F312211

General Info

Members Datasets Scaffolds Average Seq Length
204 127 195 208

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100018785|Ga0070663_1000187852
Length 213
Sequence MYLVKTPWLLKKLYPTLVWNLNRTERCIFLTFDDGPIPIVTPFVLKNLKQYDAKGTFFCIGDNVKKHPDIFEDVKAGGHAIGNHTFNHLKGWKTQDDVYMQNFLQCNDILQTETSLFRPPYGRIKRNQIKLLKAQKPDLQIIMWDVLSGDFDMSLSPEKCLQHVIRHTENGSIVVFHDSLKAFNRLEYVLPRALEYWSNEGYSFAPLPPEGGV

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2738541302 Pedobacter sp. CF074 Isolate Unclassified
3 2739367663 Pedobacter sp. YR510 Isolate Unclassified
4 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
5 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
6 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
7 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
8 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
9 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
95 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
102 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
108 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
118 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
123 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
124 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
125 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
126 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
127 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.61
Metatranscriptomes 0.98
Isolates 4.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.75
Nodule 0
Rhizoplane 0
Rhizosphere 79.41
Stem 0
Stem Tuber 0
Unclassified 7.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1007536 3300001904 Unclassified 1828
2 JGI24737J22298_10028071 3300001990 Bacteria 1771
3 JGI25162J39368_1001918 3300002737 Bacteria 9527
4 JGI25165J46597_1000621 3300003214 Bacteria 29774
5 rootH2_10000984 3300003320 Bacteria 89440
6 rootH1_10004576 3300003323 Bacteria 68064
7 rootH1_10012648 3300003323 Bacteria 5940
8 rootH1_10209256 3300003323 Bacteria 2609
9 Ga0055536_1000004 3300003781 Bacteria 411108
10 Ga0055530_10001351 3300003791 Bacteria 18306
11 Ga0055531_10008124 3300003794 Bacteria 5591
12 Ga0058863_11763624 3300004799 Bacteria 1346
13 Ga0058862_12856551 3300004803 Bacteria 1837
14 Ga0065714_10005700 3300005288 Bacteria 5071
15 Ga0065714_10104485 3300005288 Bacteria 1584
16 Ga0065714_10195273 3300005288 Bacteria 913
17 Ga0065704_10000431 3300005289 Bacteria 21291
18 Ga0070658_10000041 3300005327 Bacteria 134208
19 Ga0070658_10047178 3300005327 Bacteria 3486
20 Ga0070683_100002666 3300005329 Bacteria 14261
21 Ga0070680_100303050 3300005336 Bacteria 1355
22 Ga0070682_100508260 3300005337 Unclassified 935
23 Ga0070660_100276753 3300005339 Bacteria 1373
24 Ga0070659_100006881 3300005366 Bacteria 8236
25 Ga0070659_100255194 3300005366 Bacteria 1454
26 Ga0070711_100432609 3300005439 Bacteria 1074
27 Ga0070663_100018785 3300005455 Bacteria 4541
28 Ga0070662_100000053 3300005457 Bacteria 61062
29 Ga0070681_10024356 3300005458 Bacteria 6093
30 Ga0070679_100124163 3300005530 Bacteria 2565
31 Ga0068853_100023767 3300005539 Bacteria 5135
32 Ga0070665_100000096 3300005548 Bacteria 166864
33 Ga0068855_100000014 3300005563 Bacteria 232720
34 Ga0068855_100000185 3300005563 Bacteria 79849
35 Ga0068855_100008233 3300005563 Bacteria 12602
36 Ga0068855_100038751 3300005563 Bacteria 5661
37 Ga0068855_100508777 3300005563 Bacteria 1308
38 Ga0068855_100744349 3300005563 Bacteria 1046
39 Ga0068857_100038927 3300005577 Bacteria 4210
40 Ga0068856_100000095 3300005614 Bacteria 84075
41 Ga0068856_100031589 3300005614 Bacteria 5182
42 Ga0068856_100684677 3300005614 Bacteria 1046
43 Ga0068870_10052314 3300005840 Bacteria 2165
44 Ga0075366_10000557 3300006195 Bacteria 17406
45 Ga0075366_10012879 3300006195 Bacteria 4754
46 Ga0075366_10023952 3300006195 Bacteria 3558
47 Ga0075370_10115791 3300006353 Bacteria 1558
48 Ga0105240_10001738 3300009093 Bacteria 36787
49 Ga0105240_10033048 3300009093 Bacteria 6688
50 Ga0105240_10104520 3300009093 Bacteria 3439
51 Ga0105240_10309314 3300009093 Bacteria 1805
52 Ga0105240_10328206 3300009093 Bacteria 1742
53 Ga0105240_10647089 3300009093 Bacteria 1159
54 Ga0105245_11007801 3300009098 Bacteria 877
55 Ga0105241_10118660 3300009174 Unclassified 2127
56 Ga0105241_10269620 3300009174 Bacteria 1450
57 Ga0105241_10297851 3300009174 Bacteria 1383
58 Ga0105237_10001525 3300009545 Bacteria 30379
59 Ga0105249_10555527 3300009553 Bacteria 1199
60 Ga0105239_10000955 3300010375 Bacteria 40720
61 Ga0105239_10002923 3300010375 Bacteria 21328
62 Ga0105246_10151888 3300011119 Bacteria 1754
63 Ga0157373_10000087 3300013100 Bacteria 80308
64 Ga0157373_10001269 3300013100 Bacteria 19287
65 Ga0157373_10001448 3300013100 Bacteria 18133
66 Ga0157373_10008242 3300013100 Bacteria 7747
67 Ga0157373_10075817 3300013100 Bacteria 2373
68 Ga0157371_10000041 3300013102 Bacteria 203957
69 Ga0157371_10000164 3300013102 Bacteria 96408
70 Ga0157371_10000779 3300013102 Bacteria 36655
71 Ga0157371_10047478 3300013102 Bacteria 3053
72 Ga0157370_10026418 3300013104 Bacteria 5734
73 Ga0157370_10062540 3300013104 Bacteria 3530
74 Ga0157370_10118125 3300013104 Unclassified 2477
75 Ga0157370_10421202 3300013104 Bacteria 1228
76 Ga0157369_10000494 3300013105 Bacteria 52196
77 Ga0157369_10029946 3300013105 Bacteria 6009
78 Ga0157369_10229668 3300013105 Bacteria 1940
79 Ga0157369_10235768 3300013105 Bacteria 1912
80 Ga0157374_10006487 3300013296 Bacteria 9932
81 Ga0157374_10013284 3300013296 Bacteria 7184
82 Ga0157374_10148631 3300013296 Bacteria 2277
83 Ga0157378_10018031 3300013297 Bacteria 6198
84 Ga0163162_10000005 3300013306 Bacteria 447195
85 Ga0163162_10032845 3300013306 Bacteria 5154
86 Ga0163162_10088781 3300013306 Bacteria 3171
87 Ga0163162_10504132 3300013306 Bacteria 1341
88 Ga0157372_10000042 3300013307 Bacteria 157651
89 Ga0157372_10025700 3300013307 Bacteria 6405
90 Ga0157372_10031098 3300013307 Bacteria 5844
91 Ga0157372_10036263 3300013307 Bacteria 5434
92 Ga0182008_10012463 3300014497 Bacteria 4487
93 Ga0182008_10037079 3300014497 Unclassified 2440
94 Ga0182008_10039082 3300014497 Bacteria 2372
95 Ga0182006_1008020 3300015261 Bacteria 4798
96 Ga0182007_10004108 3300015262 Bacteria 6690
97 Ga0182007_10030825 3300015262 Bacteria 1830
98 Ga0163161_10017964 3300017792 Bacteria 4958
99 Ga0207427_100376 3300025231 Bacteria 27182
100 Ga0207427_111165 3300025231 Bacteria 918
101 Ga0209437_100048 3300025233 Bacteria 405107
102 Ga0209026_1002092 3300025250 Bacteria 7853
103 Ga0209026_1003388 3300025250 Bacteria 5260
104 Ga0209026_1007586 3300025250 Bacteria 2409
105 Ga0209233_1000029 3300025261 Bacteria 641642
106 Ga0209233_1015827 3300025261 Bacteria 2090
107 Ga0209676_1000009 3300025292 Bacteria 981719
108 Ga0209050_1000048 3300025298 Bacteria 371553
109 Ga0209257_1000005 3300025304 Bacteria 1592528
110 Ga0207647_10000752 3300025904 Bacteria 25389
111 Ga0207647_10001922 3300025904 Bacteria 15883
112 Ga0207705_10000068 3300025909 Bacteria 134316
113 Ga0207705_10032302 3300025909 Bacteria 3740
114 Ga0207654_10032315 3300025911 Bacteria 2891
115 Ga0207654_10216528 3300025911 Bacteria 1268
116 Ga0207695_10000183 3300025913 Bacteria 181350
117 Ga0207695_10012050 3300025913 Bacteria 10396
118 Ga0207695_10059533 3300025913 Bacteria 3960
119 Ga0207695_10308272 3300025913 Bacteria 1473
120 Ga0207695_10482710 3300025913 Bacteria 1121
121 Ga0207671_10001824 3300025914 Bacteria 23769
122 Ga0207671_10185711 3300025914 Bacteria 1619
123 Ga0207663_10356303 3300025916 Bacteria 1109
124 Ga0207657_10019650 3300025919 Bacteria 6406
125 Ga0207657_10252568 3300025919 Bacteria 1405
126 Ga0207657_10535619 3300025919 Bacteria 916
127 Ga0207652_10170560 3300025921 Bacteria 1952
128 Ga0207644_10388222 3300025931 Unclassified 1139
129 Ga0207690_10053624 3300025932 Bacteria 2707
130 Ga0207706_10000444 3300025933 Bacteria 44162
131 Ga0207686_10111956 3300025934 Bacteria 1843
132 Ga0207661_10002571 3300025944 Bacteria 12496
133 Ga0207667_10000049 3300025949 Bacteria 235027
134 Ga0207667_10000204 3300025949 Bacteria 84991
135 Ga0207667_10088371 3300025949 Bacteria 3205
136 Ga0207667_10559668 3300025949 Bacteria 1156
137 Ga0207712_10460219 3300025961 Bacteria 1080
138 Ga0207639_10007578 3300026041 Bacteria 7404
139 Ga0207639_10376710 3300026041 Bacteria 1273
140 Ga0207678_10112115 3300026067 Bacteria 2327
141 Ga0207702_10000699 3300026078 Bacteria 36199
142 Ga0207702_10601651 3300026078 Bacteria 1079
143 Ga0207674_10051242 3300026116 Bacteria 4213
144 Ga0268266_10000032 3300028379 Bacteria 395079
145 Ga0307515_10001308 3300028794 Bacteria 56577
146 Ga0307515_10014632 3300028794 Bacteria 14524
147 Ga0265338_10133546 3300028800 Bacteria 1955
148 Ga0265327_10093780 3300031251 Bacteria 1460
149 Ga0307509_10054222 3300031507 Bacteria 4270
150 Ga0307412_10000049 3300031911 Bacteria 151588
151 Ga0307414_10010153 3300032004 Bacteria 5448
152 Ga0307414_10206121 3300032004 Bacteria 1603
153 Ga0307507_10000099 3300033179 Bacteria 139532
154 Ga0373941_0007007 3300035115 Bacteria 2740
155 Ga0395899_0000017 3300037312 Bacteria 440179
156 Ga0395899_0000591 3300037312 Bacteria 38186
157 Ga0395899_0032027 3300037312 Bacteria 3950
158 Ga0395900_0006061 3300037418 Bacteria 12607
159 Ga0395905_0000169 3300037471 Bacteria 106579
160 Ga0395901_0090970 3300038443 Bacteria 3194
161 Ga0436361_1214551 3300039447 Bacteria 7839
162 Ga0451851_0104922 3300041507 Bacteria 1451
163 Ga0439448_0014140 3300042005 Bacteria 2405
164 Ga0466961_0015455 3300044693 Bacteria 4899
165 Ga0466959_0054203 3300045049 Bacteria 2931
166 Ga0466959_0056144 3300045049 Bacteria 2874
167 Ga0495629_0228633 3300046459 Bacteria 1282
168 Ga0495650_0042978 3300046471 Bacteria 1921
169 Ga0495585_0000241 3300046492 Bacteria 56727
170 Ga0495607_0323255 3300046501 Bacteria 719
171 Ga0495648_0088734 3300046524 Bacteria 1737
172 Ga0495642_0085589 3300046528 Bacteria 1331
173 Ga0495609_0013139 3300046538 Bacteria 3915
174 Ga0495633_0000006 3300046558 Bacteria 326774
175 Ga0495633_0067136 3300046558 Bacteria 1675
176 Ga0495668_0000054 3300046616 Bacteria 203960
177 Ga0495625_0000355 3300046660 Bacteria 69806
178 Ga0495625_0000548 3300046660 Bacteria 55064
179 Ga0495625_0048694 3300046660 Bacteria 3050
180 Ga0495661_0007422 3300046665 Bacteria 7644
181 Ga0495658_0246996 3300046683 Bacteria 1122
182 Ga0495670_0218033 3300046691 Bacteria 1013
183 Ga0495677_0113267 3300047445 Bacteria 1032
184 Ga0495686_0002085 3300047472 Bacteria 19661
185 Ga0495686_0053774 3300047472 Bacteria 2523
186 Ga0495682_0066237 3300049460 Bacteria 1302
187 nmdc:mga0k408_245_c1 3300050493 Bacteria 29347
188 nmdc:mga0k408_4726_c1 3300050493 Bacteria 7212
189 nmdc:mga0k408_794_c1 3300050493 Bacteria 17412
190 nmdc:mga07m45_171130_c1 3300050496 Bacteria 1262
191 Ga0500635_0006395 3300053080 Bacteria 3144
192 Ga0500608_020716 3300053122 Bacteria 3029
193 Ga0500614_005399 3300053123 Bacteria 2682
194 Ga0500561_0118970 3300053137 Bacteria 805
195 Ga0500622_0004845 3300053156 Bacteria 8257

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046558 Ga0495633_0067136 Ga0495633_0067136_182_868 182
2 3300003794 Ga0055531_10008124 Ga0055531_100081242 186
3 3300005337 Ga0070682_100508260 Ga0070682_1005082602 186
4 3300013104 Ga0157370_10118125 Ga0157370_101181252 186
5 3300025304 Ga0209257_1000005 Ga0209257_1000005756 186
6 3300003323 rootH1_10209256 rootH1_102092563 189
7 3300003781 Ga0055536_1000004 Ga0055536_1000004191 189
8 3300003791 Ga0055530_10001351 Ga0055530_1000135116 189
9 3300005288 Ga0065714_10104485 Ga0065714_101044851 189
10 3300005288 Ga0065714_10195273 Ga0065714_101952731 189
11 3300005289 Ga0065704_10000431 Ga0065704_100004313 189
12 3300005329 Ga0070683_100002666 Ga0070683_1000026667 189
13 3300005336 Ga0070680_100303050 Ga0070680_1003030501 189
14 3300005614 Ga0068856_100000095 Ga0068856_10000009548 189
15 3300006195 Ga0075366_10000557 Ga0075366_100005576 189
16 3300006195 Ga0075366_10012879 Ga0075366_100128792 189
17 3300006195 Ga0075366_10023952 Ga0075366_100239523 189
18 3300006353 Ga0075370_10115791 Ga0075370_101157912 189
19 3300009093 Ga0105240_10309314 Ga0105240_103093142 189
20 3300009093 Ga0105240_10328206 Ga0105240_103282062 189
21 3300009174 Ga0105241_10297851 Ga0105241_102978511 189
22 3300009545 Ga0105237_10001525 Ga0105237_1000152514 189
23 3300013100 Ga0157373_10000087 Ga0157373_1000008761 189
24 3300013100 Ga0157373_10001269 Ga0157373_1000126916 189
25 3300013100 Ga0157373_10008242 Ga0157373_100082424 189
26 3300013102 Ga0157371_10000041 Ga0157371_1000004180 189
27 3300013104 Ga0157370_10026418 Ga0157370_100264183 189
28 3300013104 Ga0157370_10421202 Ga0157370_104212022 189
29 3300013105 Ga0157369_10029946 Ga0157369_100299466 189
30 3300013307 Ga0157372_10031098 Ga0157372_100310984 189
31 3300014497 Ga0182008_10012463 Ga0182008_100124631 189
32 3300014497 Ga0182008_10037079 Ga0182008_100370791 189
33 3300014497 Ga0182008_10039082 Ga0182008_100390822 189
34 3300015261 Ga0182006_1008020 Ga0182006_10080202 189
35 3300015262 Ga0182007_10004108 Ga0182007_100041086 189
36 3300015262 Ga0182007_10030825 Ga0182007_100308252 189
37 3300017792 Ga0163161_10017964 Ga0163161_100179645 189
38 3300025250 Ga0209026_1003388 Ga0209026_10033882 189
39 3300025250 Ga0209026_1007586 Ga0209026_10075862 189
40 3300025292 Ga0209676_1000009 Ga0209676_1000009363 189
41 3300025298 Ga0209050_1000048 Ga0209050_1000048159 189
42 3300025911 Ga0207654_10216528 Ga0207654_102165282 189
43 3300025913 Ga0207695_10482710 Ga0207695_104827102 189
44 3300025914 Ga0207671_10001824 Ga0207671_1000182419 189
45 3300025916 Ga0207663_10356303 Ga0207663_103563031 189
46 3300025934 Ga0207686_10111956 Ga0207686_101119562 189
47 3300025944 Ga0207661_10002571 Ga0207661_100025714 189
48 3300026078 Ga0207702_10000699 Ga0207702_1000069926 189
49 3300031911 Ga0307412_10000049 Ga0307412_1000004925 189
50 3300032004 Ga0307414_10010153 Ga0307414_100101532 189
51 3300032004 Ga0307414_10206121 Ga0307414_102061212 189
52 3300035115 Ga0373941_0007007 Ga0373941_0007007_286_903 189
53 3300037312 Ga0395899_0000017 Ga0395899_0000017_340600_341217 189
54 3300037312 Ga0395899_0032027 Ga0395899_0032027_552_1172 189
55 3300037418 Ga0395900_0006061 Ga0395900_0006061_3311_3931 189
56 3300037471 Ga0395905_0000169 Ga0395905_0000169_41389_42009 189
57 3300046471 Ga0495650_0042978 Ga0495650_0042978_599_1216 189
58 3300046501 Ga0495607_0323255 Ga0495607_0323255_35_652 189
59 3300046660 Ga0495625_0000548 Ga0495625_0000548_53289_53906 189
60 3300050493 nmdc:mga0k408_245_c1 nmdc:mga0k408_245_c1_24904_25521 189
61 3300050493 nmdc:mga0k408_4726_c1 nmdc:mga0k408_4726_c1_5652_6269 189
62 3300050493 nmdc:mga0k408_794_c1 nmdc:mga0k408_794_c1_5737_6354 189
63 3300050496 nmdc:mga07m45_171130_c1 nmdc:mga07m45_171130_c1_481_1098 189
64 3300053156 Ga0500622_0004845 Ga0500622_0004845_3821_4438 189
65 iso_pu_bacteria 2585427687 2586211081 189
66 iso_pu_bacteria 2738541302 2738854470 189
67 iso_pu_bacteria 2739367663 2739646938 189
68 iso_pu_bacteria 2852627209 2852629159 189
69 iso_pu_bacteria 2857627736 2857631391 189
70 iso_pu_bacteria 2945997725 2945998995 189
71 3300004799 Ga0058863_11763624 Ga0058863_117636242 190
72 3300004803 Ga0058862_12856551 Ga0058862_128565512 190
73 3300005327 Ga0070658_10000041 Ga0070658_1000004123 190
74 3300005458 Ga0070681_10024356 Ga0070681_100243566 190
75 3300005530 Ga0070679_100124163 Ga0070679_1001241633 190
76 3300005539 Ga0068853_100023767 Ga0068853_1000237672 190
77 3300005563 Ga0068855_100000185 Ga0068855_10000018551 190
78 3300005563 Ga0068855_100008233 Ga0068855_10000823313 190
79 3300005563 Ga0068855_100038751 Ga0068855_1000387513 190
80 3300005840 Ga0068870_10052314 Ga0068870_100523142 190
81 3300009093 Ga0105240_10001738 Ga0105240_1000173835 190
82 3300009098 Ga0105245_11007801 Ga0105245_110078012 190
83 3300010375 Ga0105239_10000955 Ga0105239_1000095513 190
84 3300010375 Ga0105239_10002923 Ga0105239_100029238 190
85 3300013296 Ga0157374_10006487 Ga0157374_100064872 190
86 3300013296 Ga0157374_10148631 Ga0157374_101486312 190
87 3300013297 Ga0157378_10018031 Ga0157378_100180314 190
88 3300025909 Ga0207705_10000068 Ga0207705_10000068101 190
89 3300025911 Ga0207654_10032315 Ga0207654_100323153 190
90 3300025913 Ga0207695_10000183 Ga0207695_10000183118 190
91 3300025919 Ga0207657_10019650 Ga0207657_100196504 190
92 3300025921 Ga0207652_10170560 Ga0207652_101705602 190
93 3300025931 Ga0207644_10388222 Ga0207644_103882222 190
94 3300025949 Ga0207667_10000204 Ga0207667_1000020455 190
95 3300025949 Ga0207667_10088371 Ga0207667_100883713 190
96 3300026041 Ga0207639_10376710 Ga0207639_103767102 190
97 3300028800 Ga0265338_10133546 Ga0265338_101335462 190
98 3300039447 Ga0436361_1214551 Ga0436361_1214551_6359_6979 190
99 3300045049 Ga0466959_0056144 Ga0466959_0056144_2006_2626 190
100 3300046528 Ga0495642_0085589 Ga0495642_0085589_204_824 190
101 3300047445 Ga0495677_0113267 Ga0495677_0113267_112_732 190
102 3300047472 Ga0495686_0002085 Ga0495686_0002085_13919_14542 190
103 3300001904 JGI24736J21556_1007536 JGI24736J21556_10075362 191
104 3300001990 JGI24737J22298_10028071 JGI24737J22298_100280712 191
105 3300002737 JGI25162J39368_1001918 JGI25162J39368_10019182 191
106 3300003214 JGI25165J46597_1000621 JGI25165J46597_10006219 191
107 3300003320 rootH2_10000984 rootH2_1000098431 191
108 3300003323 rootH1_10004576 rootH1_1000457659 191
109 3300003323 rootH1_10012648 rootH1_100126484 191
110 3300005288 Ga0065714_10005700 Ga0065714_100057002 191
111 3300005327 Ga0070658_10047178 Ga0070658_100471782 191
112 3300005339 Ga0070660_100276753 Ga0070660_1002767532 191
113 3300005366 Ga0070659_100006881 Ga0070659_1000068814 191
114 3300005366 Ga0070659_100255194 Ga0070659_1002551941 191
115 3300005439 Ga0070711_100432609 Ga0070711_1004326091 191
116 3300005455 Ga0070663_100018785 Ga0070663_1000187852 191
117 3300005457 Ga0070662_100000053 Ga0070662_10000005332 191
118 3300005548 Ga0070665_100000096 Ga0070665_10000009690 191
119 3300005563 Ga0068855_100000014 Ga0068855_1000000148 191
120 3300005563 Ga0068855_100508777 Ga0068855_1005087772 191
121 3300005563 Ga0068855_100744349 Ga0068855_1007443492 191
122 3300005577 Ga0068857_100038927 Ga0068857_1000389274 191
123 3300005614 Ga0068856_100031589 Ga0068856_1000315895 191
124 3300005614 Ga0068856_100684677 Ga0068856_1006846771 191
125 3300009093 Ga0105240_10033048 Ga0105240_100330484 191
126 3300009093 Ga0105240_10104520 Ga0105240_101045202 191
127 3300009093 Ga0105240_10647089 Ga0105240_106470891 191
128 3300009174 Ga0105241_10118660 Ga0105241_101186602 191
129 3300009174 Ga0105241_10269620 Ga0105241_102696202 191
130 3300009553 Ga0105249_10555527 Ga0105249_105555271 191
131 3300011119 Ga0105246_10151888 Ga0105246_101518882 191
132 3300013100 Ga0157373_10001448 Ga0157373_100014483 191
133 3300013100 Ga0157373_10075817 Ga0157373_100758172 191
134 3300013102 Ga0157371_10000164 Ga0157371_1000016417 191
135 3300013102 Ga0157371_10000779 Ga0157371_1000077926 191
136 3300013102 Ga0157371_10047478 Ga0157371_100474783 191
137 3300013104 Ga0157370_10062540 Ga0157370_100625403 191
138 3300013105 Ga0157369_10000494 Ga0157369_1000049439 191
139 3300013105 Ga0157369_10229668 Ga0157369_102296682 191
140 3300013105 Ga0157369_10235768 Ga0157369_102357682 191
141 3300013296 Ga0157374_10013284 Ga0157374_100132843 191
142 3300013306 Ga0163162_10000005 Ga0163162_10000005215 191
143 3300013306 Ga0163162_10032845 Ga0163162_100328455 191
144 3300013306 Ga0163162_10088781 Ga0163162_100887812 191
145 3300013306 Ga0163162_10504132 Ga0163162_105041321 191
146 3300013307 Ga0157372_10000042 Ga0157372_1000004249 191
147 3300013307 Ga0157372_10025700 Ga0157372_100257004 191
148 3300013307 Ga0157372_10036263 Ga0157372_100362632 191
149 3300025231 Ga0207427_100376 Ga0207427_10037611 191
150 3300025231 Ga0207427_111165 Ga0207427_1111651 191
151 3300025233 Ga0209437_100048 Ga0209437_100048135 191
152 3300025250 Ga0209026_1002092 Ga0209026_10020924 191
153 3300025261 Ga0209233_1000029 Ga0209233_1000029242 191
154 3300025261 Ga0209233_1015827 Ga0209233_10158273 191
155 3300025904 Ga0207647_10000752 Ga0207647_1000075215 191
156 3300025904 Ga0207647_10001922 Ga0207647_100019229 191
157 3300025909 Ga0207705_10032302 Ga0207705_100323022 191
158 3300025913 Ga0207695_10012050 Ga0207695_100120503 191
159 3300025913 Ga0207695_10059533 Ga0207695_100595332 191
160 3300025913 Ga0207695_10308272 Ga0207695_103082722 191
161 3300025914 Ga0207671_10185711 Ga0207671_101857111 191
162 3300025919 Ga0207657_10252568 Ga0207657_102525681 191
163 3300025919 Ga0207657_10535619 Ga0207657_105356191 191
164 3300025932 Ga0207690_10053624 Ga0207690_100536243 191
165 3300025933 Ga0207706_10000444 Ga0207706_100004448 191
166 3300025949 Ga0207667_10000049 Ga0207667_100000497 191
167 3300025949 Ga0207667_10559668 Ga0207667_105596682 191
168 3300025961 Ga0207712_10460219 Ga0207712_104602191 191
169 3300026041 Ga0207639_10007578 Ga0207639_100075787 191
170 3300026067 Ga0207678_10112115 Ga0207678_101121152 191
171 3300026078 Ga0207702_10601651 Ga0207702_106016512 191
172 3300026116 Ga0207674_10051242 Ga0207674_100512424 191
173 3300028379 Ga0268266_10000032 Ga0268266_100000326 191
174 3300028794 Ga0307515_10001308 Ga0307515_1000130849 191
175 3300028794 Ga0307515_10014632 Ga0307515_100146322 191
176 3300031251 Ga0265327_10093780 Ga0265327_100937801 191
177 3300031507 Ga0307509_10054222 Ga0307509_100542223 191
178 3300033179 Ga0307507_10000099 Ga0307507_10000099102 191
179 3300037312 Ga0395899_0000591 Ga0395899_0000591_24141_24782 191
180 3300038443 Ga0395901_0090970 Ga0395901_0090970_1756_2418 191
181 3300041507 Ga0451851_0104922 Ga0451851_0104922_767_1393 191
182 3300042005 Ga0439448_0014140 Ga0439448_0014140_1187_1813 191
183 3300044693 Ga0466961_0015455 Ga0466961_0015455_2638_3276 191
184 3300045049 Ga0466959_0054203 Ga0466959_0054203_551_1189 191
185 3300046459 Ga0495629_0228633 Ga0495629_0228633_89_715 191
186 3300046492 Ga0495585_0000241 Ga0495585_0000241_55965_56591 191
187 3300046524 Ga0495648_0088734 Ga0495648_0088734_291_917 191
188 3300046538 Ga0495609_0013139 Ga0495609_0013139_96_722 191
189 3300046558 Ga0495633_0000006 Ga0495633_0000006_42368_42994 191
190 3300046616 Ga0495668_0000054 Ga0495668_0000054_203198_203824 191
191 3300046660 Ga0495625_0000355 Ga0495625_0000355_137_763 191
192 3300046660 Ga0495625_0048694 Ga0495625_0048694_680_1315 191
193 3300046665 Ga0495661_0007422 Ga0495661_0007422_5588_6211 191
194 3300046683 Ga0495658_0246996 Ga0495658_0246996_372_998 191
195 3300046691 Ga0495670_0218033 Ga0495670_0218033_190_816 191
196 3300047472 Ga0495686_0053774 Ga0495686_0053774_1853_2491 191
197 3300049460 Ga0495682_0066237 Ga0495682_0066237_582_1208 191
198 3300053080 Ga0500635_0006395 Ga0500635_0006395_325_948 191
199 3300053122 Ga0500608_020716 Ga0500608_020716_298_936 191
200 3300053123 Ga0500614_005399 Ga0500614_005399_1954_2580 191
201 3300053137 Ga0500561_0118970 Ga0500561_0118970_135_761 191
202 iso_pu_bacteria 2852623160 2852625863 191
203 iso_pu_bacteria 2884933994 2884935613 191
204 iso_pu_bacteria 2977232053 2977235419 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

20

137

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m1b-assembly2.cif.gz_B structural determination of ba0150, a polysaccharide deacetylase from bacillus anthracis 0.9133 2 188
2c1i-assembly1.cif.gz_A structure of streptococcus pneumoniae peptidoglycan deacetylase (sppgda) d 275 n mutant. 0.9096 7 189
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.8989 11 188
2c1g-assembly1.cif.gz_A structure of streptococcus pneumoniae peptidoglycan deacetylase (sppgda) 0.8966 7 188
4m1b-assembly2.cif.gz_B structural determination of ba0150, a polysaccharide deacetylase from bacillus anthracis 0.8906 2 188
ID Description Score Start End Superfamily
4l1gD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9293 2 189 3.20.20.370
4m1bB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9133 2 188 3.20.20.370
4l1gD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9106 2 189 3.20.20.370
2c1iA03 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9093 12 189 3.20.20.370
af_O53444_35_232_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8943 11 189 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A1N7DGT5-F1-model_v4 deleted 0.9981 1 191
AF-A0A1N7DGT5-F1-model_v4 deleted 0.9929 1 191
AF-A0A519Y3Z5-F1-model_v4 Polysaccharide deacetylase family protein 0.9915 29 190 GO:0005975
GO:0016020
GO:0016810
AF-A0A522YP35-F1-model_v4 deleted 0.9899 2 191
AF-A0A7X7URR1-F1-model_v4 Polysaccharide deacetylase family protein 0.9875 11 190 GO:0005975
GO:0016020
GO:0016810

Feature Viewer

pLDDT pTM Quality
97.23 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map