F312175

General Info

Members Datasets Scaffolds Average Seq Length
204 156 408 136

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10003581|Ga0070709_100035816
Length 155
Sequence MAGGKPEAPRRASGIVAAHPSTTVQTMKKTAGAKSPSELISARIAELGDWRGKTLAHVRKLIKAADPKVVEEWKWRGVPVWSDGGIICTGESYKAVVKLTFAKGAKLKDPKHLFNSSLEGNLRRAIDLHEGDKLNETAFKALIRDAVALNTAAKK

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
88 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
89 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
124 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
125 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
137 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
138 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
139 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
140 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
141 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
142 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
143 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
144 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
145 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
146 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
147 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
148 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
149 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
150 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
151 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
152 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
153 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
154 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
155 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
156 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.57
Metatranscriptomes 0.49
Isolates 2.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.84
Nodule 0.49
Rhizoplane 1.96
Rhizosphere 77.94
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10003581 3300005434 Bacteria 8343
2 Ga0070680_100087206 3300005336 Bacteria 2581
3 Ga0070682_100000886 3300005337 Bacteria 17470
4 Ga0070661_100014083 3300005344 Bacteria 5630
5 Ga0070671_100134056 3300005355 Bacteria 2087
6 Ga0070714_100051934 3300005435 Bacteria 3496
7 Ga0070714_100752649 3300005435 Bacteria 942
8 Ga0070714_101070214 3300005435 Bacteria 786
9 Ga0070713_100000004 3300005436 Bacteria 220768
10 Ga0070713_100208141 3300005436 Bacteria 1770
11 Ga0070711_100346831 3300005439 Bacteria 1193
12 Ga0070700_100003349 3300005441 Bacteria 8267
13 Ga0070708_100318577 3300005445 Bacteria 1465
14 Ga0070663_100517306 3300005455 Bacteria 993
15 Ga0070663_101975920 3300005455 Bacteria 525
16 Ga0070681_10206975 3300005458 Bacteria 1879
17 Ga0068867_100062533 3300005459 Bacteria 2766
18 Ga0070685_10127066 3300005466 Bacteria 1590
19 Ga0070679_100062032 3300005530 Bacteria 3726
20 Ga0070679_100136159 3300005530 Bacteria 2437
21 Ga0070697_100088642 3300005536 Bacteria 2555
22 Ga0070697_100552745 3300005536 Bacteria 1009
23 Ga0068853_100005813 3300005539 Bacteria 9715
24 Ga0068853_100117971 3300005539 Bacteria 2364
25 Ga0070695_100121804 3300005545 Bacteria 1786
26 Ga0070693_100797244 3300005547 Bacteria 700
27 Ga0068855_101135039 3300005563 Bacteria 815
28 Ga0068855_101499248 3300005563 Bacteria 692
29 Ga0070664_100500210 3300005564 Bacteria 1120
30 Ga0068857_100002847 3300005577 Bacteria 14220
31 Ga0068854_100000001 3300005578 Bacteria 608908
32 Ga0068856_100005941 3300005614 Bacteria 12015
33 Ga0068856_100007908 3300005614 Bacteria 10386
34 Ga0068856_100186730 3300005614 Bacteria 2087
35 Ga0068856_100391871 3300005614 Bacteria 1408
36 Ga0068852_100003166 3300005616 Bacteria 11479
37 Ga0068851_10041657 3300005834 Bacteria 2309
38 Ga0068863_100169557 3300005841 Bacteria 2093
39 Ga0068863_100824712 3300005841 Bacteria 926
40 Ga0081540_1007929 3300005983 Bacteria 7494
41 Ga0070717_10385004 3300006028 Bacteria 1258
42 Ga0070717_10412261 3300006028 Bacteria 1214
43 Ga0070712_100001090 3300006175 Bacteria 16367
44 Ga0097621_100215123 3300006237 Bacteria 1673
45 Ga0068871_100155357 3300006358 Bacteria 1953
46 Ga0068871_100313974 3300006358 Bacteria 1378
47 Ga0068871_102259267 3300006358 Bacteria 519
48 Ga0068865_100194665 3300006881 Bacteria 1570
49 Ga0068865_100410178 3300006881 Bacteria 1111
50 Ga0075436_100000187 3300006914 Bacteria 38576
51 Ga0075436_100351202 3300006914 Bacteria 1063
52 Ga0105244_10453117 3300009036 Bacteria 590
53 Ga0105240_10657029 3300009093 Bacteria 1148
54 Ga0105240_10998941 3300009093 Bacteria 895
55 Ga0105245_10514660 3300009098 Bacteria 1215
56 Ga0105241_10303310 3300009174 Bacteria 1371
57 Ga0105241_10488425 3300009174 Bacteria 1096
58 Ga0105242_10341031 3300009176 Bacteria 1381
59 Ga0105237_10001844 3300009545 Bacteria 27229
60 Ga0105237_11466745 3300009545 Bacteria 689
61 Ga0105238_10004713 3300009551 Bacteria 13480
62 Ga0105238_10226740 3300009551 Bacteria 1845
63 Ga0105238_11123869 3300009551 Bacteria 809
64 Ga0105239_10320394 3300010375 Bacteria 1748
65 Ga0105239_10412436 3300010375 Bacteria 1529
66 Ga0157373_10028658 3300013100 Bacteria 4017
67 Ga0157370_10017177 3300013104 Bacteria 7304
68 Ga0157369_11626612 3300013105 Bacteria 657
69 Ga0157374_10457951 3300013296 Bacteria 1277
70 Ga0157378_10446553 3300013297 Bacteria 1283
71 Ga0163162_11213225 3300013306 Bacteria 856
72 Ga0157372_10890732 3300013307 Bacteria 1033
73 Ga0157376_10759971 3300014969 Bacteria 979
74 Ga0182007_10018247 3300015262 Bacteria 2545
75 Ga0206356_10524432 3300020070 Bacteria 25986
76 Ga0213874_10023278 3300021377 Bacteria 1726
77 Ga0213874_10179136 3300021377 Bacteria 753
78 Ga0213876_10208466 3300021384 Bacteria 1039
79 Ga0213875_10000946 3300021388 Bacteria 20825
80 Ga0213875_10225849 3300021388 Bacteria 882
81 Ga0213871_10304356 3300021441 Bacteria 515
82 Ga0207656_10021508 3300025321 Bacteria 2579
83 Ga0207699_10009362 3300025906 Bacteria 4874
84 Ga0207699_10115229 3300025906 Bacteria 1729
85 Ga0207654_10576962 3300025911 Bacteria 801
86 Ga0207654_10581429 3300025911 Bacteria 798
87 Ga0207654_10693399 3300025911 Bacteria 731
88 Ga0207695_10464565 3300025913 Bacteria 1148
89 Ga0207693_10004086 3300025915 Bacteria 12400
90 Ga0207663_11388124 3300025916 Bacteria 566
91 Ga0207649_10012328 3300025920 Bacteria 4740
92 Ga0207649_10051018 3300025920 Bacteria 2561
93 Ga0207652_10171108 3300025921 Bacteria 1949
94 Ga0207652_10281013 3300025921 Bacteria 1502
95 Ga0207700_10000011 3300025928 Bacteria 266323
96 Ga0207700_10035647 3300025928 Bacteria 3585
97 Ga0207700_10489379 3300025928 Bacteria 1088
98 Ga0207664_10520066 3300025929 Bacteria 1066
99 Ga0207644_10359925 3300025931 Bacteria 1183
100 Ga0207704_10024466 3300025938 Bacteria 3276
101 Ga0207704_10079131 3300025938 Bacteria 2117
102 Ga0207661_10887800 3300025944 Bacteria 821
103 Ga0207679_10473887 3300025945 Bacteria 1113
104 Ga0207667_10098407 3300025949 Bacteria 3019
105 Ga0207640_10000005 3300025981 Bacteria 408618
106 Ga0207658_10477831 3300025986 Bacteria 1107
107 Ga0207677_11072228 3300026023 Bacteria 733
108 Ga0207678_10261203 3300026067 Bacteria 1484
109 Ga0207708_10007049 3300026075 Bacteria 8306
110 Ga0207702_10000164 3300026078 Bacteria 79231
111 Ga0207702_10010768 3300026078 Bacteria 7634
112 Ga0207702_10012346 3300026078 Bacteria 7111
113 Ga0207641_10591613 3300026088 Bacteria 1085
114 Ga0207648_10035527 3300026089 Bacteria 4390
115 Ga0207674_10000349 3300026116 Bacteria 59515
116 Ga0207698_11711923 3300026142 Bacteria 644
117 Ga0209981_1001280 3300027378 Bacteria 3191
118 Ga0210000_1007697 3300027462 Bacteria 1576
119 Ga0209983_1001668 3300027665 Bacteria 4921
120 Ga0209971_1146412 3300027682 Bacteria 582
121 Ga0268264_10345929 3300028381 Bacteria 1414
122 Ga0268264_11345726 3300028381 Bacteria 724
123 Ga0265337_1139105 3300028556 Bacteria 657
124 Ga0307517_10020500 3300028786 Bacteria 8416
125 Ga0265332_10303200 3300031238 Bacteria 659
126 Ga0265331_10086060 3300031250 Bacteria 1456
127 Ga0265327_10243987 3300031251 Bacteria 802
128 Ga0307508_10055126 3300031616 Bacteria 3523
129 Ga0265314_10070705 3300031711 Bacteria 2337
130 Ga0373929_0071123 3300035085 Bacteria 832
131 Ga0373935_0459166 3300035692 Bacteria 921
132 Ga0373933_0806394 3300035724 Bacteria 618
133 Ga0373937_0244656 3300036401 Bacteria 1690
134 Ga0373925_0446897 3300037068 Bacteria 1058
135 Ga0395899_0018718 3300037312 Bacteria 5263
136 Ga0395898_0000502 3300037466 Bacteria 76068
137 Ga0436364_0332885 3300037853 Bacteria 5807
138 Ga0436364_0911254 3300037853 Bacteria 5688
139 Ga0436364_1345588 3300037853 Bacteria 129670
140 Ga0436365_0400644 3300039437 Bacteria 1141
141 Ga0436360_0331726 3300039438 Bacteria 14000
142 Ga0436361_0430693 3300039447 Bacteria 786
143 Ga0436363_0479411 3300039450 Bacteria 683
144 Ga0436363_0590603 3300039450 Unclassified 1335
145 Ga0436363_0658788 3300039450 Bacteria 721
146 Ga0436363_0755709 3300039450 Bacteria 2744
147 Ga0436363_0939471 3300039450 Bacteria 521
148 Ga0436363_1327064 3300039450 Bacteria 1275
149 Ga0436363_1363076 3300039450 Bacteria 2806
150 Ga0436362_0411183 3300039453 Bacteria 534
151 Ga0436362_0486079 3300039453 Bacteria 514
152 Ga0436362_0668149 3300039453 Bacteria 570
153 Ga0466967_0585982 3300045976 Bacteria 1100
154 Ga0495590_0407668 3300046457 Bacteria 522
155 Ga0495629_0029186 3300046459 Bacteria 3913
156 Ga0495583_0177474 3300046506 Bacteria 873
157 Ga0495637_0092403 3300046520 Bacteria 1192
158 Ga0495643_0010352 3300046522 Bacteria 5743
159 Ga0495597_0022072 3300046542 Bacteria 2954
160 Ga0495622_0000427 3300046557 Bacteria 27809
161 Ga0495668_0132523 3300046616 Bacteria 1364
162 Ga0495613_0348830 3300046689 Bacteria 1017
163 Ga0495602_0225444 3300048088 Bacteria 1412
164 Ga0495602_0549695 3300048088 Bacteria 800
165 Ga0495614_0387530 3300048089 Bacteria 655
166 Ga0496105_1398824 3300048908 Bacteria 507
167 Ga0496110_0002962 3300048913 Bacteria 12872
168 Ga0496112_1560446 3300048915 Bacteria 574
169 Ga0496115_0000519 3300048918 Bacteria 29990
170 Ga0496117_0344052 3300048920 Bacteria 772
171 Ga0496119_0093713 3300048922 Bacteria 1700
172 Ga0496120_0054988 3300048923 Bacteria 2252
173 Ga0496123_0062496 3300048926 Bacteria 2385
174 Ga0496126_0573086 3300048929 Bacteria 893
175 Ga0495682_0022781 3300049460 Bacteria 2342
176 Ga0501076_0099989 3300049592 Bacteria 2337
177 Ga0501077_0040941 3300049593 Bacteria 2950
178 Ga0501081_0964132 3300049743 Bacteria 644
179 Ga0501044_0085015 3300049823 Bacteria 3197
180 nmdc:mga07m45_15694_c1 3300050496 Bacteria 4046
181 nmdc:mga0n895_174578_c1 3300050512 Bacteria 2180
182 nmdc:mga08x19_155_c1 3300050514 Bacteria 56249
183 nmdc:mga08x19_239581_c1 3300050514 Bacteria 1250
184 Ga0500651_0062730 3300053093 Bacteria 2320
185 Ga0500566_0009652 3300053094 Bacteria 5704
186 Ga0500569_005838 3300053109 Bacteria 2665
187 Ga0500595_001693 3300053119 Bacteria 11555
188 Ga0500608_002228 3300053122 Bacteria 6999
189 Ga0500614_000810 3300053123 Bacteria 7903
190 Ga0500590_083408 3300053148 Bacteria 1566
191 Ga0500619_051051 3300053154 Bacteria 1338
192 Ga0500620_014295 3300053155 Bacteria 2211
193 Ga0500638_065974 3300053162 Bacteria 1735
194 Ga0500639_323082 3300053163 Bacteria 564
195 Ga0500636_0034787 3300053177 Bacteria 2982
196 Ga0500637_0023583 3300053178 Bacteria 3367
197 Ga0500625_003760 3300053729 Bacteria 6064
198 Ga0500596_000833 3300053735 Bacteria 6111
199 2585280726 2582581308 Bacteria 7413247
200 2585326516 2582581315 Bacteria 7318924
201 2585531660 2585427527 Bacteria 7273426
202 2585551393 2585427530 Bacteria 7383882
203 2616306729 2615840626 Bacteria 7921970
204 2819638823 2818991453 Bacteria 7181617
205 Ga0070709_10003581
206 Ga0070680_100087206
207 Ga0070682_100000886
208 Ga0070661_100014083
209 Ga0070671_100134056
210 Ga0070714_100051934
211 Ga0070714_100752649
212 Ga0070714_101070214
213 Ga0070713_100000004
214 Ga0070713_100208141
215 Ga0070711_100346831
216 Ga0070700_100003349
217 Ga0070708_100318577
218 Ga0070663_100517306
219 Ga0070663_101975920
220 Ga0070681_10206975
221 Ga0068867_100062533
222 Ga0070685_10127066
223 Ga0070679_100062032
224 Ga0070679_100136159
225 Ga0070697_100088642
226 Ga0070697_100552745
227 Ga0068853_100005813
228 Ga0068853_100117971
229 Ga0070695_100121804
230 Ga0070693_100797244
231 Ga0068855_101135039
232 Ga0068855_101499248
233 Ga0070664_100500210
234 Ga0068857_100002847
235 Ga0068854_100000001
236 Ga0068856_100005941
237 Ga0068856_100007908
238 Ga0068856_100186730
239 Ga0068856_100391871
240 Ga0068852_100003166
241 Ga0068851_10041657
242 Ga0068863_100169557
243 Ga0068863_100824712
244 Ga0081540_1007929
245 Ga0070717_10385004
246 Ga0070717_10412261
247 Ga0070712_100001090
248 Ga0097621_100215123
249 Ga0068871_100155357
250 Ga0068871_100313974
251 Ga0068871_102259267
252 Ga0068865_100194665
253 Ga0068865_100410178
254 Ga0075436_100000187
255 Ga0075436_100351202
256 Ga0105244_10453117
257 Ga0105240_10657029
258 Ga0105240_10998941
259 Ga0105245_10514660
260 Ga0105241_10303310
261 Ga0105241_10488425
262 Ga0105242_10341031
263 Ga0105237_10001844
264 Ga0105237_11466745
265 Ga0105238_10004713
266 Ga0105238_10226740
267 Ga0105238_11123869
268 Ga0105239_10320394
269 Ga0105239_10412436
270 Ga0157373_10028658
271 Ga0157370_10017177
272 Ga0157369_11626612
273 Ga0157374_10457951
274 Ga0157378_10446553
275 Ga0163162_11213225
276 Ga0157372_10890732
277 Ga0157376_10759971
278 Ga0182007_10018247
279 Ga0206356_10524432
280 Ga0213874_10023278
281 Ga0213874_10179136
282 Ga0213876_10208466
283 Ga0213875_10000946
284 Ga0213875_10225849
285 Ga0213871_10304356
286 Ga0207656_10021508
287 Ga0207699_10009362
288 Ga0207699_10115229
289 Ga0207654_10576962
290 Ga0207654_10581429
291 Ga0207654_10693399
292 Ga0207695_10464565
293 Ga0207693_10004086
294 Ga0207663_11388124
295 Ga0207649_10012328
296 Ga0207649_10051018
297 Ga0207652_10171108
298 Ga0207652_10281013
299 Ga0207700_10000011
300 Ga0207700_10035647
301 Ga0207700_10489379
302 Ga0207664_10520066
303 Ga0207644_10359925
304 Ga0207704_10024466
305 Ga0207704_10079131
306 Ga0207661_10887800
307 Ga0207679_10473887
308 Ga0207667_10098407
309 Ga0207640_10000005
310 Ga0207658_10477831
311 Ga0207677_11072228
312 Ga0207678_10261203
313 Ga0207708_10007049
314 Ga0207702_10000164
315 Ga0207702_10010768
316 Ga0207702_10012346
317 Ga0207641_10591613
318 Ga0207648_10035527
319 Ga0207674_10000349
320 Ga0207698_11711923
321 Ga0209981_1001280
322 Ga0210000_1007697
323 Ga0209983_1001668
324 Ga0209971_1146412
325 Ga0268264_10345929
326 Ga0268264_11345726
327 Ga0265337_1139105
328 Ga0307517_10020500
329 Ga0265332_10303200
330 Ga0265331_10086060
331 Ga0265327_10243987
332 Ga0307508_10055126
333 Ga0265314_10070705
334 Ga0373929_0071123
335 Ga0373935_0459166
336 Ga0373933_0806394
337 Ga0373937_0244656
338 Ga0373925_0446897
339 Ga0395899_0018718
340 Ga0395898_0000502
341 Ga0436364_0332885
342 Ga0436364_0911254
343 Ga0436364_1345588
344 Ga0436365_0400644
345 Ga0436360_0331726
346 Ga0436361_0430693
347 Ga0436363_0479411
348 Ga0436363_0590603
349 Ga0436363_0658788
350 Ga0436363_0755709
351 Ga0436363_0939471
352 Ga0436363_1327064
353 Ga0436363_1363076
354 Ga0436362_0411183
355 Ga0436362_0486079
356 Ga0436362_0668149
357 Ga0466967_0585982
358 Ga0495590_0407668
359 Ga0495629_0029186
360 Ga0495583_0177474
361 Ga0495637_0092403
362 Ga0495643_0010352
363 Ga0495597_0022072
364 Ga0495622_0000427
365 Ga0495668_0132523
366 Ga0495613_0348830
367 Ga0495602_0225444
368 Ga0495602_0549695
369 Ga0495614_0387530
370 Ga0496105_1398824
371 Ga0496110_0002962
372 Ga0496112_1560446
373 Ga0496115_0000519
374 Ga0496117_0344052
375 Ga0496119_0093713
376 Ga0496120_0054988
377 Ga0496123_0062496
378 Ga0496126_0573086
379 Ga0495682_0022781
380 Ga0501076_0099989
381 Ga0501077_0040941
382 Ga0501081_0964132
383 Ga0501044_0085015
384 nmdc:mga07m45_15694_c1
385 nmdc:mga0n895_174578_c1
386 nmdc:mga08x19_155_c1
387 nmdc:mga08x19_239581_c1
388 Ga0500651_0062730
389 Ga0500566_0009652
390 Ga0500569_005838
391 Ga0500595_001693
392 Ga0500608_002228
393 Ga0500614_000810
394 Ga0500590_083408
395 Ga0500619_051051
396 Ga0500620_014295
397 Ga0500638_065974
398 Ga0500639_323082
399 Ga0500636_0034787
400 Ga0500637_0023583
401 Ga0500625_003760
402 Ga0500596_000833
403 2585280726
404 2585326516
405 2585531660
406 2585551393
407 2616306729
408 2819638823

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

51

147

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.7355 9 120
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7218 14 120
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6931 9 120
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.6337 35 126
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6316 14 120
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8376 14 122 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7981 14 122 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7115 14 118 3.90.1150.200
af_Q9M305_27_76_3.30.160.60 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.6932 40 58 3.30.160.60
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.658 14 118 3.90.1150.200
ID Description Score Start End GO Terms
AF-A0A1E4DJ85-F1-model_v4 deleted 0.9892 10 126
AF-A0A1Q3J442-F1-model_v4 deleted 0.9888 12 126
AF-A0A1S7P227-F1-model_v4 YdhG-like domain-containing protein 0.9858 9 126
AF-A0A349L252-F1-model_v4 YdhG-like domain-containing protein 0.9852 12 126
AF-A0A1X2DM13-F1-model_v4 YdhG-like domain-containing protein 0.9842 10 126

Map