F312108

General Info

Members Datasets Scaffolds Average Seq Length
204 168 408 265

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100010681|Ga0068869_1000106814
Length 282
Sequence MMAMGMHRPRKRYGQNFLVDRGIVAKILASIDPRPQDRVVEIGPGLGVLTEPLLERLQSLDVVEIDRDLAAVLAERFPPDHLRVHVGDALAFDFCALGSELRVVGNLPYNISTPLLFHLAASAQCLRDCHFMLQREVVQRMAAQPGGREYGRLTVMLQYRFQVEKLLRVPAGAFNPVPQVESAFVRLTPHRQLPSVAADEKLFAEVVRAAFTQRRKTLRNALRDHASADELSGLGIDPGLRPERLSVKEFVQIANAVTARNVNGGLGASGSGVLPASHARGR

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
79 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
89 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
90 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
91 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
93 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
103 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
108 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
163 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
164 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
165 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
168 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0.49
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.86
Nodule 0
Rhizoplane 0
Rhizosphere 90.69
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100010681 3300005334 Bacteria 5995
2 Ga0070689_100011086 3300005340 Bacteria 6447
3 Ga0070687_100129505 3300005343 Bacteria 1455
4 Ga0070669_100476860 3300005353 Bacteria 1032
5 Ga0070673_100010817 3300005364 Bacteria 6197
6 Ga0070688_100274848 3300005365 Bacteria 1208
7 Ga0070703_10154549 3300005406 Bacteria 865
8 Ga0070685_10158304 3300005466 Bacteria 1441
9 Ga0070698_100123173 3300005471 Bacteria 2551
10 Ga0070679_100079392 3300005530 Bacteria 3271
11 Ga0070672_100306485 3300005543 Bacteria 1347
12 Ga0070693_100004665 3300005547 Bacteria 6508
13 Ga0070665_100057676 3300005548 Bacteria 3893
14 Ga0070704_100081471 3300005549 Bacteria 2384
15 Ga0068855_100017636 3300005563 Bacteria 8584
16 Ga0068856_100520139 3300005614 Bacteria 1211
17 Ga0070702_100313266 3300005615 Bacteria 1090
18 Ga0068852_100018602 3300005616 Bacteria 5475
19 Ga0068859_100076633 3300005617 Bacteria 3385
20 Ga0068859_100297531 3300005617 Bacteria 1707
21 Ga0068864_100555459 3300005618 Bacteria 1110
22 Ga0068861_100018599 3300005719 Bacteria 4951
23 Ga0068858_100048523 3300005842 Bacteria 3933
24 Ga0075365_10063261 3300006038 Bacteria 2477
25 Ga0075363_100009552 3300006048 Bacteria 4563
26 Ga0075364_10169772 3300006051 Bacteria 1474
27 Ga0075367_10043871 3300006178 Bacteria 2619
28 Ga0075366_10087050 3300006195 Bacteria 1869
29 Ga0097621_100027386 3300006237 Bacteria 4481
30 Ga0075370_10060053 3300006353 Bacteria 2165
31 Ga0068871_100051660 3300006358 Bacteria 3328
32 Ga0075430_100320022 3300006846 Bacteria 1282
33 Ga0075431_100557242 3300006847 Bacteria 1133
34 Ga0068865_100034443 3300006881 Bacteria 3398
35 Ga0097620_100076635 3300006931 Bacteria 3385
36 Ga0097620_100297532 3300006931 Bacteria 1707
37 Ga0099794_10132287 3300007265 Bacteria 1260
38 Ga0105240_10069432 3300009093 Bacteria 4361
39 Ga0105240_10235868 3300009093 Bacteria 2123
40 Ga0111539_10085398 3300009094 Bacteria 3709
41 Ga0105245_10125397 3300009098 Bacteria 2403
42 Ga0105242_10440118 3300009176 Bacteria 1226
43 Ga0105248_10001876 3300009177 Bacteria 23307
44 Ga0105238_10056938 3300009551 Bacteria 3921
45 Ga0105238_10675083 3300009551 Bacteria 1044
46 Ga0105246_10209173 3300011119 Bacteria 1522
47 Ga0157369_10005296 3300013105 Bacteria 15032
48 Ga0157378_10041244 3300013297 Bacteria 4094
49 Ga0163162_10064137 3300013306 Bacteria 3718
50 Ga0157372_10003769 3300013307 Bacteria 16282
51 Ga0157375_10021453 3300013308 Bacteria 5924
52 Ga0157380_10238634 3300014326 Bacteria 1638
53 Ga0157379_10136479 3300014968 Bacteria 2210
54 Ga0157376_10024041 3300014969 Bacteria 4778
55 Ga0207643_10063396 3300025908 Bacteria 2113
56 Ga0207705_10073554 3300025909 Bacteria 2479
57 Ga0207695_10050017 3300025913 Bacteria 4400
58 Ga0207649_10172037 3300025920 Bacteria 1510
59 Ga0207652_10106068 3300025921 Bacteria 2487
60 Ga0207646_10006554 3300025922 Bacteria 12015
61 Ga0207687_10145290 3300025927 Bacteria 1804
62 Ga0207686_10388311 3300025934 Unclassified 1060
63 Ga0207670_10062020 3300025936 Bacteria 2553
64 Ga0207670_10300509 3300025936 Bacteria 1257
65 Ga0207704_10128406 3300025938 Bacteria 1750
66 Ga0207691_10191456 3300025940 Bacteria 1784
67 Ga0207711_10036637 3300025941 Bacteria 4163
68 Ga0207689_10038664 3300025942 Bacteria 3951
69 Ga0207667_10077282 3300025949 Bacteria 3453
70 Ga0207651_10283051 3300025960 Bacteria 1371
71 Ga0207677_10047790 3300026023 Bacteria 2876
72 Ga0207702_10270414 3300026078 Bacteria 1603
73 Ga0207641_10017227 3300026088 Bacteria 5913
74 Ga0207648_10128627 3300026089 Bacteria 2229
75 Ga0207648_10282181 3300026089 Bacteria 1485
76 Ga0207676_10509119 3300026095 Bacteria 1144
77 Ga0207675_100041980 3300026118 Bacteria 4270
78 Ga0207683_10285298 3300026121 Bacteria 1509
79 Ga0207698_10010169 3300026142 Bacteria 6029
80 Ga0207698_10134113 3300026142 Bacteria 2121
81 Ga0209813_10021275 3300027866 Bacteria 1822
82 Ga0268266_10179038 3300028379 Bacteria 1929
83 Ga0268264_10039750 3300028381 Bacteria 3886
84 Ga0265338_10040838 3300028800 Bacteria 4351
85 Ga0265324_10000018 3300029957 Bacteria 184238
86 Ga0265324_10000109 3300029957 Bacteria 65395
87 Ga0265324_10044525 3300029957 Bacteria 1530
88 Ga0307511_10000014 3300030521 Bacteria 127602
89 Ga0265328_10041212 3300031239 Bacteria 1700
90 Ga0265328_10046022 3300031239 Bacteria 1604
91 Ga0265325_10000035 3300031241 Bacteria 99051
92 Ga0265331_10009378 3300031250 Bacteria 5496
93 Ga0265331_10011874 3300031250 Bacteria 4749
94 Ga0265327_10000103 3300031251 Bacteria 185405
95 Ga0265327_10000583 3300031251 Bacteria 61267
96 Ga0265327_10001571 3300031251 Bacteria 27897
97 Ga0265327_10002839 3300031251 Bacteria 17481
98 Ga0265327_10007040 3300031251 Bacteria 8814
99 Ga0265327_10008132 3300031251 Bacteria 7894
100 Ga0265327_10031537 3300031251 Bacteria 2976
101 Ga0265316_10159593 3300031344 Bacteria 1686
102 Ga0265316_10293402 3300031344 Bacteria 1186
103 Ga0307408_100065777 3300031548 Bacteria 2660
104 Ga0316575_10100049 3300031665 Bacteria 1178
105 Ga0265314_10000134 3300031711 Bacteria 111395
106 Ga0265314_10028634 3300031711 Bacteria 4151
107 Ga0316576_10305596 3300031727 Bacteria 1188
108 Ga0316577_10033737 3300031733 Bacteria 2861
109 Ga0316583_10020002 3300032133 Bacteria 2399
110 Ga0316593_10059219 3300032168 Bacteria 1307
111 Ga0307507_10019511 3300033179 Bacteria 7632
112 Ga0373923_0011775 3300035111 Bacteria 3219
113 Ga0373936_0016426 3300035113 Bacteria 2847
114 Ga0373953_0009739 3300035117 Bacteria 3319
115 Ga0373954_0025549 3300035118 Bacteria 2701
116 Ga0373956_0019445 3300035119 Bacteria 2880
117 Ga0373957_0020165 3300035120 Bacteria 2353
118 Ga0316574_0012411 3300035398 Bacteria 4874
119 Ga0316574_0075094 3300035398 Bacteria 2140
120 Ga0373927_0028139 3300035695 Bacteria 3668
121 Ga0373933_0004130 3300035724 Bacteria 8002
122 Ga0316582_0006475 3300036647 Bacteria 6152
123 Ga0316582_0070975 3300036647 Bacteria 2254
124 Ga0316584_0177042 3300036712 Bacteria 1580
125 Ga0316584_0234804 3300036712 Bacteria 1344
126 Ga0373925_0171444 3300037068 Bacteria 1713
127 Ga0395900_0032576 3300037418 Bacteria 5360
128 Ga0395905_0617812 3300037471 Bacteria 986
129 Ga0400487_26580 3300039110 Bacteria 20695
130 Ga0439435_0036921 3300042436 Bacteria 1352
131 Ga0451577_0124120 3300042876 Bacteria 2314
132 Ga0451577_0238809 3300042876 Bacteria 1644
133 Ga0453684_0021721 3300044712 Bacteria 9569
134 Ga0453684_0125905 3300044712 Bacteria 3084
135 Ga0453684_0142732 3300044712 Bacteria 2856
136 Ga0453684_0907005 3300044712 Bacteria 943
137 Ga0466957_0003806 3300044842 Bacteria 8339
138 Ga0451576_0001321 3300045051 Bacteria 42891
139 Ga0451576_0005193 3300045051 Bacteria 16451
140 Ga0451576_0007109 3300045051 Bacteria 13518
141 Ga0451576_0236736 3300045051 Bacteria 1907
142 Ga0451576_0782078 3300045051 Bacteria 1002
143 Ga0495641_0065942 3300046461 Bacteria 1629
144 Ga0495651_0037498 3300046462 Bacteria 3773
145 Ga0495653_0208876 3300046463 Bacteria 1320
146 Ga0495582_0089745 3300046473 Bacteria 1713
147 Ga0495639_0016740 3300046475 Bacteria 3183
148 Ga0495662_0153672 3300046476 Bacteria 1133
149 Ga0495664_0034034 3300046477 Bacteria 2995
150 Ga0495594_0032130 3300046499 Bacteria 2848
151 Ga0495608_0158874 3300046511 Bacteria 1438
152 Ga0495628_0071065 3300046516 Bacteria 2713
153 Ga0495630_0004450 3300046517 Bacteria 9827
154 Ga0495665_0007399 3300046531 Bacteria 5938
155 Ga0495587_0006182 3300046536 Bacteria 7815
156 Ga0495621_0001943 3300046539 Bacteria 5441
157 Ga0495645_0157330 3300046543 Bacteria 1574
158 Ga0495657_0080362 3300046675 Bacteria 2110
159 Ga0495599_0066199 3300046678 Bacteria 2257
160 Ga0495647_0015101 3300046681 Bacteria 2700
161 Ga0495624_0070500 3300046690 Bacteria 2176
162 Ga0495600_0073129 3300046809 Bacteria 2238
163 Ga0495674_0029837 3300047319 Bacteria 4962
164 Ga0495675_0068399 3300047444 Bacteria 2243
165 Ga0495684_0018681 3300047471 Bacteria 5340
166 Ga0501036_0016428 3300049572 Bacteria 6181
167 Ga0501037_0023536 3300049573 Bacteria 4555
168 Ga0501038_0059982 3300049574 Bacteria 3257
169 Ga0501040_0007445 3300049576 Bacteria 7090
170 Ga0501041_0000960 3300049577 Bacteria 15698
171 Ga0501042_0009731 3300049578 Bacteria 6421
172 Ga0501042_0373001 3300049578 Bacteria 1033
173 Ga0501043_0295810 3300049579 Bacteria 1238
174 Ga0501046_0041056 3300049580 Bacteria 3693
175 Ga0501048_0030417 3300049582 Bacteria 3907
176 Ga0501068_0131206 3300049584 Bacteria 1567
177 Ga0501069_0110514 3300049585 Bacteria 1565
178 Ga0501071_0027953 3300049587 Bacteria 3970
179 Ga0501074_0255616 3300049590 Bacteria 1246
180 Ga0501075_0000411 3300049591 Bacteria 24982
181 Ga0501075_0041778 3300049591 Bacteria 3437
182 Ga0501076_0000404 3300049592 Bacteria 26953
183 Ga0501076_0026088 3300049592 Bacteria 4523
184 Ga0501079_0002789 3300049741 Bacteria 12734
185 Ga0501079_0342527 3300049741 Bacteria 1171
186 Ga0501080_0004156 3300049742 Bacteria 12836
187 Ga0501081_0000036 3300049743 Bacteria 50653
188 Ga0501081_0196586 3300049743 Bacteria 1462
189 Ga0501083_0113705 3300049744 Bacteria 1778
190 Ga0501280_000839 3300049776 Bacteria 6648
191 Ga0501035_0143741 3300049822 Bacteria 2073
192 Ga0501045_0028522 3300049824 Bacteria 4027
193 Ga0501045_0100583 3300049824 Bacteria 2140
194 nmdc:mga0k408_97718_c1 3300050493 Bacteria 1730
195 nmdc:mga04h51_53549_c1 3300050495 Bacteria 1362
196 nmdc:mga07m45_24775_c1 3300050496 Bacteria 3289
197 nmdc:mga0a205_302497_c1 3300050515 Bacteria 1472
198 nmdc:mga0sz30_22898_c1 3300050516 Bacteria 2538
199 Ga0500646_0001198 3300053090 Bacteria 6972
200 Ga0500655_003234 3300053133 Bacteria 2952
201 Ga0500636_0000417 3300053177 Bacteria 23409
202 Ga0501084_0026167 3300054114 Bacteria 4867
203 2894511519 2894510363 Bacteria 5121143
204 8001522634 8001522603 Bacteria 4726425
205 Ga0068869_100010681
206 Ga0070689_100011086
207 Ga0070687_100129505
208 Ga0070669_100476860
209 Ga0070673_100010817
210 Ga0070688_100274848
211 Ga0070703_10154549
212 Ga0070685_10158304
213 Ga0070698_100123173
214 Ga0070679_100079392
215 Ga0070672_100306485
216 Ga0070693_100004665
217 Ga0070665_100057676
218 Ga0070704_100081471
219 Ga0068855_100017636
220 Ga0068856_100520139
221 Ga0070702_100313266
222 Ga0068852_100018602
223 Ga0068859_100076633
224 Ga0068859_100297531
225 Ga0068864_100555459
226 Ga0068861_100018599
227 Ga0068858_100048523
228 Ga0075365_10063261
229 Ga0075363_100009552
230 Ga0075364_10169772
231 Ga0075367_10043871
232 Ga0075366_10087050
233 Ga0097621_100027386
234 Ga0075370_10060053
235 Ga0068871_100051660
236 Ga0075430_100320022
237 Ga0075431_100557242
238 Ga0068865_100034443
239 Ga0097620_100076635
240 Ga0097620_100297532
241 Ga0099794_10132287
242 Ga0105240_10069432
243 Ga0105240_10235868
244 Ga0111539_10085398
245 Ga0105245_10125397
246 Ga0105242_10440118
247 Ga0105248_10001876
248 Ga0105238_10056938
249 Ga0105238_10675083
250 Ga0105246_10209173
251 Ga0157369_10005296
252 Ga0157378_10041244
253 Ga0163162_10064137
254 Ga0157372_10003769
255 Ga0157375_10021453
256 Ga0157380_10238634
257 Ga0157379_10136479
258 Ga0157376_10024041
259 Ga0207643_10063396
260 Ga0207705_10073554
261 Ga0207695_10050017
262 Ga0207649_10172037
263 Ga0207652_10106068
264 Ga0207646_10006554
265 Ga0207687_10145290
266 Ga0207686_10388311
267 Ga0207670_10062020
268 Ga0207670_10300509
269 Ga0207704_10128406
270 Ga0207691_10191456
271 Ga0207711_10036637
272 Ga0207689_10038664
273 Ga0207667_10077282
274 Ga0207651_10283051
275 Ga0207677_10047790
276 Ga0207702_10270414
277 Ga0207641_10017227
278 Ga0207648_10128627
279 Ga0207648_10282181
280 Ga0207676_10509119
281 Ga0207675_100041980
282 Ga0207683_10285298
283 Ga0207698_10010169
284 Ga0207698_10134113
285 Ga0209813_10021275
286 Ga0268266_10179038
287 Ga0268264_10039750
288 Ga0265338_10040838
289 Ga0265324_10000018
290 Ga0265324_10000109
291 Ga0265324_10044525
292 Ga0307511_10000014
293 Ga0265328_10041212
294 Ga0265328_10046022
295 Ga0265325_10000035
296 Ga0265331_10009378
297 Ga0265331_10011874
298 Ga0265327_10000103
299 Ga0265327_10000583
300 Ga0265327_10001571
301 Ga0265327_10002839
302 Ga0265327_10007040
303 Ga0265327_10008132
304 Ga0265327_10031537
305 Ga0265316_10159593
306 Ga0265316_10293402
307 Ga0307408_100065777
308 Ga0316575_10100049
309 Ga0265314_10000134
310 Ga0265314_10028634
311 Ga0316576_10305596
312 Ga0316577_10033737
313 Ga0316583_10020002
314 Ga0316593_10059219
315 Ga0307507_10019511
316 Ga0373923_0011775
317 Ga0373936_0016426
318 Ga0373953_0009739
319 Ga0373954_0025549
320 Ga0373956_0019445
321 Ga0373957_0020165
322 Ga0316574_0012411
323 Ga0316574_0075094
324 Ga0373927_0028139
325 Ga0373933_0004130
326 Ga0316582_0006475
327 Ga0316582_0070975
328 Ga0316584_0177042
329 Ga0316584_0234804
330 Ga0373925_0171444
331 Ga0395900_0032576
332 Ga0395905_0617812
333 Ga0400487_26580
334 Ga0439435_0036921
335 Ga0451577_0124120
336 Ga0451577_0238809
337 Ga0453684_0021721
338 Ga0453684_0125905
339 Ga0453684_0142732
340 Ga0453684_0907005
341 Ga0466957_0003806
342 Ga0451576_0001321
343 Ga0451576_0005193
344 Ga0451576_0007109
345 Ga0451576_0236736
346 Ga0451576_0782078
347 Ga0495641_0065942
348 Ga0495651_0037498
349 Ga0495653_0208876
350 Ga0495582_0089745
351 Ga0495639_0016740
352 Ga0495662_0153672
353 Ga0495664_0034034
354 Ga0495594_0032130
355 Ga0495608_0158874
356 Ga0495628_0071065
357 Ga0495630_0004450
358 Ga0495665_0007399
359 Ga0495587_0006182
360 Ga0495621_0001943
361 Ga0495645_0157330
362 Ga0495657_0080362
363 Ga0495599_0066199
364 Ga0495647_0015101
365 Ga0495624_0070500
366 Ga0495600_0073129
367 Ga0495674_0029837
368 Ga0495675_0068399
369 Ga0495684_0018681
370 Ga0501036_0016428
371 Ga0501037_0023536
372 Ga0501038_0059982
373 Ga0501040_0007445
374 Ga0501041_0000960
375 Ga0501042_0009731
376 Ga0501042_0373001
377 Ga0501043_0295810
378 Ga0501046_0041056
379 Ga0501048_0030417
380 Ga0501068_0131206
381 Ga0501069_0110514
382 Ga0501071_0027953
383 Ga0501074_0255616
384 Ga0501075_0000411
385 Ga0501075_0041778
386 Ga0501076_0000404
387 Ga0501076_0026088
388 Ga0501079_0002789
389 Ga0501079_0342527
390 Ga0501080_0004156
391 Ga0501081_0000036
392 Ga0501081_0196586
393 Ga0501083_0113705
394 Ga0501280_000839
395 Ga0501035_0143741
396 Ga0501045_0028522
397 Ga0501045_0100583
398 nmdc:mga0k408_97718_c1
399 nmdc:mga04h51_53549_c1
400 nmdc:mga07m45_24775_c1
401 nmdc:mga0a205_302497_c1
402 nmdc:mga0sz30_22898_c1
403 Ga0500646_0001198
404 Ga0500655_003234
405 Ga0500636_0000417
406 Ga0501084_0026167
407 2894511519
408 8001522634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00398

RrnaAD

Ribosomal RNA adenine dimethylase

6

259

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o5h-assembly1.cif.gz_V ribosomal methyltransferase ksga bound to small ribosomal subunit 0.9555 16 260
6ifs-assembly2.cif.gz_B ksga from bacillus subtilis 168 0.939 17 259
3tpz-assembly1.cif.gz_A 2.1 angstrom crystal structure of the l114p mutant of e. coli ksga 0.937 13 259
3tqs-assembly2.cif.gz_B structure of the dimethyladenosine transferase (ksga) from coxiella burnetii 0.9338 15 257
6ifv-assembly2.cif.gz_B c-terminal truncated ksga from bacillus subtilis 168 0.9316 12 190
ID Description Score Start End Superfamily
1qyrA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;rRNA adenine dimethylase, C-terminal domain 0.971 194 259 1.10.8.100
3tqsA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;rRNA adenine dimethylase, C-terminal domain 0.9699 196 257 1.10.8.100
1qyrB02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;rRNA adenine dimethylase, C-terminal domain 0.9606 194 259 1.10.8.100
1qyrB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.936 15 193 3.40.50.150
1qyrA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;rRNA adenine dimethylase, C-terminal domain 0.9299 194 259 1.10.8.100
ID Description Score Start End GO Terms
AF-A0A645J2R0-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) 0.9739 141 258 GO:0003723
GO:0005829
GO:0052908
AF-A0A7H4PAD4-F1-model_v4 Dimethyladenosine transferase (EC 2.1.1.182) 0.9679 117 259 GO:0003723
GO:0005829
GO:0052908
AF-A0A4R4GC92-F1-model_v4 deleted 0.9609 128 193
AF-A0A7R8WYI9-F1-model_v4 rRNA adenine N(6)-methyltransferase (EC 2.1.1.-) 0.959 28 199 GO:0000179
GO:0003723
GO:0005829
AF-A0A645J2R0-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) 0.958 141 258 GO:0003723
GO:0005829
GO:0052908

Map