F311740

General Info

Members Datasets Scaffolds Average Seq Length
203 117 203 353

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0070036|Ga0501034_0070036_1653_2759
Length 368
Sequence MSPQSKLECGRLEIEMNMKKVAIIGASGYSGEELVRLLLHHPDVELSAVTSRQSAGQTLAQVFPKFANHPRAKALRFSEPKVEVLAKQADVVFLALPHGVAAEYAVPLIQAGCIVIDLSADFRVKSAEVYKEFYAHEHPAPDLLGKSVYGLPEVYREQIKKATLIASPGCYPTSILLPTIPLLKAGLVKPTGIIADSMSGVSGAGRKAELDYLFVECNESVRPYGVPKHRHLSEIEQELSFAANAQVTIQFTPHLIPVNRGILTTLYLAPEKHFSTEAEAKTLGEQIAACYAKAYGNEPFVRVLEGKALPDTKNVTGTNVIEIAWRLDPRTGRLIVMSAEDNLVKGASGQAVQSMNILCGFAETAGLV

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
46 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
47 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
48 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
49 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
52 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
55 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
56 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
57 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
63 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
64 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
65 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
66 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
67 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
68 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
69 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
70 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
88 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
100 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
101 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
102 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
103 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.97
Rhizosphere 97.54
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10088002 3300003320 Bacteria 4505
2 Ga0070690_100001049 3300005330 Bacteria 14154
3 Ga0070690_100051876 3300005330 Bacteria 2620
4 Ga0068868_100319073 3300005338 Bacteria 1323
5 Ga0070689_100045822 3300005340 Bacteria 3368
6 Ga0070689_100093511 3300005340 Bacteria 2373
7 Ga0070691_10099653 3300005341 Bacteria 1442
8 Ga0070688_100039462 3300005365 Unclassified 2889
9 Ga0070714_100023108 3300005435 Bacteria 5105
10 Ga0070714_100207439 3300005435 Bacteria 1795
11 Ga0070711_100001752 3300005439 Bacteria 12061
12 Ga0070705_100024243 3300005440 Bacteria 3272
13 Ga0070694_100153541 3300005444 Unclassified 1683
14 Ga0070679_100133074 3300005530 Bacteria 2468
15 Ga0070686_100001709 3300005544 Bacteria 12286
16 Ga0070686_100005053 3300005544 Bacteria 7283
17 Ga0070695_100133026 3300005545 Bacteria 1716
18 Ga0070704_100007179 3300005549 Bacteria 6622
19 Ga0068855_100039316 3300005563 Bacteria 5616
20 Ga0068857_100036119 3300005577 Bacteria 4378
21 Ga0068857_100243212 3300005577 Bacteria 1648
22 Ga0068856_100000080 3300005614 Bacteria 90679
23 Ga0068856_100043660 3300005614 Bacteria 4410
24 Ga0068859_100026250 3300005617 Bacteria 5841
25 Ga0068859_100218996 3300005617 Bacteria 1991
26 Ga0068863_100184530 3300005841 Bacteria 2003
27 Ga0097621_100109103 3300006237 Bacteria 2337
28 Ga0075428_100000468 3300006844 Bacteria 40623
29 Ga0075430_100187692 3300006846 Unclassified 1719
30 Ga0075431_100060540 3300006847 Bacteria 3906
31 Ga0075429_100078722 3300006880 Bacteria 2873
32 Ga0075429_100132495 3300006880 Bacteria 2181
33 Ga0068865_100048166 3300006881 Bacteria 2932
34 Ga0097620_100026250 3300006931 Bacteria 5841
35 Ga0097620_100218975 3300006931 Bacteria 1991
36 Ga0097620_100289500 3300006931 Unclassified 1731
37 Ga0099794_10104414 3300007265 Bacteria 1416
38 Ga0105240_10001811 3300009093 Bacteria 35983
39 Ga0105240_10085367 3300009093 Bacteria 3867
40 Ga0105240_10398457 3300009093 Unclassified 1551
41 Ga0111539_10002816 3300009094 Bacteria 23104
42 Ga0111539_10208629 3300009094 Bacteria 2276
43 Ga0111539_10216664 3300009094 Bacteria 2230
44 Ga0111539_10563305 3300009094 Unclassified 1327
45 Ga0105245_10305517 3300009098 Unclassified 1562
46 Ga0105238_10100212 3300009551 Bacteria 2880
47 Ga0105238_10206737 3300009551 Unclassified 1939
48 Ga0157370_10059741 3300013104 Bacteria 3622
49 Ga0157375_10000016 3300013308 Bacteria 295002
50 Ga0163163_10000096 3300014325 Bacteria 93313
51 Ga0207695_10183318 3300025913 Unclassified 2014
52 Ga0207695_10235824 3300025913 Bacteria 1732
53 Ga0207663_10001649 3300025916 Bacteria 10525
54 Ga0207652_10117934 3300025921 Bacteria 2358
55 Ga0207694_10087580 3300025924 Bacteria 2453
56 Ga0207694_10105409 3300025924 Unclassified 2238
57 Ga0207670_10064709 3300025936 Bacteria 2507
58 Ga0207670_10194534 3300025936 Bacteria 1537
59 Ga0207667_10045269 3300025949 Bacteria 4661
60 Ga0207667_10080620 3300025949 Bacteria 3372
61 Ga0207667_10223943 3300025949 Bacteria 1927
62 Ga0207708_10220114 3300026075 Bacteria 1521
63 Ga0207702_10001107 3300026078 Bacteria 27560
64 Ga0207641_10411630 3300026088 Bacteria 1300
65 Ga0207674_10047449 3300026116 Bacteria 4402
66 Ga0207674_10096595 3300026116 Bacteria 2939
67 Ga0265337_1002727 3300028556 Bacteria 7927
68 Ga0265337_1005591 3300028556 Unclassified 4966
69 Ga0265337_1006549 3300028556 Bacteria 4475
70 Ga0265337_1014337 3300028556 Bacteria 2629
71 Ga0265337_1026981 3300028556 Bacteria 1735
72 Ga0265319_1000004 3300028563 Bacteria 305085
73 Ga0265318_10025058 3300028577 Bacteria 2360
74 Ga0265323_10000140 3300028653 Bacteria 41860
75 Ga0265323_10042627 3300028653 Bacteria 1642
76 Ga0265336_10000493 3300028666 Bacteria 23115
77 Ga0265338_10000084 3300028800 Bacteria 175415
78 Ga0265338_10000616 3300028800 Bacteria 62218
79 Ga0265338_10001074 3300028800 Bacteria 45350
80 Ga0265338_10001675 3300028800 Bacteria 35207
81 Ga0265338_10001829 3300028800 Bacteria 33349
82 Ga0265338_10002019 3300028800 Bacteria 31479
83 Ga0265338_10005250 3300028800 Bacteria 16981
84 Ga0265338_10006138 3300028800 Bacteria 15421
85 Ga0265338_10011262 3300028800 Bacteria 10354
86 Ga0265338_10019398 3300028800 Bacteria 7216
87 Ga0265338_10021119 3300028800 Bacteria 6806
88 Ga0265338_10021297 3300028800 Bacteria 6767
89 Ga0265338_10030886 3300028800 Bacteria 5264
90 Ga0265338_10034110 3300028800 Unclassified 4926
91 Ga0265338_10078264 3300028800 Bacteria 2790
92 Ga0265324_10000064 3300029957 Bacteria 91244
93 Ga0265324_10000188 3300029957 Bacteria 47481
94 Ga0265324_10010515 3300029957 Bacteria 3562
95 Ga0265324_10018332 3300029957 Bacteria 2533
96 Ga0265332_10012134 3300031238 Unclassified 3823
97 Ga0265320_10000551 3300031240 Bacteria 28889
98 Ga0265320_10001912 3300031240 Bacteria 14716
99 Ga0265320_10009719 3300031240 Bacteria 5773
100 Ga0265325_10039526 3300031241 Unclassified 2484
101 Ga0265329_10008168 3300031242 Bacteria 3990
102 Ga0265329_10057339 3300031242 Bacteria 1235
103 Ga0265340_10001551 3300031247 Bacteria 13183
104 Ga0265340_10014133 3300031247 Bacteria 4179
105 Ga0265339_10037622 3300031249 Bacteria 2704
106 Ga0265327_10001590 3300031251 Bacteria 27697
107 Ga0265327_10009506 3300031251 Bacteria 7002
108 Ga0265316_10015764 3300031344 Bacteria 6591
109 Ga0265316_10019404 3300031344 Bacteria 5818
110 Ga0265316_10023632 3300031344 Bacteria 5160
111 Ga0265316_10028671 3300031344 Bacteria 4589
112 Ga0265316_10192049 3300031344 Bacteria 1516
113 Ga0265313_10000385 3300031595 Bacteria 47503
114 Ga0265314_10000088 3300031711 Bacteria 138315
115 Ga0265314_10028902 3300031711 Bacteria 4126
116 Ga0373930_0013595 3300034816 Bacteria 1503
117 Ga0373928_0000018 3300035084 Bacteria 28140
118 Ga0373949_0003211 3300035090 Bacteria 3956
119 Ga0373951_0020264 3300035091 Bacteria 1521
120 Ga0373932_0000004 3300035112 Bacteria 412176
121 Ga0373953_0089524 3300035117 Unclassified 1286
122 Ga0373954_0007892 3300035118 Bacteria 4662
123 Ga0373956_0015355 3300035119 Bacteria 3205
124 Ga0373962_0000015 3300035242 Bacteria 48259
125 Ga0373931_0000009 3300035691 Bacteria 349854
126 Ga0373927_0003007 3300035695 Bacteria 12237
127 Ga0373927_0036178 3300035695 Bacteria 3211
128 Ga0373937_0006478 3300036401 Bacteria 10103
129 Ga0373937_0074312 3300036401 Bacteria 3136
130 Ga0373937_0226058 3300036401 Bacteria 1762
131 Ga0373925_0000522 3300037068 Bacteria 38320
132 Ga0373925_0014275 3300037068 Bacteria 5747
133 Ga0373925_0164143 3300037068 Bacteria 1751
134 Ga0395900_0105522 3300037418 Bacteria 2895
135 Ga0395905_0054252 3300037471 Bacteria 3751
136 Ga0451577_0009096 3300042876 Bacteria 9586
137 Ga0451577_0011209 3300042876 Bacteria 8499
138 Ga0451577_0032935 3300042876 Bacteria 4671
139 Ga0451577_0121709 3300042876 Unclassified 2338
140 Ga0453684_0000532 3300044712 Bacteria 145255
141 Ga0453684_0010165 3300044712 Bacteria 16149
142 Ga0453684_0021422 3300044712 Bacteria 9657
143 Ga0453684_0295182 3300044712 Bacteria 1844
144 Ga0453684_0623154 3300044712 Unclassified 1180
145 Ga0451576_0049711 3300045051 Bacteria 4401
146 Ga0451576_0195948 3300045051 Bacteria 2110
147 Ga0451576_0227527 3300045051 Bacteria 1947
148 Ga0451576_0261315 3300045051 Unclassified 1810
149 Ga0495641_0035665 3300046461 Bacteria 2342
150 Ga0495651_0228207 3300046462 Bacteria 1284
151 Ga0495582_0074341 3300046473 Bacteria 1881
152 Ga0495662_0005683 3300046476 Bacteria 6234
153 Ga0495608_0199335 3300046511 Bacteria 1262
154 Ga0495618_0000968 3300046514 Bacteria 19743
155 Ga0495630_0000022 3300046517 Bacteria 172932
156 Ga0495630_0025129 3300046517 Bacteria 4403
157 Ga0495666_0007144 3300046526 Bacteria 5610
158 Ga0495665_0074084 3300046531 Bacteria 1793
159 Ga0495640_0017451 3300046533 Bacteria 5351
160 Ga0495640_0044332 3300046533 Bacteria 3093
161 Ga0495640_0095282 3300046533 Bacteria 1959
162 Ga0495586_0000222 3300046535 Bacteria 37841
163 Ga0495586_0000350 3300046535 Bacteria 28890
164 Ga0495586_0002332 3300046535 Bacteria 10326
165 Ga0495586_0006634 3300046535 Bacteria 6180
166 Ga0495586_0066681 3300046535 Bacteria 1962
167 Ga0495645_0110695 3300046543 Bacteria 1943
168 Ga0495622_0005382 3300046557 Bacteria 5944
169 Ga0495667_0151116 3300046559 Bacteria 1495
170 Ga0495634_0002583 3300046642 Bacteria 14935
171 Ga0495634_0046952 3300046642 Bacteria 2912
172 Ga0495599_0074867 3300046678 Bacteria 2114
173 Ga0495613_0002225 3300046689 Bacteria 14688
174 Ga0495613_0007800 3300046689 Bacteria 7966
175 Ga0495613_0079715 3300046689 Bacteria 2381
176 Ga0495624_0012647 3300046690 Bacteria 5764
177 Ga0495674_0000401 3300047319 Bacteria 38833
178 Ga0495674_0029271 3300047319 Bacteria 5018
179 Ga0495674_0090628 3300047319 Bacteria 2612
180 Ga0495676_0126686 3300047321 Bacteria 1850
181 Ga0495680_0003659 3300047322 Bacteria 15005
182 Ga0495675_0017939 3300047444 Bacteria 4488
183 Ga0495684_0007937 3300047471 Bacteria 8210
184 Ga0495614_0055035 3300048089 Bacteria 1707
185 Ga0496106_0060206 3300048909 Bacteria 2878
186 Ga0496107_0068305 3300048910 Bacteria 2579
187 Ga0496115_0003105 3300048918 Bacteria 11937
188 Ga0496115_0205937 3300048918 Unclassified 1625
189 Ga0501031_0005653 3300049568 Bacteria 8146
190 Ga0501032_0045327 3300049569 Bacteria 2974
191 Ga0501033_0001002 3300049570 Bacteria 25704
192 Ga0501033_0268922 3300049570 Unclassified 1205
193 Ga0501034_0070036 3300049571 Bacteria 3519
194 Ga0501037_0130937 3300049573 Bacteria 1798
195 Ga0501039_0188385 3300049575 Bacteria 1623
196 Ga0501043_0126994 3300049579 Bacteria 2000
197 Ga0501035_0021292 3300049822 Bacteria 5961
198 Ga0501035_0033088 3300049822 Bacteria 4701
199 Ga0501044_0000611 3300049823 Bacteria 43362
200 Ga0501044_0052560 3300049823 Bacteria 4197
201 nmdc:mga09592_121355_c1 3300050508 Bacteria 2245
202 nmdc:mga08y16_13869_c1 3300050511 Bacteria 8479
203 nmdc:mga08y16_65259_c1 3300050511 Bacteria 3800

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_100060540 Ga0075431_1000605402 334
2 3300006880 Ga0075429_100078722 Ga0075429_1000787222 334
3 3300006931 Ga0097620_100289500 Ga0097620_1002895003 341
4 3300006881 Ga0068865_100048166 Ga0068865_1000481662 342
5 3300026075 Ga0207708_10220114 Ga0207708_102201142 342
6 3300031238 Ga0265332_10012134 Ga0265332_100121344 342
7 3300031242 Ga0265329_10008168 Ga0265329_100081683 342
8 3300031711 Ga0265314_10000088 Ga0265314_1000008882 342
9 3300005435 Ga0070714_100207439 Ga0070714_1002074393 345
10 3300028556 Ga0265337_1005591 Ga0265337_10055915 345
11 3300028563 Ga0265319_1000004 Ga0265319_1000004281 345
12 3300028577 Ga0265318_10025058 Ga0265318_100250581 345
13 3300028800 Ga0265338_10034110 Ga0265338_100341102 345
14 3300031251 Ga0265327_10009506 Ga0265327_100095066 345
15 3300031344 Ga0265316_10023632 Ga0265316_100236323 345
16 3300031595 Ga0265313_10000385 Ga0265313_1000038517 345
17 3300031711 Ga0265314_10028902 Ga0265314_100289025 345
18 3300005544 Ga0070686_100001709 Ga0070686_1000017095 346
19 3300009093 Ga0105240_10001811 Ga0105240_100018115 346
20 3300028800 Ga0265338_10019398 Ga0265338_100193983 346
21 3300031247 Ga0265340_10001551 Ga0265340_100015515 346
22 3300031344 Ga0265316_10192049 Ga0265316_101920491 346
23 3300049570 Ga0501033_0268922 Ga0501033_0268922_20_1066 346
24 3300044712 Ga0453684_0010165 Ga0453684_0010165_10518_11561 347
25 3300009098 Ga0105245_10305517 Ga0105245_103055172 348
26 3300037068 Ga0373925_0164143 Ga0373925_0164143_311_1366 349
27 3300005330 Ga0070690_100051876 Ga0070690_1000518764 351
28 3300005340 Ga0070689_100045822 Ga0070689_1000458221 351
29 3300005365 Ga0070688_100039462 Ga0070688_1000394623 351
30 3300005440 Ga0070705_100024243 Ga0070705_1000242432 351
31 3300005444 Ga0070694_100153541 Ga0070694_1001535411 351
32 3300005544 Ga0070686_100005053 Ga0070686_1000050534 351
33 3300005549 Ga0070704_100007179 Ga0070704_1000071794 351
34 3300005841 Ga0068863_100184530 Ga0068863_1001845303 351
35 3300006880 Ga0075429_100132495 Ga0075429_1001324952 351
36 3300009094 Ga0111539_10208629 Ga0111539_102086291 351
37 3300009094 Ga0111539_10216664 Ga0111539_102166643 351
38 3300025913 Ga0207695_10183318 Ga0207695_101833182 351
39 3300025936 Ga0207670_10064709 Ga0207670_100647092 351
40 3300025936 Ga0207670_10194534 Ga0207670_101945342 351
41 3300026088 Ga0207641_10411630 Ga0207641_104116301 351
42 3300031247 Ga0265340_10014133 Ga0265340_100141332 351
43 3300044712 Ga0453684_0295182 Ga0453684_0295182_88_1143 351
44 3300045051 Ga0451576_0227527 Ga0451576_0227527_575_1633 351
45 3300046461 Ga0495641_0035665 Ga0495641_0035665_143_1198 351
46 3300046462 Ga0495651_0228207 Ga0495651_0228207_47_1102 351
47 3300046531 Ga0495665_0074084 Ga0495665_0074084_155_1234 351
48 3300046535 Ga0495586_0002332 Ga0495586_0002332_4158_5213 351
49 3300046689 Ga0495613_0007800 Ga0495613_0007800_1343_2398 351
50 3300047319 Ga0495674_0029271 Ga0495674_0029271_155_1234 351
51 3300047321 Ga0495676_0126686 Ga0495676_0126686_711_1766 351
52 3300048089 Ga0495614_0055035 Ga0495614_0055035_45_1100 351
53 3300048918 Ga0496115_0205937 Ga0496115_0205937_410_1465 351
54 3300050508 nmdc:mga09592_121355_c1 nmdc:mga09592_121355_c1_964_2019 351
55 3300005530 Ga0070679_100133074 Ga0070679_1001330742 352
56 3300005545 Ga0070695_100133026 Ga0070695_1001330262 352
57 3300005577 Ga0068857_100243212 Ga0068857_1002432122 352
58 3300006237 Ga0097621_100109103 Ga0097621_1001091032 352
59 3300009093 Ga0105240_10398457 Ga0105240_103984572 352
60 3300025921 Ga0207652_10117934 Ga0207652_101179344 352
61 3300025924 Ga0207694_10087580 Ga0207694_100875803 352
62 3300028800 Ga0265338_10002019 Ga0265338_1000201911 352
63 3300028800 Ga0265338_10006138 Ga0265338_1000613813 352
64 3300028800 Ga0265338_10021297 Ga0265338_100212977 352
65 3300045051 Ga0451576_0049711 Ga0451576_0049711_1031_2089 352
66 3300045051 Ga0451576_0261315 Ga0451576_0261315_309_1373 352
67 3300046473 Ga0495582_0074341 Ga0495582_0074341_683_1741 352
68 3300046517 Ga0495630_0000022 Ga0495630_0000022_22816_23874 352
69 3300046526 Ga0495666_0007144 Ga0495666_0007144_651_1709 352
70 3300046533 Ga0495640_0095282 Ga0495640_0095282_742_1800 352
71 3300046535 Ga0495586_0000222 Ga0495586_0000222_14653_15711 352
72 3300046642 Ga0495634_0046952 Ga0495634_0046952_899_1957 352
73 3300046689 Ga0495613_0079715 Ga0495613_0079715_613_1671 352
74 3300047319 Ga0495674_0000401 Ga0495674_0000401_29563_30621 352
75 3300048918 Ga0496115_0003105 Ga0496115_0003105_6410_7468 352
76 3300003320 rootH2_10088002 rootH2_100880023 353
77 3300005330 Ga0070690_100001049 Ga0070690_1000010496 353
78 3300005338 Ga0068868_100319073 Ga0068868_1003190732 353
79 3300005340 Ga0070689_100093511 Ga0070689_1000935113 353
80 3300005341 Ga0070691_10099653 Ga0070691_100996532 353
81 3300005435 Ga0070714_100023108 Ga0070714_1000231085 353
82 3300005439 Ga0070711_100001752 Ga0070711_1000017529 353
83 3300005563 Ga0068855_100039316 Ga0068855_1000393164 353
84 3300005577 Ga0068857_100036119 Ga0068857_1000361195 353
85 3300005614 Ga0068856_100000080 Ga0068856_10000008031 353
86 3300005614 Ga0068856_100043660 Ga0068856_1000436604 353
87 3300005617 Ga0068859_100026250 Ga0068859_1000262505 353
88 3300005617 Ga0068859_100218996 Ga0068859_1002189962 353
89 3300006844 Ga0075428_100000468 Ga0075428_10000046827 353
90 3300006846 Ga0075430_100187692 Ga0075430_1001876922 353
91 3300006931 Ga0097620_100026250 Ga0097620_1000262505 353
92 3300006931 Ga0097620_100218975 Ga0097620_1002189752 353
93 3300007265 Ga0099794_10104414 Ga0099794_101044141 353
94 3300009093 Ga0105240_10085367 Ga0105240_100853672 353
95 3300009094 Ga0111539_10002816 Ga0111539_1000281613 353
96 3300009094 Ga0111539_10563305 Ga0111539_105633051 353
97 3300009551 Ga0105238_10100212 Ga0105238_101002124 353
98 3300009551 Ga0105238_10206737 Ga0105238_102067372 353
99 3300013104 Ga0157370_10059741 Ga0157370_100597412 353
100 3300013308 Ga0157375_10000016 Ga0157375_10000016164 353
101 3300014325 Ga0163163_10000096 Ga0163163_1000009625 353
102 3300025913 Ga0207695_10235824 Ga0207695_102358242 353
103 3300025916 Ga0207663_10001649 Ga0207663_100016495 353
104 3300025924 Ga0207694_10105409 Ga0207694_101054092 353
105 3300025949 Ga0207667_10045269 Ga0207667_100452695 353
106 3300025949 Ga0207667_10080620 Ga0207667_100806202 353
107 3300025949 Ga0207667_10223943 Ga0207667_102239432 353
108 3300026078 Ga0207702_10001107 Ga0207702_100011074 353
109 3300026116 Ga0207674_10047449 Ga0207674_100474493 353
110 3300026116 Ga0207674_10096595 Ga0207674_100965952 353
111 3300028556 Ga0265337_1002727 Ga0265337_100272710 353
112 3300028556 Ga0265337_1006549 Ga0265337_10065493 353
113 3300028556 Ga0265337_1014337 Ga0265337_10143372 353
114 3300028556 Ga0265337_1026981 Ga0265337_10269812 353
115 3300028653 Ga0265323_10000140 Ga0265323_1000014026 353
116 3300028653 Ga0265323_10042627 Ga0265323_100426271 353
117 3300028666 Ga0265336_10000493 Ga0265336_100004936 353
118 3300028800 Ga0265338_10000084 Ga0265338_1000008421 353
119 3300028800 Ga0265338_10000616 Ga0265338_1000061620 353
120 3300028800 Ga0265338_10001074 Ga0265338_1000107442 353
121 3300028800 Ga0265338_10001675 Ga0265338_1000167518 353
122 3300028800 Ga0265338_10001829 Ga0265338_1000182917 353
123 3300028800 Ga0265338_10005250 Ga0265338_1000525013 353
124 3300028800 Ga0265338_10011262 Ga0265338_100112624 353
125 3300028800 Ga0265338_10021119 Ga0265338_100211192 353
126 3300028800 Ga0265338_10030886 Ga0265338_100308865 353
127 3300028800 Ga0265338_10078264 Ga0265338_100782643 353
128 3300029957 Ga0265324_10000064 Ga0265324_1000006457 353
129 3300029957 Ga0265324_10000188 Ga0265324_1000018814 353
130 3300029957 Ga0265324_10010515 Ga0265324_100105154 353
131 3300029957 Ga0265324_10018332 Ga0265324_100183322 353
132 3300031240 Ga0265320_10000551 Ga0265320_1000055118 353
133 3300031240 Ga0265320_10001912 Ga0265320_100019125 353
134 3300031240 Ga0265320_10009719 Ga0265320_100097192 353
135 3300031241 Ga0265325_10039526 Ga0265325_100395262 353
136 3300031242 Ga0265329_10057339 Ga0265329_100573391 353
137 3300031249 Ga0265339_10037622 Ga0265339_100376224 353
138 3300031251 Ga0265327_10001590 Ga0265327_1000159011 353
139 3300031344 Ga0265316_10015764 Ga0265316_100157645 353
140 3300031344 Ga0265316_10019404 Ga0265316_100194044 353
141 3300031344 Ga0265316_10028671 Ga0265316_100286714 353
142 3300034816 Ga0373930_0013595 Ga0373930_0013595_385_1446 353
143 3300035084 Ga0373928_0000018 Ga0373928_0000018_79_1140 353
144 3300035090 Ga0373949_0003211 Ga0373949_0003211_74_1135 353
145 3300035091 Ga0373951_0020264 Ga0373951_0020264_347_1408 353
146 3300035112 Ga0373932_0000004 Ga0373932_0000004_269599_270660 353
147 3300035117 Ga0373953_0089524 Ga0373953_0089524_147_1226 353
148 3300035118 Ga0373954_0007892 Ga0373954_0007892_2033_3112 353
149 3300035119 Ga0373956_0015355 Ga0373956_0015355_1013_2092 353
150 3300035242 Ga0373962_0000015 Ga0373962_0000015_37779_38840 353
151 3300035691 Ga0373931_0000009 Ga0373931_0000009_348512_349573 353
152 3300035695 Ga0373927_0003007 Ga0373927_0003007_8457_9518 353
153 3300035695 Ga0373927_0036178 Ga0373927_0036178_64_1125 353
154 3300036401 Ga0373937_0006478 Ga0373937_0006478_1825_2922 353
155 3300036401 Ga0373937_0074312 Ga0373937_0074312_1001_2080 353
156 3300036401 Ga0373937_0226058 Ga0373937_0226058_301_1362 353
157 3300037068 Ga0373925_0000522 Ga0373925_0000522_33849_34910 353
158 3300037068 Ga0373925_0014275 Ga0373925_0014275_3460_4521 353
159 3300037418 Ga0395900_0105522 Ga0395900_0105522_1442_2512 353
160 3300037471 Ga0395905_0054252 Ga0395905_0054252_1040_2110 353
161 3300042876 Ga0451577_0009096 Ga0451577_0009096_1308_2369 353
162 3300042876 Ga0451577_0011209 Ga0451577_0011209_7383_8450 353
163 3300042876 Ga0451577_0032935 Ga0451577_0032935_107_1168 353
164 3300042876 Ga0451577_0121709 Ga0451577_0121709_1237_2298 353
165 3300044712 Ga0453684_0000532 Ga0453684_0000532_88801_89862 353
166 3300044712 Ga0453684_0021422 Ga0453684_0021422_7240_8301 353
167 3300044712 Ga0453684_0623154 Ga0453684_0623154_34_1095 353
168 3300045051 Ga0451576_0195948 Ga0451576_0195948_409_1476 353
169 3300046476 Ga0495662_0005683 Ga0495662_0005683_2272_3333 353
170 3300046511 Ga0495608_0199335 Ga0495608_0199335_92_1156 353
171 3300046514 Ga0495618_0000968 Ga0495618_0000968_12199_13278 353
172 3300046517 Ga0495630_0025129 Ga0495630_0025129_702_1763 353
173 3300046533 Ga0495640_0017451 Ga0495640_0017451_3612_4691 353
174 3300046533 Ga0495640_0044332 Ga0495640_0044332_398_1459 353
175 3300046535 Ga0495586_0000350 Ga0495586_0000350_19338_20399 353
176 3300046535 Ga0495586_0006634 Ga0495586_0006634_2107_3186 353
177 3300046535 Ga0495586_0066681 Ga0495586_0066681_59_1120 353
178 3300046543 Ga0495645_0110695 Ga0495645_0110695_318_1388 353
179 3300046557 Ga0495622_0005382 Ga0495622_0005382_1462_2523 353
180 3300046559 Ga0495667_0151116 Ga0495667_0151116_89_1150 353
181 3300046642 Ga0495634_0002583 Ga0495634_0002583_869_1948 353
182 3300046678 Ga0495599_0074867 Ga0495599_0074867_1008_2075 353
183 3300046689 Ga0495613_0002225 Ga0495613_0002225_12064_13143 353
184 3300046690 Ga0495624_0012647 Ga0495624_0012647_181_1242 353
185 3300047319 Ga0495674_0090628 Ga0495674_0090628_32_1093 353
186 3300047322 Ga0495680_0003659 Ga0495680_0003659_7774_8853 353
187 3300047444 Ga0495675_0017939 Ga0495675_0017939_1141_2202 353
188 3300047471 Ga0495684_0007937 Ga0495684_0007937_2737_3816 353
189 3300048909 Ga0496106_0060206 Ga0496106_0060206_1478_2539 353
190 3300048910 Ga0496107_0068305 Ga0496107_0068305_1233_2294 353
191 3300049568 Ga0501031_0005653 Ga0501031_0005653_945_2006 353
192 3300049569 Ga0501032_0045327 Ga0501032_0045327_906_1967 353
193 3300049570 Ga0501033_0001002 Ga0501033_0001002_892_1953 353
194 3300049571 Ga0501034_0070036 Ga0501034_0070036_1653_2759 353
195 3300049573 Ga0501037_0130937 Ga0501037_0130937_726_1787 353
196 3300049575 Ga0501039_0188385 Ga0501039_0188385_84_1145 353
197 3300049579 Ga0501043_0126994 Ga0501043_0126994_73_1134 353
198 3300049822 Ga0501035_0021292 Ga0501035_0021292_4013_5074 353
199 3300049822 Ga0501035_0033088 Ga0501035_0033088_801_1862 353
200 3300049823 Ga0501044_0000611 Ga0501044_0000611_31470_32531 353
201 3300049823 Ga0501044_0052560 Ga0501044_0052560_2532_3593 353
202 3300050511 nmdc:mga08y16_13869_c1 nmdc:mga08y16_13869_c1_4607_5668 353
203 3300050511 nmdc:mga08y16_65259_c1 nmdc:mga08y16_65259_c1_800_1870 353

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

20

162

0.97

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

170

342

0.93

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

180

345

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8afu-assembly2.cif.gz_A-2 daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus 0.933 2 353
8afv-assembly2.cif.gz_C daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.9259 5 353
8afu-assembly2.cif.gz_B daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus 0.9251 2 353
8afv-assembly1.cif.gz_A daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.9247 5 353
8afv-assembly1.cif.gz_B daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.9244 5 353
ID Description Score Start End Superfamily
af_Q58496_2_123_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9563 4 124 3.40.50.720
af_Q58496_2_146_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9445 4 151 3.40.50.720
1vknA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9431 4 152 3.40.50.720
af_Q58496_2_146_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.932 4 151 3.40.50.720
af_Q58496_2_123_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9186 4 124 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A350EXB2-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) 0.9979 2 85 GO:0003942
GO:0008652
GO:0051287
AF-A0A382QN42-F1-model_v4 Semialdehyde dehydrogenase dimerisation domain-containing protein 0.9837 241 353
AF-X1VXP1-F1-model_v4 Semialdehyde dehydrogenase NAD-binding domain-containing protein 0.9822 73 153 GO:0006526
GO:0016620
GO:0051287
AF-A0A538R4F2-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) 0.9806 2 172 GO:0003942
GO:0008652
GO:0051287
AF-A0A7X9AWL7-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) 0.9775 1 150 GO:0003942
GO:0006526
GO:0051287

Feature Viewer

pLDDT pTM Quality
89.09 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map