Bacteria 1911
34 Ga0111539_10004608 3300009094 Bacteria 18007
35 Ga0114129_10065245 3300009147 Bacteria 5081
36 Ga0105239_10000240 3300010375 Bacteria 81097
37 Ga0157373_10000009 3300013100 Bacteria 201551
38 Ga0157373_10004348 3300013100 Bacteria 10669
39 Ga0157371_10011192 3300013102 Bacteria 6937
40 Ga0157371_10021716 3300013102 Bacteria 4710
41 Ga0157371_10034267 3300013102 Bacteria 3642
42 Ga0157370_10000684 3300013104 Bacteria 42223
43 Ga0157370_10001688 3300013104 Bacteria 27185
44 Ga0157370_10003961 3300013104 Bacteria 17235
45 Ga0157370_10384845 3300013104 Bacteria 1292
46 Ga0157370_10424943 3300013104 Bacteria 1222
47 Ga0157370_10436107 3300013104 Bacteria 1205
48 Ga0157369_10000731 3300013105 Bacteria 42343
49 Ga0157369_10002318 3300013105 Bacteria 22909
50 Ga0157369_10018896 3300013105 Bacteria 7723
51 Ga0157369_10031917 3300013105 Bacteria 5795
52 Ga0157374_10258070 3300013296 Bacteria 1716
53 Ga0157374_10292581 3300013296 Bacteria 1610
54 Ga0157374_10362253 3300013296 Bacteria 1442
55 Ga0163162_10000109 3300013306 Bacteria 74550
56 Ga0163162_10499922 3300013306 Bacteria 1346
57 Ga0157372_10000034 3300013307 Bacteria 174784
58 Ga0157372_10051041 3300013307 Bacteria 4602
59 Ga0157372_10259338 3300013307 Bacteria 2018
60 Ga0157372_10415555 3300013307 Bacteria 1567
61 Ga0157372_10453341 3300013307 Bacteria 1495
62 Ga0157372_10791846 3300013307 Bacteria 1102
63 Ga0157375_10000204 3300013308 Bacteria 55063
64 Ga0157375_10079131 3300013308 Bacteria 3322
65 Ga0182008_10000028 3300014497 Bacteria 176968
66 Ga0182008_10000058 3300014497 Bacteria 100175
67 Ga0182006_1005050 3300015261 Bacteria 6348
68 Ga0182007_10014122 3300015262 Bacteria 3022
69 Ga0182007_10037782 3300015262 Bacteria 1620
70 Ga0163161_10000396 3300017792 Bacteria 36366
71 Ga0163161_10002431 3300017792 Bacteria 13312
72 Ga0209646_1000003 3300025246 Bacteria 1160860
73 Ga0209026_1002368 3300025250 Bacteria 7129
74 Ga0209675_1000263 3300025291 Bacteria 51088
75 Ga0207426_1000582 3300025302 Bacteria 48598
76 Ga0209257_1000005 3300025304 Bacteria 1592528
77 Ga0207655_1000539 3300025728 Bacteria 47934
78 Ga0207647_10006132 3300025904 Bacteria 8762
79 Ga0207695_10000010 3300025913 Bacteria 981919
80 Ga0207695_10524231 3300025913 Bacteria 1066
81 Ga0207671_10001163 3300025914 Bacteria 31375
82 Ga0207652_10093774 3300025921 Bacteria 2642
83 Ga0207706_10291616 3300025933 Bacteria 1422
84 Ga0207661_10021435 3300025944 Unclassified 4841
85 Ga0207678_10026936 3300026067 Bacteria 5014
86 Ga0207678_10337487 3300026067 Bacteria 1298
87 Ga0207702_10042659 3300026078 Bacteria 3806
88 Ga0207698_10243999 3300026142 Bacteria 1639
89 Ga0268266_10153560 3300028379 Bacteria 2078
90 Ga0307515_10034879 3300028794 Bacteria 8212
91 Ga0265327_10000010 3300031251 Bacteria 566817
92 Ga0265327_10001558 3300031251 Bacteria 28149
93 Ga0265327_10003042 3300031251 Bacteria 16610
94 Ga0307413_10201410 3300031824 Bacteria 1438
95 Ga0307412_10000028 3300031911 Bacteria 213966
96 Ga0307412_10238086 3300031911 Bacteria 1406
97 Ga0307416_100000052 3300032002 Bacteria 114516
98 Ga0307416_100027211 3300032002 Bacteria 4231
99 Ga0307414_10000009 3300032004 Bacteria 359782
100 Ga0307414_10000702 3300032004 Bacteria 17139
101 Ga0307414_10258911 3300032004 Bacteria 1450
102 Ga0307414_10294148 3300032004 Bacteria 1370
103 Ga0307414_10302571 3300032004 Bacteria 1353
104 Ga0373927_0276134 3300035695 Bacteria 1105
105 Ga0436365_0707466 3300039437 Bacteria 24283
106 Ga0439439_0003813 3300041406 Bacteria 3350
107 Ga0439466_0020040 3300041411 Bacteria 2389
108 Ga0439457_000798 3300042014 Bacteria 9391
109 Ga0439462_0006976 3300042015 Bacteria 2821
110 Ga0466982_0190213 3300044672 Bacteria 1235
111 Ga0466957_0000310 3300044842 Bacteria 23777
112 Ga0495627_003771 3300046453 Bacteria 6545
113 Ga0495596_0006392 3300046500 Bacteria 5429
114 Ga0495610_0000001 3300046512 Bacteria 1620061
115 Ga0495632_0001905 3300046519 Bacteria 16695
116 Ga0495643_0015507 3300046522 Bacteria 4501
117 Ga0495643_0161765 3300046522 Bacteria 1101
118 Ga0495663_0000039 3300046525 Bacteria 68141
119 Ga0495663_0002377 3300046525 Bacteria 5665
120 Ga0495609_0000025 3300046538 Bacteria 256898
121 Ga0495633_0000002 3300046558 Bacteria 488754
122 Ga0495633_0002807 3300046558 Bacteria 12044
123 Ga0495625_0002075 3300046660 Bacteria 22450
124 Ga0495686_0000207 3300047472 Bacteria 109571
125 Ga0496105_0109722 3300048908 Bacteria 2278
126 Ga0496116_0000053 3300048919 Bacteria 291837
127 Ga0496117_0000050 3300048920 Bacteria 292727
128 Ga0496118_0000044 3300048921 Bacteria 283524
129 Ga0496119_0000002 3300048922 Bacteria 738385
130 Ga0496120_0045980 3300048923 Bacteria 2525
131 Ga0496122_0000191 3300048925 Bacteria 140173
132 Ga0496122_0000290 3300048925 Bacteria 111581
133 Ga0496122_0000668 3300048925 Bacteria 69054
134 Ga0496122_0001730 3300048925 Bacteria 33861
135 Ga0496122_0006241 3300048925 Bacteria 13790
136 Ga0496123_0000579 3300048926 Bacteria 62330
137 Ga0496123_0000586 3300048926 Bacteria 62082
138 Ga0496123_0016210 3300048926 Bacteria 6067
139 Ga0496124_0025182 3300048927 Bacteria 5393
140 Ga0496125_0000181 3300048928 Bacteria 138133
141 Ga0496125_0046552 3300048928 Bacteria 3638
142 Ga0501034_0021483 3300049571 Bacteria 6579
143 Ga0501034_0118903 3300049571 Bacteria 2629
144 Ga0501034_0132388 3300049571 Bacteria 2476
145 Ga0501034_0212048 3300049571 Bacteria 1892
146 Ga0501037_0420872 3300049573 Bacteria 914
147 Ga0501047_0027089 3300049581 Bacteria 5521
148 Ga0501202_001386 3300049652 Unclassified 3878
149 Ga0501216_015739 3300049660 Bacteria 1278
150 Ga0501238_018328 3300049671 Bacteria 979
151 Ga0501257_012104 3300049686 Bacteria 1972
152 Ga0501225_0000470 3300049705 Bacteria 12619
153 Ga0501241_003965 3300049758 Bacteria 2783
154 Ga0501280_004107 3300049776 Bacteria 2163
155 Ga0501035_0046326 3300049822 Bacteria 3911
156 Ga0501035_0399130 3300049822 Bacteria 1144
157 Ga0501035_0621495 3300049822 Bacteria 878
158 Ga0501044_0132263 3300049823 Bacteria 2488
159 Ga0501284_00003 3300050005 Bacteria 212116
160 nmdc:mga05p37_35979_c1 3300050507 Bacteria 6075
161 nmdc:mga09592_17948_c1 3300050508 Bacteria 5798
162 nmdc:mga06r32_9546_c1 3300050510 Bacteria 8762
163 nmdc:mga08y16_32218_c1 3300050511 Bacteria 5511
164 Ga0500646_0001604 3300053090 Bacteria 5970
165 Ga0500651_0130598 3300053093 Bacteria 1520
166 Ga0500562_007147 3300053108 Bacteria 2818
167 Ga0500559_0029154 3300053136 Bacteria 2362
168 Ga0500568_0045066 3300053139 Bacteria 1757
169 Ga0500588_0004302 3300053146 Bacteria 3076
170 Ga0500588_0093186 3300053146 Unclassified 1027
171 Ga0500604_0001884 3300053151 Bacteria 5826
172 Ga0500622_0000392 3300053156 Bacteria 42200
173 Ga0500622_0000394 3300053156 Bacteria 42087
174 Ga0500622_0005226 3300053156 Bacteria 7846
175 Ga0500627_0004491 3300053158 Bacteria 4493
176 Ga0500627_0090042 3300053158 Bacteria 1373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0420872 Ga0501037_0420872_105_806 233
2 3300049822 Ga0501035_0621495 Ga0501035_0621495_101_802 233
3 3300049671 Ga0501238_018328 Ga0501238_018328_221_967 248
4 3300013307 Ga0157372_10453341 Ga0157372_104533412 253
5 3300053146 Ga0500588_0093186 Ga0500588_0093186_241_1017 257
6 3300032004 Ga0307414_10000702 Ga0307414_100007026 262
7 3300053156 Ga0500622_0005226 Ga0500622_0005226_3902_4690 262
8 3300005614 Ga0068856_100004666 Ga0068856_1000046669 264
9 3300026078 Ga0207702_10042659 Ga0207702_100426592 264
10 3300049571 Ga0501034_0021483 Ga0501034_0021483_580_1374 264
11 3300049571 Ga0501034_0118903 Ga0501034_0118903_1256_2050 264
12 3300049822 Ga0501035_0399130 Ga0501035_0399130_151_945 264
13 3300049823 Ga0501044_0132263 Ga0501044_0132263_750_1544 264
14 iso_pu_bacteria 2738541278 2738729550 266
15 3300013307 Ga0157372_10259338 Ga0157372_102593383 268
16 3300003322 rootL2_10331632 rootL2_103316322 269
17 3300005535 Ga0070684_100180329 Ga0070684_1001803292 269
18 3300013105 Ga0157369_10031917 Ga0157369_100319172 269
19 3300013296 Ga0157374_10258070 Ga0157374_102580702 269
20 3300013306 Ga0163162_10499922 Ga0163162_104999223 269
21 3300025933 Ga0207706_10291616 Ga0207706_102916162 269
22 3300031251 Ga0265327_10001558 Ga0265327_1000155822 269
23 3300053136 Ga0500559_0029154 Ga0500559_0029154_714_1523 269
24 iso_pu_bacteria 2738543023 2739302990 269
25 3300003322 rootL2_10011857 rootL2_100118572 270
26 3300003323 rootH1_10000662 rootH1_1000066268 270
27 3300003323 rootH1_10126265 rootH1_101262654 270
28 3300005347 Ga0070668_100035160 Ga0070668_1000351603 270
29 3300013102 Ga0157371_10021716 Ga0157371_100217163 270
30 3300013104 Ga0157370_10384845 Ga0157370_103848451 270
31 3300013307 Ga0157372_10415555 Ga0157372_104155552 270
32 3300031251 Ga0265327_10003042 Ga0265327_100030423 270
33 3300031911 Ga0307412_10238086 Ga0307412_102380862 270
34 3300035695 Ga0373927_0276134 Ga0373927_0276134_68_880 270
35 3300041406 Ga0439439_0003813 Ga0439439_0003813_1065_1880 270
36 3300042014 Ga0439457_000798 Ga0439457_000798_1321_2136 270
37 3300042015 Ga0439462_0006976 Ga0439462_0006976_905_1720 270
38 3300044842 Ga0466957_0000310 Ga0466957_0000310_10085_10897 270
39 3300049686 Ga0501257_012104 Ga0501257_012104_747_1562 270
40 3300049705 Ga0501225_0000470 Ga0501225_0000470_6495_7310 270
41 3300053093 Ga0500651_0130598 Ga0500651_0130598_135_950 270
42 3300053146 Ga0500588_0004302 Ga0500588_0004302_688_1500 270
43 iso_pu_bacteria 2582581278 2585143390 270
44 iso_pu_bacteria 2585428061 2587751751 270
45 iso_pu_bacteria 2585428182 2588209704 270
46 iso_pu_bacteria 2585428184 2588219754 270
47 iso_pu_bacteria 2585428187 2588234458 270
48 iso_pu_bacteria 2588253712 2588445960 270
49 iso_pu_bacteria 2728369107 2729201833 270
50 iso_pu_bacteria 2739367874 2740057226 270
51 iso_pu_bacteria 2751185877 2753672492 270
52 iso_pu_bacteria 2765235839 2765572481 270
53 iso_pu_bacteria 2816332188 2816873818 270
54 iso_pu_bacteria 2818991444 2819589087 270
55 iso_pu_bacteria 2842083920 2842086457 270
56 iso_pu_bacteria 2871720351 2871721723 270
57 iso_pu_bacteria 2884791551 2884796167 270
58 iso_pu_bacteria 2889290771 2889291737 270
59 iso_pu_bacteria 2896317667 2896320967 270
60 iso_pu_bacteria 2905999023 2906002702 270
61 iso_pu_bacteria 2929154850 2929156399 270
62 iso_pu_bacteria 2945924605 2945927556 270
63 iso_pu_bacteria 2977243572 2977246368 270
64 iso_pu_bacteria 2993372514 2993373628 270
65 iso_pu_bacteria 2993480792 2993484305 270
66 3300005455 Ga0070663_100015130 Ga0070663_1000151302 272
67 3300005616 Ga0068852_100067449 Ga0068852_1000674492 272
68 3300013102 Ga0157371_10011192 Ga0157371_100111924 272
69 3300013102 Ga0157371_10034267 Ga0157371_100342673 272
70 3300013104 Ga0157370_10436107 Ga0157370_104361072 272
71 3300013105 Ga0157369_10002318 Ga0157369_1000231812 272
72 3300013105 Ga0157369_10018896 Ga0157369_100188963 272
73 3300013307 Ga0157372_10000034 Ga0157372_1000003489 272
74 3300013307 Ga0157372_10051041 Ga0157372_100510412 272
75 3300025913 Ga0207695_10524231 Ga0207695_105242311 272
76 3300026067 Ga0207678_10026936 Ga0207678_100269363 272
77 3300031251 Ga0265327_10000010 Ga0265327_10000010219 272
78 3300032004 Ga0307414_10302571 Ga0307414_103025712 272
79 3300049822 Ga0501035_0046326 Ga0501035_0046326_53_871 272
80 3300053158 Ga0500627_0004491 Ga0500627_0004491_1726_2544 272
81 iso_pu_bacteria 2895498888 2895500435 272
82 3300003320 rootH2_10001604 rootH2_100016042 273
83 3300003323 rootH1_10035709 rootH1_100357095 273
84 3300005331 Ga0070670_100270124 Ga0070670_1002701242 273
85 3300005337 Ga0070682_100000175 Ga0070682_10000017542 273
86 3300005366 Ga0070659_100066278 Ga0070659_1000662785 273
87 3300005530 Ga0070679_100024098 Ga0070679_1000240984 273
88 3300005539 Ga0068853_100120481 Ga0068853_1001204813 273
89 3300005616 Ga0068852_100066217 Ga0068852_1000662173 273
90 3300009036 Ga0105244_10000124 Ga0105244_1000012416 273
91 3300009093 Ga0105240_10000047 Ga0105240_1000004741 273
92 3300009093 Ga0105240_10281252 Ga0105240_102812523 273
93 3300010375 Ga0105239_10000240 Ga0105239_1000024040 273
94 3300013100 Ga0157373_10000009 Ga0157373_10000009130 273
95 3300013100 Ga0157373_10004348 Ga0157373_100043482 273
96 3300013104 Ga0157370_10000684 Ga0157370_1000068435 273
97 3300013104 Ga0157370_10001688 Ga0157370_1000168817 273
98 3300013104 Ga0157370_10003961 Ga0157370_1000396111 273
99 3300013104 Ga0157370_10424943 Ga0157370_104249432 273
100 3300013105 Ga0157369_10000731 Ga0157369_100007315 273
101 3300013296 Ga0157374_10292581 Ga0157374_102925811 273
102 3300013307 Ga0157372_10791846 Ga0157372_107918462 273
103 3300013308 Ga0157375_10000204 Ga0157375_1000020424 273
104 3300013308 Ga0157375_10079131 Ga0157375_100791313 273
105 3300014497 Ga0182008_10000028 Ga0182008_1000002866 273
106 3300014497 Ga0182008_10000058 Ga0182008_1000005840 273
107 3300015261 Ga0182006_1005050 Ga0182006_10050506 273
108 3300015262 Ga0182007_10014122 Ga0182007_100141222 273
109 3300015262 Ga0182007_10037782 Ga0182007_100377823 273
110 3300017792 Ga0163161_10000396 Ga0163161_1000039610 273
111 3300017792 Ga0163161_10002431 Ga0163161_100024318 273
112 3300025291 Ga0209675_1000263 Ga0209675_10002637 273
113 3300025728 Ga0207655_1000539 Ga0207655_100053930 273
114 3300025904 Ga0207647_10006132 Ga0207647_100061327 273
115 3300025913 Ga0207695_10000010 Ga0207695_10000010198 273
116 3300025914 Ga0207671_10001163 Ga0207671_100011636 273
117 3300025921 Ga0207652_10093774 Ga0207652_100937743 273
118 3300025944 Ga0207661_10021435 Ga0207661_100214353 273
119 3300026067 Ga0207678_10337487 Ga0207678_103374872 273
120 3300026142 Ga0207698_10243999 Ga0207698_102439993 273
121 3300028794 Ga0307515_10034879 Ga0307515_100348795 273
122 3300031824 Ga0307413_10201410 Ga0307413_102014102 273
123 3300031911 Ga0307412_10000028 Ga0307412_10000028133 273
124 3300032002 Ga0307416_100000052 Ga0307416_1000000528 273
125 3300032002 Ga0307416_100027211 Ga0307416_1000272115 273
126 3300032004 Ga0307414_10000009 Ga0307414_10000009335 273
127 3300032004 Ga0307414_10258911 Ga0307414_102589113 273
128 3300032004 Ga0307414_10294148 Ga0307414_102941482 273
129 3300039437 Ga0436365_0707466 Ga0436365_0707466_9436_10257 273
130 3300041411 Ga0439466_0020040 Ga0439466_0020040_804_1634 273
131 3300046453 Ga0495627_003771 Ga0495627_003771_2127_2957 273
132 3300046500 Ga0495596_0006392 Ga0495596_0006392_3553_4386 273
133 3300046512 Ga0495610_0000001 Ga0495610_0000001_992825_993655 273
134 3300046519 Ga0495632_0001905 Ga0495632_0001905_4271_5101 273
135 3300046522 Ga0495643_0015507 Ga0495643_0015507_3347_4177 273
136 3300046522 Ga0495643_0161765 Ga0495643_0161765_156_986 273
137 3300046525 Ga0495663_0000039 Ga0495663_0000039_43662_44492 273
138 3300046525 Ga0495663_0002377 Ga0495663_0002377_2205_3035 273
139 3300046538 Ga0495609_0000025 Ga0495609_0000025_130501_131331 273
140 3300046558 Ga0495633_0000002 Ga0495633_0000002_115638_116468 273
141 3300046558 Ga0495633_0002807 Ga0495633_0002807_3256_4086 273
142 3300046660 Ga0495625_0002075 Ga0495625_0002075_7952_8782 273
143 3300047472 Ga0495686_0000207 Ga0495686_0000207_48850_49680 273
144 3300048908 Ga0496105_0109722 Ga0496105_0109722_106_936 273
145 3300048919 Ga0496116_0000053 Ga0496116_0000053_214866_215696 273
146 3300048920 Ga0496117_0000050 Ga0496117_0000050_225034_225864 273
147 3300048921 Ga0496118_0000044 Ga0496118_0000044_66891_67721 273
148 3300048922 Ga0496119_0000002 Ga0496119_0000002_69069_69899 273
149 3300048923 Ga0496120_0045980 Ga0496120_0045980_1084_1914 273
150 3300048925 Ga0496122_0000191 Ga0496122_0000191_67197_68027 273
151 3300048925 Ga0496122_0000290 Ga0496122_0000290_82834_83664 273
152 3300048925 Ga0496122_0000668 Ga0496122_0000668_12541_13362 273
153 3300048925 Ga0496122_0001730 Ga0496122_0001730_4424_5254 273
154 3300048925 Ga0496122_0006241 Ga0496122_0006241_11267_12097 273
155 3300048926 Ga0496123_0000579 Ga0496123_0000579_8354_9184 273
156 3300048926 Ga0496123_0000586 Ga0496123_0000586_5054_5875 273
157 3300048926 Ga0496123_0016210 Ga0496123_0016210_4331_5161 273
158 3300048927 Ga0496124_0025182 Ga0496124_0025182_1221_2051 273
159 3300048928 Ga0496125_0000181 Ga0496125_0000181_4328_5158 273
160 3300048928 Ga0496125_0046552 Ga0496125_0046552_1639_2469 273
161 3300049652 Ga0501202_001386 Ga0501202_001386_192_1022 273
162 3300049660 Ga0501216_015739 Ga0501216_015739_196_1026 273
163 3300053090 Ga0500646_0001604 Ga0500646_0001604_427_1248 273
164 2162886011 MRS1b_contig_7667592 MRS1b_0533.00001090 274
165 3300002738 JGI25154J39366_1000022 JGI25154J39366_10000223 274
166 3300003215 JGI25153J46596_10011973 JGI25153J46596_100119734 274
167 3300003316 rootH1_10125256 rootH1_101252562 274
168 3300003320 rootH2_10066192 rootH2_100661923 274
169 3300003322 rootL2_10110624 rootL2_101106247 274
170 3300003322 rootL2_10193287 rootL2_101932878 274
171 3300003323 rootH1_10057714 rootH1_100577143 274
172 3300003323 rootH1_10138290 rootH1_101382903 274
173 3300003794 Ga0055531_10000359 Ga0055531_1000035926 274
174 3300005262 Ga0065165_1001876 Ga0065165_10018769 274
175 3300005834 Ga0068851_10064536 Ga0068851_100645361 274
176 3300006847 Ga0075431_100002027 Ga0075431_1000020273 274
177 3300009094 Ga0111539_10004608 Ga0111539_100046086 274
178 3300009147 Ga0114129_10065245 Ga0114129_100652454 274
179 3300013296 Ga0157374_10362253 Ga0157374_103622532 274
180 3300013306 Ga0163162_10000109 Ga0163162_1000010923 274
181 3300025246 Ga0209646_1000003 Ga0209646_1000003510 274
182 3300025250 Ga0209026_1002368 Ga0209026_10023683 274
183 3300025302 Ga0207426_1000582 Ga0207426_10005825 274
184 3300025304 Ga0209257_1000005 Ga0209257_10000051069 274
185 3300028379 Ga0268266_10153560 Ga0268266_101535602 274
186 3300044672 Ga0466982_0190213 Ga0466982_0190213_140_967 274
187 3300049571 Ga0501034_0132388 Ga0501034_0132388_703_1527 274
188 3300049571 Ga0501034_0212048 Ga0501034_0212048_455_1288 274
189 3300049581 Ga0501047_0027089 Ga0501047_0027089_4203_5036 274
190 3300049758 Ga0501241_003965 Ga0501241_003965_364_1212 274
191 3300049776 Ga0501280_004107 Ga0501280_004107_384_1214 274
192 3300050005 Ga0501284_00003 Ga0501284_00003_175389_176237 274
193 3300050507 nmdc:mga05p37_35979_c1 nmdc:mga05p37_35979_c1_4664_5488 274
194 3300050508 nmdc:mga09592_17948_c1 nmdc:mga09592_17948_c1_2905_3729 274
195 3300050510 nmdc:mga06r32_9546_c1 nmdc:mga06r32_9546_c1_4844_5668 274
196 3300050511 nmdc:mga08y16_32218_c1 nmdc:mga08y16_32218_c1_3241_4065 274
197 3300053108 Ga0500562_007147 Ga0500562_007147_726_1559 274
198 3300053139 Ga0500568_0045066 Ga0500568_0045066_260_1093 274
199 3300053151 Ga0500604_0001884 Ga0500604_0001884_2882_3718 274
200 3300053156 Ga0500622_0000392 Ga0500622_0000392_16374_17210 274
201 3300053156 Ga0500622_0000394 Ga0500622_0000394_24869_25702 274
202 3300053158 Ga0500627_0090042 Ga0500627_0090042_428_1264 274
203 iso_pu_bacteria 2929921140 2929926874 274
204 iso_pu_bacteria 8003151029 8003153992 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03705

CheR_N

CheR methyltransferase, all-alpha domain

22

74

0.95

PF01739

CheR

CheR methyltransferase, SAM binding domain

87

282

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ftw-assembly1.cif.gz_A crystal structure of glutamate o-methyltransferase in complex with s- adenosyl-l-homocysteine (sah) from bacillus subtilis 0.8605 9 272
5ftw-assembly1.cif.gz_A crystal structure of glutamate o-methyltransferase in complex with s- adenosyl-l-homocysteine (sah) from bacillus subtilis 0.8543 9 272
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.8181 76 274
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.8069 76 274
1aw5-assembly1.cif.gz_A 5-aminolevulinate dehydratase from saccharomyces cerevisiae 0.713 105 135
ID Description Score Start End Superfamily
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8573 73 272 3.40.50.150
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.849 73 272 3.40.50.150
1af7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8157 73 272 3.40.50.150
1af7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8079 73 272 3.40.50.150
af_Q0DEV8_1_106_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7925 210 244 3.40.50.150
ID Description Score Start End GO Terms
AF-J2IZG0-F1-model_v4 protein-glutamate O-methyltransferase (EC 2.1.1.80) 0.964 6 274 GO:0008757
GO:0032259
AF-J2IZG0-F1-model_v4 protein-glutamate O-methyltransferase (EC 2.1.1.80) 0.957 6 274 GO:0008757
GO:0032259
AF-A0A7T9BPK0-F1-model_v4 deleted 0.9569 6 274
AF-A0A6J4T6M9-F1-model_v4 MCP methyltransferase, CheR-type 0.9564 9 274 GO:0008757
GO:0032259
AF-A0A1Z4T9Q7-F1-model_v4 deleted 0.9544 8 274

Feature Viewer

pLDDT pTM Quality
90.61 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map