F312211
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 204 | 127 | 195 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100018785|Ga0070663_1000187852 |
| Length | 213 |
| Sequence | MYLVKTPWLLKKLYPTLVWNLNRTERCIFLTFDDGPIPIVTPFVLKNLKQYDAKGTFFCIGDNVKKHPDIFEDVKAGGHAIGNHTFNHLKGWKTQDDVYMQNFLQCNDILQTETSLFRPPYGRIKRNQIKLLKAQKPDLQIIMWDVLSGDFDMSLSPEKCLQHVIRHTENGSIVVFHDSLKAFNRLEYVLPRALEYWSNEGYSFAPLPPEGGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 2 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 3 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 4 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 5 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 6 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 7 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 8 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 9 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 10 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 41 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 58 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 64 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 89 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 90 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 91 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 92 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 93 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 94 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 95 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 96 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 97 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 98 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 99 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 100 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 101 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 102 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 103 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 104 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 105 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 122 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 123 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 124 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 125 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 126 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 127 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.61 |
| Metatranscriptomes | 0.98 |
| Isolates | 4.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.75 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 79.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1007536 | 3300001904 | Unclassified | 1828 |
| 2 | JGI24737J22298_10028071 | 3300001990 | Bacteria | 1771 |
| 3 | JGI25162J39368_1001918 | 3300002737 | Bacteria | 9527 |
| 4 | JGI25165J46597_1000621 | 3300003214 | Bacteria | 29774 |
| 5 | rootH2_10000984 | 3300003320 | Bacteria | 89440 |
| 6 | rootH1_10004576 | 3300003323 | Bacteria | 68064 |
| 7 | rootH1_10012648 | 3300003323 | Bacteria | 5940 |
| 8 | rootH1_10209256 | 3300003323 | Bacteria | 2609 |
| 9 | Ga0055536_1000004 | 3300003781 | Bacteria | 411108 |
| 10 | Ga0055530_10001351 | 3300003791 | Bacteria | 18306 |
| 11 | Ga0055531_10008124 | 3300003794 | Bacteria | 5591 |
| 12 | Ga0058863_11763624 | 3300004799 | Bacteria | 1346 |
| 13 | Ga0058862_12856551 | 3300004803 | Bacteria | 1837 |
| 14 | Ga0065714_10005700 | 3300005288 | Bacteria | 5071 |
| 15 | Ga0065714_10104485 | 3300005288 | Bacteria | 1584 |
| 16 | Ga0065714_10195273 | 3300005288 | Bacteria | 913 |
| 17 | Ga0065704_10000431 | 3300005289 | Bacteria | 21291 |
| 18 | Ga0070658_10000041 | 3300005327 | Bacteria | 134208 |
| 19 | Ga0070658_10047178 | 3300005327 | Bacteria | 3486 |
| 20 | Ga0070683_100002666 | 3300005329 | Bacteria | 14261 |
| 21 | Ga0070680_100303050 | 3300005336 | Bacteria | 1355 |
| 22 | Ga0070682_100508260 | 3300005337 | Unclassified | 935 |
| 23 | Ga0070660_100276753 | 3300005339 | Bacteria | 1373 |
| 24 | Ga0070659_100006881 | 3300005366 | Bacteria | 8236 |
| 25 | Ga0070659_100255194 | 3300005366 | Bacteria | 1454 |
| 26 | Ga0070711_100432609 | 3300005439 | Bacteria | 1074 |
| 27 | Ga0070663_100018785 | 3300005455 | Bacteria | 4541 |
| 28 | Ga0070662_100000053 | 3300005457 | Bacteria | 61062 |
| 29 | Ga0070681_10024356 | 3300005458 | Bacteria | 6093 |
| 30 | Ga0070679_100124163 | 3300005530 | Bacteria | 2565 |
| 31 | Ga0068853_100023767 | 3300005539 | Bacteria | 5135 |
| 32 | Ga0070665_100000096 | 3300005548 | Bacteria | 166864 |
| 33 | Ga0068855_100000014 | 3300005563 | Bacteria | 232720 |
| 34 | Ga0068855_100000185 | 3300005563 | Bacteria | 79849 |
| 35 | Ga0068855_100008233 | 3300005563 | Bacteria | 12602 |
| 36 | Ga0068855_100038751 | 3300005563 | Bacteria | 5661 |
| 37 | Ga0068855_100508777 | 3300005563 | Bacteria | 1308 |
| 38 | Ga0068855_100744349 | 3300005563 | Bacteria | 1046 |
| 39 | Ga0068857_100038927 | 3300005577 | Bacteria | 4210 |
| 40 | Ga0068856_100000095 | 3300005614 | Bacteria | 84075 |
| 41 | Ga0068856_100031589 | 3300005614 | Bacteria | 5182 |
| 42 | Ga0068856_100684677 | 3300005614 | Bacteria | 1046 |
| 43 | Ga0068870_10052314 | 3300005840 | Bacteria | 2165 |
| 44 | Ga0075366_10000557 | 3300006195 | Bacteria | 17406 |
| 45 | Ga0075366_10012879 | 3300006195 | Bacteria | 4754 |
| 46 | Ga0075366_10023952 | 3300006195 | Bacteria | 3558 |
| 47 | Ga0075370_10115791 | 3300006353 | Bacteria | 1558 |
| 48 | Ga0105240_10001738 | 3300009093 | Bacteria | 36787 |
| 49 | Ga0105240_10033048 | 3300009093 | Bacteria | 6688 |
| 50 | Ga0105240_10104520 | 3300009093 | Bacteria | 3439 |
| 51 | Ga0105240_10309314 | 3300009093 | Bacteria | 1805 |
| 52 | Ga0105240_10328206 | 3300009093 | Bacteria | 1742 |
| 53 | Ga0105240_10647089 | 3300009093 | Bacteria | 1159 |
| 54 | Ga0105245_11007801 | 3300009098 | Bacteria | 877 |
| 55 | Ga0105241_10118660 | 3300009174 | Unclassified | 2127 |
| 56 | Ga0105241_10269620 | 3300009174 | Bacteria | 1450 |
| 57 | Ga0105241_10297851 | 3300009174 | Bacteria | 1383 |
| 58 | Ga0105237_10001525 | 3300009545 | Bacteria | 30379 |
| 59 | Ga0105249_10555527 | 3300009553 | Bacteria | 1199 |
| 60 | Ga0105239_10000955 | 3300010375 | Bacteria | 40720 |
| 61 | Ga0105239_10002923 | 3300010375 | Bacteria | 21328 |
| 62 | Ga0105246_10151888 | 3300011119 | Bacteria | 1754 |
| 63 | Ga0157373_10000087 | 3300013100 | Bacteria | 80308 |
| 64 | Ga0157373_10001269 | 3300013100 | Bacteria | 19287 |
| 65 | Ga0157373_10001448 | 3300013100 | Bacteria | 18133 |
| 66 | Ga0157373_10008242 | 3300013100 | Bacteria | 7747 |
| 67 | Ga0157373_10075817 | 3300013100 | Bacteria | 2373 |
| 68 | Ga0157371_10000041 | 3300013102 | Bacteria | 203957 |
| 69 | Ga0157371_10000164 | 3300013102 | Bacteria | 96408 |
| 70 | Ga0157371_10000779 | 3300013102 | Bacteria | 36655 |
| 71 | Ga0157371_10047478 | 3300013102 | Bacteria | 3053 |
| 72 | Ga0157370_10026418 | 3300013104 | Bacteria | 5734 |
| 73 | Ga0157370_10062540 | 3300013104 | Bacteria | 3530 |
| 74 | Ga0157370_10118125 | 3300013104 | Unclassified | 2477 |
| 75 | Ga0157370_10421202 | 3300013104 | Bacteria | 1228 |
| 76 | Ga0157369_10000494 | 3300013105 | Bacteria | 52196 |
| 77 | Ga0157369_10029946 | 3300013105 | Bacteria | 6009 |
| 78 | Ga0157369_10229668 | 3300013105 | Bacteria | 1940 |
| 79 | Ga0157369_10235768 | 3300013105 | Bacteria | 1912 |
| 80 | Ga0157374_10006487 | 3300013296 | Bacteria | 9932 |
| 81 | Ga0157374_10013284 | 3300013296 | Bacteria | 7184 |
| 82 | Ga0157374_10148631 | 3300013296 | Bacteria | 2277 |
| 83 | Ga0157378_10018031 | 3300013297 | Bacteria | 6198 |
| 84 | Ga0163162_10000005 | 3300013306 | Bacteria | 447195 |
| 85 | Ga0163162_10032845 | 3300013306 | Bacteria | 5154 |
| 86 | Ga0163162_10088781 | 3300013306 | Bacteria | 3171 |
| 87 | Ga0163162_10504132 | 3300013306 | Bacteria | 1341 |
| 88 | Ga0157372_10000042 | 3300013307 | Bacteria | 157651 |
| 89 | Ga0157372_10025700 | 3300013307 | Bacteria | 6405 |
| 90 | Ga0157372_10031098 | 3300013307 | Bacteria | 5844 |
| 91 | Ga0157372_10036263 | 3300013307 | Bacteria | 5434 |
| 92 | Ga0182008_10012463 | 3300014497 | Bacteria | 4487 |
| 93 | Ga0182008_10037079 | 3300014497 | Unclassified | 2440 |
| 94 | Ga0182008_10039082 | 3300014497 | Bacteria | 2372 |
| 95 | Ga0182006_1008020 | 3300015261 | Bacteria | 4798 |
| 96 | Ga0182007_10004108 | 3300015262 | Bacteria | 6690 |
| 97 | Ga0182007_10030825 | 3300015262 | Bacteria | 1830 |
| 98 | Ga0163161_10017964 | 3300017792 | Bacteria | 4958 |
| 99 | Ga0207427_100376 | 3300025231 | Bacteria | 27182 |
| 100 | Ga0207427_111165 | 3300025231 | Bacteria | 918 |
| 101 | Ga0209437_100048 | 3300025233 | Bacteria | 405107 |
| 102 | Ga0209026_1002092 | 3300025250 | Bacteria | 7853 |
| 103 | Ga0209026_1003388 | 3300025250 | Bacteria | 5260 |
| 104 | Ga0209026_1007586 | 3300025250 | Bacteria | 2409 |
| 105 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 106 | Ga0209233_1015827 | 3300025261 | Bacteria | 2090 |
| 107 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 108 | Ga0209050_1000048 | 3300025298 | Bacteria | 371553 |
| 109 | Ga0209257_1000005 | 3300025304 | Bacteria | 1592528 |
| 110 | Ga0207647_10000752 | 3300025904 | Bacteria | 25389 |
| 111 | Ga0207647_10001922 | 3300025904 | Bacteria | 15883 |
| 112 | Ga0207705_10000068 | 3300025909 | Bacteria | 134316 |
| 113 | Ga0207705_10032302 | 3300025909 | Bacteria | 3740 |
| 114 | Ga0207654_10032315 | 3300025911 | Bacteria | 2891 |
| 115 | Ga0207654_10216528 | 3300025911 | Bacteria | 1268 |
| 116 | Ga0207695_10000183 | 3300025913 | Bacteria | 181350 |
| 117 | Ga0207695_10012050 | 3300025913 | Bacteria | 10396 |
| 118 | Ga0207695_10059533 | 3300025913 | Bacteria | 3960 |
| 119 | Ga0207695_10308272 | 3300025913 | Bacteria | 1473 |
| 120 | Ga0207695_10482710 | 3300025913 | Bacteria | 1121 |
| 121 | Ga0207671_10001824 | 3300025914 | Bacteria | 23769 |
| 122 | Ga0207671_10185711 | 3300025914 | Bacteria | 1619 |
| 123 | Ga0207663_10356303 | 3300025916 | Bacteria | 1109 |
| 124 | Ga0207657_10019650 | 3300025919 | Bacteria | 6406 |
| 125 | Ga0207657_10252568 | 3300025919 | Bacteria | 1405 |
| 126 | Ga0207657_10535619 | 3300025919 | Bacteria | 916 |
| 127 | Ga0207652_10170560 | 3300025921 | Bacteria | 1952 |
| 128 | Ga0207644_10388222 | 3300025931 | Unclassified | 1139 |
| 129 | Ga0207690_10053624 | 3300025932 | Bacteria | 2707 |
| 130 | Ga0207706_10000444 | 3300025933 | Bacteria | 44162 |
| 131 | Ga0207686_10111956 | 3300025934 | Bacteria | 1843 |
| 132 | Ga0207661_10002571 | 3300025944 | Bacteria | 12496 |
| 133 | Ga0207667_10000049 | 3300025949 | Bacteria | 235027 |
| 134 | Ga0207667_10000204 | 3300025949 | Bacteria | 84991 |
| 135 | Ga0207667_10088371 | 3300025949 | Bacteria | 3205 |
| 136 | Ga0207667_10559668 | 3300025949 | Bacteria | 1156 |
| 137 | Ga0207712_10460219 | 3300025961 | Bacteria | 1080 |
| 138 | Ga0207639_10007578 | 3300026041 | Bacteria | 7404 |
| 139 | Ga0207639_10376710 | 3300026041 | Bacteria | 1273 |
| 140 | Ga0207678_10112115 | 3300026067 | Bacteria | 2327 |
| 141 | Ga0207702_10000699 | 3300026078 | Bacteria | 36199 |
| 142 | Ga0207702_10601651 | 3300026078 | Bacteria | 1079 |
| 143 | Ga0207674_10051242 | 3300026116 | Bacteria | 4213 |
| 144 | Ga0268266_10000032 | 3300028379 | Bacteria | 395079 |
| 145 | Ga0307515_10001308 | 3300028794 | Bacteria | 56577 |
| 146 | Ga0307515_10014632 | 3300028794 | Bacteria | 14524 |
| 147 | Ga0265338_10133546 | 3300028800 | Bacteria | 1955 |
| 148 | Ga0265327_10093780 | 3300031251 | Bacteria | 1460 |
| 149 | Ga0307509_10054222 | 3300031507 | Bacteria | 4270 |
| 150 | Ga0307412_10000049 | 3300031911 | Bacteria | 151588 |
| 151 | Ga0307414_10010153 | 3300032004 | Bacteria | 5448 |
| 152 | Ga0307414_10206121 | 3300032004 | Bacteria | 1603 |
| 153 | Ga0307507_10000099 | 3300033179 | Bacteria | 139532 |
| 154 | Ga0373941_0007007 | 3300035115 | Bacteria | 2740 |
| 155 | Ga0395899_0000017 | 3300037312 | Bacteria | 440179 |
| 156 | Ga0395899_0000591 | 3300037312 | Bacteria | 38186 |
| 157 | Ga0395899_0032027 | 3300037312 | Bacteria | 3950 |
| 158 | Ga0395900_0006061 | 3300037418 | Bacteria | 12607 |
| 159 | Ga0395905_0000169 | 3300037471 | Bacteria | 106579 |
| 160 | Ga0395901_0090970 | 3300038443 | Bacteria | 3194 |
| 161 | Ga0436361_1214551 | 3300039447 | Bacteria | 7839 |
| 162 | Ga0451851_0104922 | 3300041507 | Bacteria | 1451 |
| 163 | Ga0439448_0014140 | 3300042005 | Bacteria | 2405 |
| 164 | Ga0466961_0015455 | 3300044693 | Bacteria | 4899 |
| 165 | Ga0466959_0054203 | 3300045049 | Bacteria | 2931 |
| 166 | Ga0466959_0056144 | 3300045049 | Bacteria | 2874 |
| 167 | Ga0495629_0228633 | 3300046459 | Bacteria | 1282 |
| 168 | Ga0495650_0042978 | 3300046471 | Bacteria | 1921 |
| 169 | Ga0495585_0000241 | 3300046492 | Bacteria | 56727 |
| 170 | Ga0495607_0323255 | 3300046501 | Bacteria | 719 |
| 171 | Ga0495648_0088734 | 3300046524 | Bacteria | 1737 |
| 172 | Ga0495642_0085589 | 3300046528 | Bacteria | 1331 |
| 173 | Ga0495609_0013139 | 3300046538 | Bacteria | 3915 |
| 174 | Ga0495633_0000006 | 3300046558 | Bacteria | 326774 |
| 175 | Ga0495633_0067136 | 3300046558 | Bacteria | 1675 |
| 176 | Ga0495668_0000054 | 3300046616 | Bacteria | 203960 |
| 177 | Ga0495625_0000355 | 3300046660 | Bacteria | 69806 |
| 178 | Ga0495625_0000548 | 3300046660 | Bacteria | 55064 |
| 179 | Ga0495625_0048694 | 3300046660 | Bacteria | 3050 |
| 180 | Ga0495661_0007422 | 3300046665 | Bacteria | 7644 |
| 181 | Ga0495658_0246996 | 3300046683 | Bacteria | 1122 |
| 182 | Ga0495670_0218033 | 3300046691 | Bacteria | 1013 |
| 183 | Ga0495677_0113267 | 3300047445 | Bacteria | 1032 |
| 184 | Ga0495686_0002085 | 3300047472 | Bacteria | 19661 |
| 185 | Ga0495686_0053774 | 3300047472 | Bacteria | 2523 |
| 186 | Ga0495682_0066237 | 3300049460 | Bacteria | 1302 |
| 187 | nmdc:mga0k408_245_c1 | 3300050493 | Bacteria | 29347 |
| 188 | nmdc:mga0k408_4726_c1 | 3300050493 | Bacteria | 7212 |
| 189 | nmdc:mga0k408_794_c1 | 3300050493 | Bacteria | 17412 |
| 190 | nmdc:mga07m45_171130_c1 | 3300050496 | Bacteria | 1262 |
| 191 | Ga0500635_0006395 | 3300053080 | Bacteria | 3144 |
| 192 | Ga0500608_020716 | 3300053122 | Bacteria | 3029 |
| 193 | Ga0500614_005399 | 3300053123 | Bacteria | 2682 |
| 194 | Ga0500561_0118970 | 3300053137 | Bacteria | 805 |
| 195 | Ga0500622_0004845 | 3300053156 | Bacteria | 8257 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046558 | Ga0495633_0067136 | Ga0495633_0067136_182_868 | 182 |
| 2 | 3300003794 | Ga0055531_10008124 | Ga0055531_100081242 | 186 |
| 3 | 3300005337 | Ga0070682_100508260 | Ga0070682_1005082602 | 186 |
| 4 | 3300013104 | Ga0157370_10118125 | Ga0157370_101181252 | 186 |
| 5 | 3300025304 | Ga0209257_1000005 | Ga0209257_1000005756 | 186 |
| 6 | 3300003323 | rootH1_10209256 | rootH1_102092563 | 189 |
| 7 | 3300003781 | Ga0055536_1000004 | Ga0055536_1000004191 | 189 |
| 8 | 3300003791 | Ga0055530_10001351 | Ga0055530_1000135116 | 189 |
| 9 | 3300005288 | Ga0065714_10104485 | Ga0065714_101044851 | 189 |
| 10 | 3300005288 | Ga0065714_10195273 | Ga0065714_101952731 | 189 |
| 11 | 3300005289 | Ga0065704_10000431 | Ga0065704_100004313 | 189 |
| 12 | 3300005329 | Ga0070683_100002666 | Ga0070683_1000026667 | 189 |
| 13 | 3300005336 | Ga0070680_100303050 | Ga0070680_1003030501 | 189 |
| 14 | 3300005614 | Ga0068856_100000095 | Ga0068856_10000009548 | 189 |
| 15 | 3300006195 | Ga0075366_10000557 | Ga0075366_100005576 | 189 |
| 16 | 3300006195 | Ga0075366_10012879 | Ga0075366_100128792 | 189 |
| 17 | 3300006195 | Ga0075366_10023952 | Ga0075366_100239523 | 189 |
| 18 | 3300006353 | Ga0075370_10115791 | Ga0075370_101157912 | 189 |
| 19 | 3300009093 | Ga0105240_10309314 | Ga0105240_103093142 | 189 |
| 20 | 3300009093 | Ga0105240_10328206 | Ga0105240_103282062 | 189 |
| 21 | 3300009174 | Ga0105241_10297851 | Ga0105241_102978511 | 189 |
| 22 | 3300009545 | Ga0105237_10001525 | Ga0105237_1000152514 | 189 |
| 23 | 3300013100 | Ga0157373_10000087 | Ga0157373_1000008761 | 189 |
| 24 | 3300013100 | Ga0157373_10001269 | Ga0157373_1000126916 | 189 |
| 25 | 3300013100 | Ga0157373_10008242 | Ga0157373_100082424 | 189 |
| 26 | 3300013102 | Ga0157371_10000041 | Ga0157371_1000004180 | 189 |
| 27 | 3300013104 | Ga0157370_10026418 | Ga0157370_100264183 | 189 |
| 28 | 3300013104 | Ga0157370_10421202 | Ga0157370_104212022 | 189 |
| 29 | 3300013105 | Ga0157369_10029946 | Ga0157369_100299466 | 189 |
| 30 | 3300013307 | Ga0157372_10031098 | Ga0157372_100310984 | 189 |
| 31 | 3300014497 | Ga0182008_10012463 | Ga0182008_100124631 | 189 |
| 32 | 3300014497 | Ga0182008_10037079 | Ga0182008_100370791 | 189 |
| 33 | 3300014497 | Ga0182008_10039082 | Ga0182008_100390822 | 189 |
| 34 | 3300015261 | Ga0182006_1008020 | Ga0182006_10080202 | 189 |
| 35 | 3300015262 | Ga0182007_10004108 | Ga0182007_100041086 | 189 |
| 36 | 3300015262 | Ga0182007_10030825 | Ga0182007_100308252 | 189 |
| 37 | 3300017792 | Ga0163161_10017964 | Ga0163161_100179645 | 189 |
| 38 | 3300025250 | Ga0209026_1003388 | Ga0209026_10033882 | 189 |
| 39 | 3300025250 | Ga0209026_1007586 | Ga0209026_10075862 | 189 |
| 40 | 3300025292 | Ga0209676_1000009 | Ga0209676_1000009363 | 189 |
| 41 | 3300025298 | Ga0209050_1000048 | Ga0209050_1000048159 | 189 |
| 42 | 3300025911 | Ga0207654_10216528 | Ga0207654_102165282 | 189 |
| 43 | 3300025913 | Ga0207695_10482710 | Ga0207695_104827102 | 189 |
| 44 | 3300025914 | Ga0207671_10001824 | Ga0207671_1000182419 | 189 |
| 45 | 3300025916 | Ga0207663_10356303 | Ga0207663_103563031 | 189 |
| 46 | 3300025934 | Ga0207686_10111956 | Ga0207686_101119562 | 189 |
| 47 | 3300025944 | Ga0207661_10002571 | Ga0207661_100025714 | 189 |
| 48 | 3300026078 | Ga0207702_10000699 | Ga0207702_1000069926 | 189 |
| 49 | 3300031911 | Ga0307412_10000049 | Ga0307412_1000004925 | 189 |
| 50 | 3300032004 | Ga0307414_10010153 | Ga0307414_100101532 | 189 |
| 51 | 3300032004 | Ga0307414_10206121 | Ga0307414_102061212 | 189 |
| 52 | 3300035115 | Ga0373941_0007007 | Ga0373941_0007007_286_903 | 189 |
| 53 | 3300037312 | Ga0395899_0000017 | Ga0395899_0000017_340600_341217 | 189 |
| 54 | 3300037312 | Ga0395899_0032027 | Ga0395899_0032027_552_1172 | 189 |
| 55 | 3300037418 | Ga0395900_0006061 | Ga0395900_0006061_3311_3931 | 189 |
| 56 | 3300037471 | Ga0395905_0000169 | Ga0395905_0000169_41389_42009 | 189 |
| 57 | 3300046471 | Ga0495650_0042978 | Ga0495650_0042978_599_1216 | 189 |
| 58 | 3300046501 | Ga0495607_0323255 | Ga0495607_0323255_35_652 | 189 |
| 59 | 3300046660 | Ga0495625_0000548 | Ga0495625_0000548_53289_53906 | 189 |
| 60 | 3300050493 | nmdc:mga0k408_245_c1 | nmdc:mga0k408_245_c1_24904_25521 | 189 |
| 61 | 3300050493 | nmdc:mga0k408_4726_c1 | nmdc:mga0k408_4726_c1_5652_6269 | 189 |
| 62 | 3300050493 | nmdc:mga0k408_794_c1 | nmdc:mga0k408_794_c1_5737_6354 | 189 |
| 63 | 3300050496 | nmdc:mga07m45_171130_c1 | nmdc:mga07m45_171130_c1_481_1098 | 189 |
| 64 | 3300053156 | Ga0500622_0004845 | Ga0500622_0004845_3821_4438 | 189 |
| 65 | iso_pu_bacteria | 2585427687 | 2586211081 | 189 |
| 66 | iso_pu_bacteria | 2738541302 | 2738854470 | 189 |
| 67 | iso_pu_bacteria | 2739367663 | 2739646938 | 189 |
| 68 | iso_pu_bacteria | 2852627209 | 2852629159 | 189 |
| 69 | iso_pu_bacteria | 2857627736 | 2857631391 | 189 |
| 70 | iso_pu_bacteria | 2945997725 | 2945998995 | 189 |
| 71 | 3300004799 | Ga0058863_11763624 | Ga0058863_117636242 | 190 |
| 72 | 3300004803 | Ga0058862_12856551 | Ga0058862_128565512 | 190 |
| 73 | 3300005327 | Ga0070658_10000041 | Ga0070658_1000004123 | 190 |
| 74 | 3300005458 | Ga0070681_10024356 | Ga0070681_100243566 | 190 |
| 75 | 3300005530 | Ga0070679_100124163 | Ga0070679_1001241633 | 190 |
| 76 | 3300005539 | Ga0068853_100023767 | Ga0068853_1000237672 | 190 |
| 77 | 3300005563 | Ga0068855_100000185 | Ga0068855_10000018551 | 190 |
| 78 | 3300005563 | Ga0068855_100008233 | Ga0068855_10000823313 | 190 |
| 79 | 3300005563 | Ga0068855_100038751 | Ga0068855_1000387513 | 190 |
| 80 | 3300005840 | Ga0068870_10052314 | Ga0068870_100523142 | 190 |
| 81 | 3300009093 | Ga0105240_10001738 | Ga0105240_1000173835 | 190 |
| 82 | 3300009098 | Ga0105245_11007801 | Ga0105245_110078012 | 190 |
| 83 | 3300010375 | Ga0105239_10000955 | Ga0105239_1000095513 | 190 |
| 84 | 3300010375 | Ga0105239_10002923 | Ga0105239_100029238 | 190 |
| 85 | 3300013296 | Ga0157374_10006487 | Ga0157374_100064872 | 190 |
| 86 | 3300013296 | Ga0157374_10148631 | Ga0157374_101486312 | 190 |
| 87 | 3300013297 | Ga0157378_10018031 | Ga0157378_100180314 | 190 |
| 88 | 3300025909 | Ga0207705_10000068 | Ga0207705_10000068101 | 190 |
| 89 | 3300025911 | Ga0207654_10032315 | Ga0207654_100323153 | 190 |
| 90 | 3300025913 | Ga0207695_10000183 | Ga0207695_10000183118 | 190 |
| 91 | 3300025919 | Ga0207657_10019650 | Ga0207657_100196504 | 190 |
| 92 | 3300025921 | Ga0207652_10170560 | Ga0207652_101705602 | 190 |
| 93 | 3300025931 | Ga0207644_10388222 | Ga0207644_103882222 | 190 |
| 94 | 3300025949 | Ga0207667_10000204 | Ga0207667_1000020455 | 190 |
| 95 | 3300025949 | Ga0207667_10088371 | Ga0207667_100883713 | 190 |
| 96 | 3300026041 | Ga0207639_10376710 | Ga0207639_103767102 | 190 |
| 97 | 3300028800 | Ga0265338_10133546 | Ga0265338_101335462 | 190 |
| 98 | 3300039447 | Ga0436361_1214551 | Ga0436361_1214551_6359_6979 | 190 |
| 99 | 3300045049 | Ga0466959_0056144 | Ga0466959_0056144_2006_2626 | 190 |
| 100 | 3300046528 | Ga0495642_0085589 | Ga0495642_0085589_204_824 | 190 |
| 101 | 3300047445 | Ga0495677_0113267 | Ga0495677_0113267_112_732 | 190 |
| 102 | 3300047472 | Ga0495686_0002085 | Ga0495686_0002085_13919_14542 | 190 |
| 103 | 3300001904 | JGI24736J21556_1007536 | JGI24736J21556_10075362 | 191 |
| 104 | 3300001990 | JGI24737J22298_10028071 | JGI24737J22298_100280712 | 191 |
| 105 | 3300002737 | JGI25162J39368_1001918 | JGI25162J39368_10019182 | 191 |
| 106 | 3300003214 | JGI25165J46597_1000621 | JGI25165J46597_10006219 | 191 |
| 107 | 3300003320 | rootH2_10000984 | rootH2_1000098431 | 191 |
| 108 | 3300003323 | rootH1_10004576 | rootH1_1000457659 | 191 |
| 109 | 3300003323 | rootH1_10012648 | rootH1_100126484 | 191 |
| 110 | 3300005288 | Ga0065714_10005700 | Ga0065714_100057002 | 191 |
| 111 | 3300005327 | Ga0070658_10047178 | Ga0070658_100471782 | 191 |
| 112 | 3300005339 | Ga0070660_100276753 | Ga0070660_1002767532 | 191 |
| 113 | 3300005366 | Ga0070659_100006881 | Ga0070659_1000068814 | 191 |
| 114 | 3300005366 | Ga0070659_100255194 | Ga0070659_1002551941 | 191 |
| 115 | 3300005439 | Ga0070711_100432609 | Ga0070711_1004326091 | 191 |
| 116 | 3300005455 | Ga0070663_100018785 | Ga0070663_1000187852 | 191 |
| 117 | 3300005457 | Ga0070662_100000053 | Ga0070662_10000005332 | 191 |
| 118 | 3300005548 | Ga0070665_100000096 | Ga0070665_10000009690 | 191 |
| 119 | 3300005563 | Ga0068855_100000014 | Ga0068855_1000000148 | 191 |
| 120 | 3300005563 | Ga0068855_100508777 | Ga0068855_1005087772 | 191 |
| 121 | 3300005563 | Ga0068855_100744349 | Ga0068855_1007443492 | 191 |
| 122 | 3300005577 | Ga0068857_100038927 | Ga0068857_1000389274 | 191 |
| 123 | 3300005614 | Ga0068856_100031589 | Ga0068856_1000315895 | 191 |
| 124 | 3300005614 | Ga0068856_100684677 | Ga0068856_1006846771 | 191 |
| 125 | 3300009093 | Ga0105240_10033048 | Ga0105240_100330484 | 191 |
| 126 | 3300009093 | Ga0105240_10104520 | Ga0105240_101045202 | 191 |
| 127 | 3300009093 | Ga0105240_10647089 | Ga0105240_106470891 | 191 |
| 128 | 3300009174 | Ga0105241_10118660 | Ga0105241_101186602 | 191 |
| 129 | 3300009174 | Ga0105241_10269620 | Ga0105241_102696202 | 191 |
| 130 | 3300009553 | Ga0105249_10555527 | Ga0105249_105555271 | 191 |
| 131 | 3300011119 | Ga0105246_10151888 | Ga0105246_101518882 | 191 |
| 132 | 3300013100 | Ga0157373_10001448 | Ga0157373_100014483 | 191 |
| 133 | 3300013100 | Ga0157373_10075817 | Ga0157373_100758172 | 191 |
| 134 | 3300013102 | Ga0157371_10000164 | Ga0157371_1000016417 | 191 |
| 135 | 3300013102 | Ga0157371_10000779 | Ga0157371_1000077926 | 191 |
| 136 | 3300013102 | Ga0157371_10047478 | Ga0157371_100474783 | 191 |
| 137 | 3300013104 | Ga0157370_10062540 | Ga0157370_100625403 | 191 |
| 138 | 3300013105 | Ga0157369_10000494 | Ga0157369_1000049439 | 191 |
| 139 | 3300013105 | Ga0157369_10229668 | Ga0157369_102296682 | 191 |
| 140 | 3300013105 | Ga0157369_10235768 | Ga0157369_102357682 | 191 |
| 141 | 3300013296 | Ga0157374_10013284 | Ga0157374_100132843 | 191 |
| 142 | 3300013306 | Ga0163162_10000005 | Ga0163162_10000005215 | 191 |
| 143 | 3300013306 | Ga0163162_10032845 | Ga0163162_100328455 | 191 |
| 144 | 3300013306 | Ga0163162_10088781 | Ga0163162_100887812 | 191 |
| 145 | 3300013306 | Ga0163162_10504132 | Ga0163162_105041321 | 191 |
| 146 | 3300013307 | Ga0157372_10000042 | Ga0157372_1000004249 | 191 |
| 147 | 3300013307 | Ga0157372_10025700 | Ga0157372_100257004 | 191 |
| 148 | 3300013307 | Ga0157372_10036263 | Ga0157372_100362632 | 191 |
| 149 | 3300025231 | Ga0207427_100376 | Ga0207427_10037611 | 191 |
| 150 | 3300025231 | Ga0207427_111165 | Ga0207427_1111651 | 191 |
| 151 | 3300025233 | Ga0209437_100048 | Ga0209437_100048135 | 191 |
| 152 | 3300025250 | Ga0209026_1002092 | Ga0209026_10020924 | 191 |
| 153 | 3300025261 | Ga0209233_1000029 | Ga0209233_1000029242 | 191 |
| 154 | 3300025261 | Ga0209233_1015827 | Ga0209233_10158273 | 191 |
| 155 | 3300025904 | Ga0207647_10000752 | Ga0207647_1000075215 | 191 |
| 156 | 3300025904 | Ga0207647_10001922 | Ga0207647_100019229 | 191 |
| 157 | 3300025909 | Ga0207705_10032302 | Ga0207705_100323022 | 191 |
| 158 | 3300025913 | Ga0207695_10012050 | Ga0207695_100120503 | 191 |
| 159 | 3300025913 | Ga0207695_10059533 | Ga0207695_100595332 | 191 |
| 160 | 3300025913 | Ga0207695_10308272 | Ga0207695_103082722 | 191 |
| 161 | 3300025914 | Ga0207671_10185711 | Ga0207671_101857111 | 191 |
| 162 | 3300025919 | Ga0207657_10252568 | Ga0207657_102525681 | 191 |
| 163 | 3300025919 | Ga0207657_10535619 | Ga0207657_105356191 | 191 |
| 164 | 3300025932 | Ga0207690_10053624 | Ga0207690_100536243 | 191 |
| 165 | 3300025933 | Ga0207706_10000444 | Ga0207706_100004448 | 191 |
| 166 | 3300025949 | Ga0207667_10000049 | Ga0207667_100000497 | 191 |
| 167 | 3300025949 | Ga0207667_10559668 | Ga0207667_105596682 | 191 |
| 168 | 3300025961 | Ga0207712_10460219 | Ga0207712_104602191 | 191 |
| 169 | 3300026041 | Ga0207639_10007578 | Ga0207639_100075787 | 191 |
| 170 | 3300026067 | Ga0207678_10112115 | Ga0207678_101121152 | 191 |
| 171 | 3300026078 | Ga0207702_10601651 | Ga0207702_106016512 | 191 |
| 172 | 3300026116 | Ga0207674_10051242 | Ga0207674_100512424 | 191 |
| 173 | 3300028379 | Ga0268266_10000032 | Ga0268266_100000326 | 191 |
| 174 | 3300028794 | Ga0307515_10001308 | Ga0307515_1000130849 | 191 |
| 175 | 3300028794 | Ga0307515_10014632 | Ga0307515_100146322 | 191 |
| 176 | 3300031251 | Ga0265327_10093780 | Ga0265327_100937801 | 191 |
| 177 | 3300031507 | Ga0307509_10054222 | Ga0307509_100542223 | 191 |
| 178 | 3300033179 | Ga0307507_10000099 | Ga0307507_10000099102 | 191 |
| 179 | 3300037312 | Ga0395899_0000591 | Ga0395899_0000591_24141_24782 | 191 |
| 180 | 3300038443 | Ga0395901_0090970 | Ga0395901_0090970_1756_2418 | 191 |
| 181 | 3300041507 | Ga0451851_0104922 | Ga0451851_0104922_767_1393 | 191 |
| 182 | 3300042005 | Ga0439448_0014140 | Ga0439448_0014140_1187_1813 | 191 |
| 183 | 3300044693 | Ga0466961_0015455 | Ga0466961_0015455_2638_3276 | 191 |
| 184 | 3300045049 | Ga0466959_0054203 | Ga0466959_0054203_551_1189 | 191 |
| 185 | 3300046459 | Ga0495629_0228633 | Ga0495629_0228633_89_715 | 191 |
| 186 | 3300046492 | Ga0495585_0000241 | Ga0495585_0000241_55965_56591 | 191 |
| 187 | 3300046524 | Ga0495648_0088734 | Ga0495648_0088734_291_917 | 191 |
| 188 | 3300046538 | Ga0495609_0013139 | Ga0495609_0013139_96_722 | 191 |
| 189 | 3300046558 | Ga0495633_0000006 | Ga0495633_0000006_42368_42994 | 191 |
| 190 | 3300046616 | Ga0495668_0000054 | Ga0495668_0000054_203198_203824 | 191 |
| 191 | 3300046660 | Ga0495625_0000355 | Ga0495625_0000355_137_763 | 191 |
| 192 | 3300046660 | Ga0495625_0048694 | Ga0495625_0048694_680_1315 | 191 |
| 193 | 3300046665 | Ga0495661_0007422 | Ga0495661_0007422_5588_6211 | 191 |
| 194 | 3300046683 | Ga0495658_0246996 | Ga0495658_0246996_372_998 | 191 |
| 195 | 3300046691 | Ga0495670_0218033 | Ga0495670_0218033_190_816 | 191 |
| 196 | 3300047472 | Ga0495686_0053774 | Ga0495686_0053774_1853_2491 | 191 |
| 197 | 3300049460 | Ga0495682_0066237 | Ga0495682_0066237_582_1208 | 191 |
| 198 | 3300053080 | Ga0500635_0006395 | Ga0500635_0006395_325_948 | 191 |
| 199 | 3300053122 | Ga0500608_020716 | Ga0500608_020716_298_936 | 191 |
| 200 | 3300053123 | Ga0500614_005399 | Ga0500614_005399_1954_2580 | 191 |
| 201 | 3300053137 | Ga0500561_0118970 | Ga0500561_0118970_135_761 | 191 |
| 202 | iso_pu_bacteria | 2852623160 | 2852625863 | 191 |
| 203 | iso_pu_bacteria | 2884933994 | 2884935613 | 191 |
| 204 | iso_pu_bacteria | 2977232053 | 2977235419 | 191 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4m1b-assembly2.cif.gz_B | structural determination of ba0150, a polysaccharide deacetylase from bacillus anthracis | 0.9133 | 2 | 188 |
| 2c1i-assembly1.cif.gz_A | structure of streptococcus pneumoniae peptidoglycan deacetylase (sppgda) d 275 n mutant. | 0.9096 | 7 | 189 |
| 7y51-assembly1.cif.gz_A-2 | acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant | 0.8989 | 11 | 188 |
| 2c1g-assembly1.cif.gz_A | structure of streptococcus pneumoniae peptidoglycan deacetylase (sppgda) | 0.8966 | 7 | 188 |
| 4m1b-assembly2.cif.gz_B | structural determination of ba0150, a polysaccharide deacetylase from bacillus anthracis | 0.8906 | 2 | 188 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4l1gD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.9293 | 2 | 189 | 3.20.20.370 |
| 4m1bB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.9133 | 2 | 188 | 3.20.20.370 |
| 4l1gD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.9106 | 2 | 189 | 3.20.20.370 |
| 2c1iA03 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.9093 | 12 | 189 | 3.20.20.370 |
| af_O53444_35_232_3.20.20.370 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase | 0.8943 | 11 | 189 | 3.20.20.370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1N7DGT5-F1-model_v4 | deleted | 0.9981 | 1 | 191 |
|
| AF-A0A1N7DGT5-F1-model_v4 | deleted | 0.9929 | 1 | 191 |
|
| AF-A0A519Y3Z5-F1-model_v4 | Polysaccharide deacetylase family protein | 0.9915 | 29 | 190 |
GO:0005975
GO:0016020 GO:0016810 |
| AF-A0A522YP35-F1-model_v4 | deleted | 0.9899 | 2 | 191 |
|
| AF-A0A7X7URR1-F1-model_v4 | Polysaccharide deacetylase family protein | 0.9875 | 11 | 190 |
GO:0005975
GO:0016020 GO:0016810 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar