F311740
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 203 | 117 | 203 | 353 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0070036|Ga0501034_0070036_1653_2759 |
| Length | 368 |
| Sequence | MSPQSKLECGRLEIEMNMKKVAIIGASGYSGEELVRLLLHHPDVELSAVTSRQSAGQTLAQVFPKFANHPRAKALRFSEPKVEVLAKQADVVFLALPHGVAAEYAVPLIQAGCIVIDLSADFRVKSAEVYKEFYAHEHPAPDLLGKSVYGLPEVYREQIKKATLIASPGCYPTSILLPTIPLLKAGLVKPTGIIADSMSGVSGAGRKAELDYLFVECNESVRPYGVPKHRHLSEIEQELSFAANAQVTIQFTPHLIPVNRGILTTLYLAPEKHFSTEAEAKTLGEQIAACYAKAYGNEPFVRVLEGKALPDTKNVTGTNVIEIAWRLDPRTGRLIVMSAEDNLVKGASGQAVQSMNILCGFAETAGLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 4 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 16 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 17 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 18 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 19 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 20 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 22 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 23 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 24 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 25 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 26 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 46 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 47 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 48 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 49 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 50 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 51 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 52 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 53 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 54 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 55 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 56 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 57 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 58 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 59 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 60 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 61 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 62 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 63 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 64 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 65 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 66 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 67 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 68 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 69 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 70 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 71 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 72 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 73 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 74 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 75 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 76 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 77 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 78 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 79 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 80 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 105 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 106 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 107 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 108 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 113 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 114 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 117 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.97 |
| Rhizosphere | 97.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10088002 | 3300003320 | Bacteria | 4505 |
| 2 | Ga0070690_100001049 | 3300005330 | Bacteria | 14154 |
| 3 | Ga0070690_100051876 | 3300005330 | Bacteria | 2620 |
| 4 | Ga0068868_100319073 | 3300005338 | Bacteria | 1323 |
| 5 | Ga0070689_100045822 | 3300005340 | Bacteria | 3368 |
| 6 | Ga0070689_100093511 | 3300005340 | Bacteria | 2373 |
| 7 | Ga0070691_10099653 | 3300005341 | Bacteria | 1442 |
| 8 | Ga0070688_100039462 | 3300005365 | Unclassified | 2889 |
| 9 | Ga0070714_100023108 | 3300005435 | Bacteria | 5105 |
| 10 | Ga0070714_100207439 | 3300005435 | Bacteria | 1795 |
| 11 | Ga0070711_100001752 | 3300005439 | Bacteria | 12061 |
| 12 | Ga0070705_100024243 | 3300005440 | Bacteria | 3272 |
| 13 | Ga0070694_100153541 | 3300005444 | Unclassified | 1683 |
| 14 | Ga0070679_100133074 | 3300005530 | Bacteria | 2468 |
| 15 | Ga0070686_100001709 | 3300005544 | Bacteria | 12286 |
| 16 | Ga0070686_100005053 | 3300005544 | Bacteria | 7283 |
| 17 | Ga0070695_100133026 | 3300005545 | Bacteria | 1716 |
| 18 | Ga0070704_100007179 | 3300005549 | Bacteria | 6622 |
| 19 | Ga0068855_100039316 | 3300005563 | Bacteria | 5616 |
| 20 | Ga0068857_100036119 | 3300005577 | Bacteria | 4378 |
| 21 | Ga0068857_100243212 | 3300005577 | Bacteria | 1648 |
| 22 | Ga0068856_100000080 | 3300005614 | Bacteria | 90679 |
| 23 | Ga0068856_100043660 | 3300005614 | Bacteria | 4410 |
| 24 | Ga0068859_100026250 | 3300005617 | Bacteria | 5841 |
| 25 | Ga0068859_100218996 | 3300005617 | Bacteria | 1991 |
| 26 | Ga0068863_100184530 | 3300005841 | Bacteria | 2003 |
| 27 | Ga0097621_100109103 | 3300006237 | Bacteria | 2337 |
| 28 | Ga0075428_100000468 | 3300006844 | Bacteria | 40623 |
| 29 | Ga0075430_100187692 | 3300006846 | Unclassified | 1719 |
| 30 | Ga0075431_100060540 | 3300006847 | Bacteria | 3906 |
| 31 | Ga0075429_100078722 | 3300006880 | Bacteria | 2873 |
| 32 | Ga0075429_100132495 | 3300006880 | Bacteria | 2181 |
| 33 | Ga0068865_100048166 | 3300006881 | Bacteria | 2932 |
| 34 | Ga0097620_100026250 | 3300006931 | Bacteria | 5841 |
| 35 | Ga0097620_100218975 | 3300006931 | Bacteria | 1991 |
| 36 | Ga0097620_100289500 | 3300006931 | Unclassified | 1731 |
| 37 | Ga0099794_10104414 | 3300007265 | Bacteria | 1416 |
| 38 | Ga0105240_10001811 | 3300009093 | Bacteria | 35983 |
| 39 | Ga0105240_10085367 | 3300009093 | Bacteria | 3867 |
| 40 | Ga0105240_10398457 | 3300009093 | Unclassified | 1551 |
| 41 | Ga0111539_10002816 | 3300009094 | Bacteria | 23104 |
| 42 | Ga0111539_10208629 | 3300009094 | Bacteria | 2276 |
| 43 | Ga0111539_10216664 | 3300009094 | Bacteria | 2230 |
| 44 | Ga0111539_10563305 | 3300009094 | Unclassified | 1327 |
| 45 | Ga0105245_10305517 | 3300009098 | Unclassified | 1562 |
| 46 | Ga0105238_10100212 | 3300009551 | Bacteria | 2880 |
| 47 | Ga0105238_10206737 | 3300009551 | Unclassified | 1939 |
| 48 | Ga0157370_10059741 | 3300013104 | Bacteria | 3622 |
| 49 | Ga0157375_10000016 | 3300013308 | Bacteria | 295002 |
| 50 | Ga0163163_10000096 | 3300014325 | Bacteria | 93313 |
| 51 | Ga0207695_10183318 | 3300025913 | Unclassified | 2014 |
| 52 | Ga0207695_10235824 | 3300025913 | Bacteria | 1732 |
| 53 | Ga0207663_10001649 | 3300025916 | Bacteria | 10525 |
| 54 | Ga0207652_10117934 | 3300025921 | Bacteria | 2358 |
| 55 | Ga0207694_10087580 | 3300025924 | Bacteria | 2453 |
| 56 | Ga0207694_10105409 | 3300025924 | Unclassified | 2238 |
| 57 | Ga0207670_10064709 | 3300025936 | Bacteria | 2507 |
| 58 | Ga0207670_10194534 | 3300025936 | Bacteria | 1537 |
| 59 | Ga0207667_10045269 | 3300025949 | Bacteria | 4661 |
| 60 | Ga0207667_10080620 | 3300025949 | Bacteria | 3372 |
| 61 | Ga0207667_10223943 | 3300025949 | Bacteria | 1927 |
| 62 | Ga0207708_10220114 | 3300026075 | Bacteria | 1521 |
| 63 | Ga0207702_10001107 | 3300026078 | Bacteria | 27560 |
| 64 | Ga0207641_10411630 | 3300026088 | Bacteria | 1300 |
| 65 | Ga0207674_10047449 | 3300026116 | Bacteria | 4402 |
| 66 | Ga0207674_10096595 | 3300026116 | Bacteria | 2939 |
| 67 | Ga0265337_1002727 | 3300028556 | Bacteria | 7927 |
| 68 | Ga0265337_1005591 | 3300028556 | Unclassified | 4966 |
| 69 | Ga0265337_1006549 | 3300028556 | Bacteria | 4475 |
| 70 | Ga0265337_1014337 | 3300028556 | Bacteria | 2629 |
| 71 | Ga0265337_1026981 | 3300028556 | Bacteria | 1735 |
| 72 | Ga0265319_1000004 | 3300028563 | Bacteria | 305085 |
| 73 | Ga0265318_10025058 | 3300028577 | Bacteria | 2360 |
| 74 | Ga0265323_10000140 | 3300028653 | Bacteria | 41860 |
| 75 | Ga0265323_10042627 | 3300028653 | Bacteria | 1642 |
| 76 | Ga0265336_10000493 | 3300028666 | Bacteria | 23115 |
| 77 | Ga0265338_10000084 | 3300028800 | Bacteria | 175415 |
| 78 | Ga0265338_10000616 | 3300028800 | Bacteria | 62218 |
| 79 | Ga0265338_10001074 | 3300028800 | Bacteria | 45350 |
| 80 | Ga0265338_10001675 | 3300028800 | Bacteria | 35207 |
| 81 | Ga0265338_10001829 | 3300028800 | Bacteria | 33349 |
| 82 | Ga0265338_10002019 | 3300028800 | Bacteria | 31479 |
| 83 | Ga0265338_10005250 | 3300028800 | Bacteria | 16981 |
| 84 | Ga0265338_10006138 | 3300028800 | Bacteria | 15421 |
| 85 | Ga0265338_10011262 | 3300028800 | Bacteria | 10354 |
| 86 | Ga0265338_10019398 | 3300028800 | Bacteria | 7216 |
| 87 | Ga0265338_10021119 | 3300028800 | Bacteria | 6806 |
| 88 | Ga0265338_10021297 | 3300028800 | Bacteria | 6767 |
| 89 | Ga0265338_10030886 | 3300028800 | Bacteria | 5264 |
| 90 | Ga0265338_10034110 | 3300028800 | Unclassified | 4926 |
| 91 | Ga0265338_10078264 | 3300028800 | Bacteria | 2790 |
| 92 | Ga0265324_10000064 | 3300029957 | Bacteria | 91244 |
| 93 | Ga0265324_10000188 | 3300029957 | Bacteria | 47481 |
| 94 | Ga0265324_10010515 | 3300029957 | Bacteria | 3562 |
| 95 | Ga0265324_10018332 | 3300029957 | Bacteria | 2533 |
| 96 | Ga0265332_10012134 | 3300031238 | Unclassified | 3823 |
| 97 | Ga0265320_10000551 | 3300031240 | Bacteria | 28889 |
| 98 | Ga0265320_10001912 | 3300031240 | Bacteria | 14716 |
| 99 | Ga0265320_10009719 | 3300031240 | Bacteria | 5773 |
| 100 | Ga0265325_10039526 | 3300031241 | Unclassified | 2484 |
| 101 | Ga0265329_10008168 | 3300031242 | Bacteria | 3990 |
| 102 | Ga0265329_10057339 | 3300031242 | Bacteria | 1235 |
| 103 | Ga0265340_10001551 | 3300031247 | Bacteria | 13183 |
| 104 | Ga0265340_10014133 | 3300031247 | Bacteria | 4179 |
| 105 | Ga0265339_10037622 | 3300031249 | Bacteria | 2704 |
| 106 | Ga0265327_10001590 | 3300031251 | Bacteria | 27697 |
| 107 | Ga0265327_10009506 | 3300031251 | Bacteria | 7002 |
| 108 | Ga0265316_10015764 | 3300031344 | Bacteria | 6591 |
| 109 | Ga0265316_10019404 | 3300031344 | Bacteria | 5818 |
| 110 | Ga0265316_10023632 | 3300031344 | Bacteria | 5160 |
| 111 | Ga0265316_10028671 | 3300031344 | Bacteria | 4589 |
| 112 | Ga0265316_10192049 | 3300031344 | Bacteria | 1516 |
| 113 | Ga0265313_10000385 | 3300031595 | Bacteria | 47503 |
| 114 | Ga0265314_10000088 | 3300031711 | Bacteria | 138315 |
| 115 | Ga0265314_10028902 | 3300031711 | Bacteria | 4126 |
| 116 | Ga0373930_0013595 | 3300034816 | Bacteria | 1503 |
| 117 | Ga0373928_0000018 | 3300035084 | Bacteria | 28140 |
| 118 | Ga0373949_0003211 | 3300035090 | Bacteria | 3956 |
| 119 | Ga0373951_0020264 | 3300035091 | Bacteria | 1521 |
| 120 | Ga0373932_0000004 | 3300035112 | Bacteria | 412176 |
| 121 | Ga0373953_0089524 | 3300035117 | Unclassified | 1286 |
| 122 | Ga0373954_0007892 | 3300035118 | Bacteria | 4662 |
| 123 | Ga0373956_0015355 | 3300035119 | Bacteria | 3205 |
| 124 | Ga0373962_0000015 | 3300035242 | Bacteria | 48259 |
| 125 | Ga0373931_0000009 | 3300035691 | Bacteria | 349854 |
| 126 | Ga0373927_0003007 | 3300035695 | Bacteria | 12237 |
| 127 | Ga0373927_0036178 | 3300035695 | Bacteria | 3211 |
| 128 | Ga0373937_0006478 | 3300036401 | Bacteria | 10103 |
| 129 | Ga0373937_0074312 | 3300036401 | Bacteria | 3136 |
| 130 | Ga0373937_0226058 | 3300036401 | Bacteria | 1762 |
| 131 | Ga0373925_0000522 | 3300037068 | Bacteria | 38320 |
| 132 | Ga0373925_0014275 | 3300037068 | Bacteria | 5747 |
| 133 | Ga0373925_0164143 | 3300037068 | Bacteria | 1751 |
| 134 | Ga0395900_0105522 | 3300037418 | Bacteria | 2895 |
| 135 | Ga0395905_0054252 | 3300037471 | Bacteria | 3751 |
| 136 | Ga0451577_0009096 | 3300042876 | Bacteria | 9586 |
| 137 | Ga0451577_0011209 | 3300042876 | Bacteria | 8499 |
| 138 | Ga0451577_0032935 | 3300042876 | Bacteria | 4671 |
| 139 | Ga0451577_0121709 | 3300042876 | Unclassified | 2338 |
| 140 | Ga0453684_0000532 | 3300044712 | Bacteria | 145255 |
| 141 | Ga0453684_0010165 | 3300044712 | Bacteria | 16149 |
| 142 | Ga0453684_0021422 | 3300044712 | Bacteria | 9657 |
| 143 | Ga0453684_0295182 | 3300044712 | Bacteria | 1844 |
| 144 | Ga0453684_0623154 | 3300044712 | Unclassified | 1180 |
| 145 | Ga0451576_0049711 | 3300045051 | Bacteria | 4401 |
| 146 | Ga0451576_0195948 | 3300045051 | Bacteria | 2110 |
| 147 | Ga0451576_0227527 | 3300045051 | Bacteria | 1947 |
| 148 | Ga0451576_0261315 | 3300045051 | Unclassified | 1810 |
| 149 | Ga0495641_0035665 | 3300046461 | Bacteria | 2342 |
| 150 | Ga0495651_0228207 | 3300046462 | Bacteria | 1284 |
| 151 | Ga0495582_0074341 | 3300046473 | Bacteria | 1881 |
| 152 | Ga0495662_0005683 | 3300046476 | Bacteria | 6234 |
| 153 | Ga0495608_0199335 | 3300046511 | Bacteria | 1262 |
| 154 | Ga0495618_0000968 | 3300046514 | Bacteria | 19743 |
| 155 | Ga0495630_0000022 | 3300046517 | Bacteria | 172932 |
| 156 | Ga0495630_0025129 | 3300046517 | Bacteria | 4403 |
| 157 | Ga0495666_0007144 | 3300046526 | Bacteria | 5610 |
| 158 | Ga0495665_0074084 | 3300046531 | Bacteria | 1793 |
| 159 | Ga0495640_0017451 | 3300046533 | Bacteria | 5351 |
| 160 | Ga0495640_0044332 | 3300046533 | Bacteria | 3093 |
| 161 | Ga0495640_0095282 | 3300046533 | Bacteria | 1959 |
| 162 | Ga0495586_0000222 | 3300046535 | Bacteria | 37841 |
| 163 | Ga0495586_0000350 | 3300046535 | Bacteria | 28890 |
| 164 | Ga0495586_0002332 | 3300046535 | Bacteria | 10326 |
| 165 | Ga0495586_0006634 | 3300046535 | Bacteria | 6180 |
| 166 | Ga0495586_0066681 | 3300046535 | Bacteria | 1962 |
| 167 | Ga0495645_0110695 | 3300046543 | Bacteria | 1943 |
| 168 | Ga0495622_0005382 | 3300046557 | Bacteria | 5944 |
| 169 | Ga0495667_0151116 | 3300046559 | Bacteria | 1495 |
| 170 | Ga0495634_0002583 | 3300046642 | Bacteria | 14935 |
| 171 | Ga0495634_0046952 | 3300046642 | Bacteria | 2912 |
| 172 | Ga0495599_0074867 | 3300046678 | Bacteria | 2114 |
| 173 | Ga0495613_0002225 | 3300046689 | Bacteria | 14688 |
| 174 | Ga0495613_0007800 | 3300046689 | Bacteria | 7966 |
| 175 | Ga0495613_0079715 | 3300046689 | Bacteria | 2381 |
| 176 | Ga0495624_0012647 | 3300046690 | Bacteria | 5764 |
| 177 | Ga0495674_0000401 | 3300047319 | Bacteria | 38833 |
| 178 | Ga0495674_0029271 | 3300047319 | Bacteria | 5018 |
| 179 | Ga0495674_0090628 | 3300047319 | Bacteria | 2612 |
| 180 | Ga0495676_0126686 | 3300047321 | Bacteria | 1850 |
| 181 | Ga0495680_0003659 | 3300047322 | Bacteria | 15005 |
| 182 | Ga0495675_0017939 | 3300047444 | Bacteria | 4488 |
| 183 | Ga0495684_0007937 | 3300047471 | Bacteria | 8210 |
| 184 | Ga0495614_0055035 | 3300048089 | Bacteria | 1707 |
| 185 | Ga0496106_0060206 | 3300048909 | Bacteria | 2878 |
| 186 | Ga0496107_0068305 | 3300048910 | Bacteria | 2579 |
| 187 | Ga0496115_0003105 | 3300048918 | Bacteria | 11937 |
| 188 | Ga0496115_0205937 | 3300048918 | Unclassified | 1625 |
| 189 | Ga0501031_0005653 | 3300049568 | Bacteria | 8146 |
| 190 | Ga0501032_0045327 | 3300049569 | Bacteria | 2974 |
| 191 | Ga0501033_0001002 | 3300049570 | Bacteria | 25704 |
| 192 | Ga0501033_0268922 | 3300049570 | Unclassified | 1205 |
| 193 | Ga0501034_0070036 | 3300049571 | Bacteria | 3519 |
| 194 | Ga0501037_0130937 | 3300049573 | Bacteria | 1798 |
| 195 | Ga0501039_0188385 | 3300049575 | Bacteria | 1623 |
| 196 | Ga0501043_0126994 | 3300049579 | Bacteria | 2000 |
| 197 | Ga0501035_0021292 | 3300049822 | Bacteria | 5961 |
| 198 | Ga0501035_0033088 | 3300049822 | Bacteria | 4701 |
| 199 | Ga0501044_0000611 | 3300049823 | Bacteria | 43362 |
| 200 | Ga0501044_0052560 | 3300049823 | Bacteria | 4197 |
| 201 | nmdc:mga09592_121355_c1 | 3300050508 | Bacteria | 2245 |
| 202 | nmdc:mga08y16_13869_c1 | 3300050511 | Bacteria | 8479 |
| 203 | nmdc:mga08y16_65259_c1 | 3300050511 | Bacteria | 3800 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006847 | Ga0075431_100060540 | Ga0075431_1000605402 | 334 |
| 2 | 3300006880 | Ga0075429_100078722 | Ga0075429_1000787222 | 334 |
| 3 | 3300006931 | Ga0097620_100289500 | Ga0097620_1002895003 | 341 |
| 4 | 3300006881 | Ga0068865_100048166 | Ga0068865_1000481662 | 342 |
| 5 | 3300026075 | Ga0207708_10220114 | Ga0207708_102201142 | 342 |
| 6 | 3300031238 | Ga0265332_10012134 | Ga0265332_100121344 | 342 |
| 7 | 3300031242 | Ga0265329_10008168 | Ga0265329_100081683 | 342 |
| 8 | 3300031711 | Ga0265314_10000088 | Ga0265314_1000008882 | 342 |
| 9 | 3300005435 | Ga0070714_100207439 | Ga0070714_1002074393 | 345 |
| 10 | 3300028556 | Ga0265337_1005591 | Ga0265337_10055915 | 345 |
| 11 | 3300028563 | Ga0265319_1000004 | Ga0265319_1000004281 | 345 |
| 12 | 3300028577 | Ga0265318_10025058 | Ga0265318_100250581 | 345 |
| 13 | 3300028800 | Ga0265338_10034110 | Ga0265338_100341102 | 345 |
| 14 | 3300031251 | Ga0265327_10009506 | Ga0265327_100095066 | 345 |
| 15 | 3300031344 | Ga0265316_10023632 | Ga0265316_100236323 | 345 |
| 16 | 3300031595 | Ga0265313_10000385 | Ga0265313_1000038517 | 345 |
| 17 | 3300031711 | Ga0265314_10028902 | Ga0265314_100289025 | 345 |
| 18 | 3300005544 | Ga0070686_100001709 | Ga0070686_1000017095 | 346 |
| 19 | 3300009093 | Ga0105240_10001811 | Ga0105240_100018115 | 346 |
| 20 | 3300028800 | Ga0265338_10019398 | Ga0265338_100193983 | 346 |
| 21 | 3300031247 | Ga0265340_10001551 | Ga0265340_100015515 | 346 |
| 22 | 3300031344 | Ga0265316_10192049 | Ga0265316_101920491 | 346 |
| 23 | 3300049570 | Ga0501033_0268922 | Ga0501033_0268922_20_1066 | 346 |
| 24 | 3300044712 | Ga0453684_0010165 | Ga0453684_0010165_10518_11561 | 347 |
| 25 | 3300009098 | Ga0105245_10305517 | Ga0105245_103055172 | 348 |
| 26 | 3300037068 | Ga0373925_0164143 | Ga0373925_0164143_311_1366 | 349 |
| 27 | 3300005330 | Ga0070690_100051876 | Ga0070690_1000518764 | 351 |
| 28 | 3300005340 | Ga0070689_100045822 | Ga0070689_1000458221 | 351 |
| 29 | 3300005365 | Ga0070688_100039462 | Ga0070688_1000394623 | 351 |
| 30 | 3300005440 | Ga0070705_100024243 | Ga0070705_1000242432 | 351 |
| 31 | 3300005444 | Ga0070694_100153541 | Ga0070694_1001535411 | 351 |
| 32 | 3300005544 | Ga0070686_100005053 | Ga0070686_1000050534 | 351 |
| 33 | 3300005549 | Ga0070704_100007179 | Ga0070704_1000071794 | 351 |
| 34 | 3300005841 | Ga0068863_100184530 | Ga0068863_1001845303 | 351 |
| 35 | 3300006880 | Ga0075429_100132495 | Ga0075429_1001324952 | 351 |
| 36 | 3300009094 | Ga0111539_10208629 | Ga0111539_102086291 | 351 |
| 37 | 3300009094 | Ga0111539_10216664 | Ga0111539_102166643 | 351 |
| 38 | 3300025913 | Ga0207695_10183318 | Ga0207695_101833182 | 351 |
| 39 | 3300025936 | Ga0207670_10064709 | Ga0207670_100647092 | 351 |
| 40 | 3300025936 | Ga0207670_10194534 | Ga0207670_101945342 | 351 |
| 41 | 3300026088 | Ga0207641_10411630 | Ga0207641_104116301 | 351 |
| 42 | 3300031247 | Ga0265340_10014133 | Ga0265340_100141332 | 351 |
| 43 | 3300044712 | Ga0453684_0295182 | Ga0453684_0295182_88_1143 | 351 |
| 44 | 3300045051 | Ga0451576_0227527 | Ga0451576_0227527_575_1633 | 351 |
| 45 | 3300046461 | Ga0495641_0035665 | Ga0495641_0035665_143_1198 | 351 |
| 46 | 3300046462 | Ga0495651_0228207 | Ga0495651_0228207_47_1102 | 351 |
| 47 | 3300046531 | Ga0495665_0074084 | Ga0495665_0074084_155_1234 | 351 |
| 48 | 3300046535 | Ga0495586_0002332 | Ga0495586_0002332_4158_5213 | 351 |
| 49 | 3300046689 | Ga0495613_0007800 | Ga0495613_0007800_1343_2398 | 351 |
| 50 | 3300047319 | Ga0495674_0029271 | Ga0495674_0029271_155_1234 | 351 |
| 51 | 3300047321 | Ga0495676_0126686 | Ga0495676_0126686_711_1766 | 351 |
| 52 | 3300048089 | Ga0495614_0055035 | Ga0495614_0055035_45_1100 | 351 |
| 53 | 3300048918 | Ga0496115_0205937 | Ga0496115_0205937_410_1465 | 351 |
| 54 | 3300050508 | nmdc:mga09592_121355_c1 | nmdc:mga09592_121355_c1_964_2019 | 351 |
| 55 | 3300005530 | Ga0070679_100133074 | Ga0070679_1001330742 | 352 |
| 56 | 3300005545 | Ga0070695_100133026 | Ga0070695_1001330262 | 352 |
| 57 | 3300005577 | Ga0068857_100243212 | Ga0068857_1002432122 | 352 |
| 58 | 3300006237 | Ga0097621_100109103 | Ga0097621_1001091032 | 352 |
| 59 | 3300009093 | Ga0105240_10398457 | Ga0105240_103984572 | 352 |
| 60 | 3300025921 | Ga0207652_10117934 | Ga0207652_101179344 | 352 |
| 61 | 3300025924 | Ga0207694_10087580 | Ga0207694_100875803 | 352 |
| 62 | 3300028800 | Ga0265338_10002019 | Ga0265338_1000201911 | 352 |
| 63 | 3300028800 | Ga0265338_10006138 | Ga0265338_1000613813 | 352 |
| 64 | 3300028800 | Ga0265338_10021297 | Ga0265338_100212977 | 352 |
| 65 | 3300045051 | Ga0451576_0049711 | Ga0451576_0049711_1031_2089 | 352 |
| 66 | 3300045051 | Ga0451576_0261315 | Ga0451576_0261315_309_1373 | 352 |
| 67 | 3300046473 | Ga0495582_0074341 | Ga0495582_0074341_683_1741 | 352 |
| 68 | 3300046517 | Ga0495630_0000022 | Ga0495630_0000022_22816_23874 | 352 |
| 69 | 3300046526 | Ga0495666_0007144 | Ga0495666_0007144_651_1709 | 352 |
| 70 | 3300046533 | Ga0495640_0095282 | Ga0495640_0095282_742_1800 | 352 |
| 71 | 3300046535 | Ga0495586_0000222 | Ga0495586_0000222_14653_15711 | 352 |
| 72 | 3300046642 | Ga0495634_0046952 | Ga0495634_0046952_899_1957 | 352 |
| 73 | 3300046689 | Ga0495613_0079715 | Ga0495613_0079715_613_1671 | 352 |
| 74 | 3300047319 | Ga0495674_0000401 | Ga0495674_0000401_29563_30621 | 352 |
| 75 | 3300048918 | Ga0496115_0003105 | Ga0496115_0003105_6410_7468 | 352 |
| 76 | 3300003320 | rootH2_10088002 | rootH2_100880023 | 353 |
| 77 | 3300005330 | Ga0070690_100001049 | Ga0070690_1000010496 | 353 |
| 78 | 3300005338 | Ga0068868_100319073 | Ga0068868_1003190732 | 353 |
| 79 | 3300005340 | Ga0070689_100093511 | Ga0070689_1000935113 | 353 |
| 80 | 3300005341 | Ga0070691_10099653 | Ga0070691_100996532 | 353 |
| 81 | 3300005435 | Ga0070714_100023108 | Ga0070714_1000231085 | 353 |
| 82 | 3300005439 | Ga0070711_100001752 | Ga0070711_1000017529 | 353 |
| 83 | 3300005563 | Ga0068855_100039316 | Ga0068855_1000393164 | 353 |
| 84 | 3300005577 | Ga0068857_100036119 | Ga0068857_1000361195 | 353 |
| 85 | 3300005614 | Ga0068856_100000080 | Ga0068856_10000008031 | 353 |
| 86 | 3300005614 | Ga0068856_100043660 | Ga0068856_1000436604 | 353 |
| 87 | 3300005617 | Ga0068859_100026250 | Ga0068859_1000262505 | 353 |
| 88 | 3300005617 | Ga0068859_100218996 | Ga0068859_1002189962 | 353 |
| 89 | 3300006844 | Ga0075428_100000468 | Ga0075428_10000046827 | 353 |
| 90 | 3300006846 | Ga0075430_100187692 | Ga0075430_1001876922 | 353 |
| 91 | 3300006931 | Ga0097620_100026250 | Ga0097620_1000262505 | 353 |
| 92 | 3300006931 | Ga0097620_100218975 | Ga0097620_1002189752 | 353 |
| 93 | 3300007265 | Ga0099794_10104414 | Ga0099794_101044141 | 353 |
| 94 | 3300009093 | Ga0105240_10085367 | Ga0105240_100853672 | 353 |
| 95 | 3300009094 | Ga0111539_10002816 | Ga0111539_1000281613 | 353 |
| 96 | 3300009094 | Ga0111539_10563305 | Ga0111539_105633051 | 353 |
| 97 | 3300009551 | Ga0105238_10100212 | Ga0105238_101002124 | 353 |
| 98 | 3300009551 | Ga0105238_10206737 | Ga0105238_102067372 | 353 |
| 99 | 3300013104 | Ga0157370_10059741 | Ga0157370_100597412 | 353 |
| 100 | 3300013308 | Ga0157375_10000016 | Ga0157375_10000016164 | 353 |
| 101 | 3300014325 | Ga0163163_10000096 | Ga0163163_1000009625 | 353 |
| 102 | 3300025913 | Ga0207695_10235824 | Ga0207695_102358242 | 353 |
| 103 | 3300025916 | Ga0207663_10001649 | Ga0207663_100016495 | 353 |
| 104 | 3300025924 | Ga0207694_10105409 | Ga0207694_101054092 | 353 |
| 105 | 3300025949 | Ga0207667_10045269 | Ga0207667_100452695 | 353 |
| 106 | 3300025949 | Ga0207667_10080620 | Ga0207667_100806202 | 353 |
| 107 | 3300025949 | Ga0207667_10223943 | Ga0207667_102239432 | 353 |
| 108 | 3300026078 | Ga0207702_10001107 | Ga0207702_100011074 | 353 |
| 109 | 3300026116 | Ga0207674_10047449 | Ga0207674_100474493 | 353 |
| 110 | 3300026116 | Ga0207674_10096595 | Ga0207674_100965952 | 353 |
| 111 | 3300028556 | Ga0265337_1002727 | Ga0265337_100272710 | 353 |
| 112 | 3300028556 | Ga0265337_1006549 | Ga0265337_10065493 | 353 |
| 113 | 3300028556 | Ga0265337_1014337 | Ga0265337_10143372 | 353 |
| 114 | 3300028556 | Ga0265337_1026981 | Ga0265337_10269812 | 353 |
| 115 | 3300028653 | Ga0265323_10000140 | Ga0265323_1000014026 | 353 |
| 116 | 3300028653 | Ga0265323_10042627 | Ga0265323_100426271 | 353 |
| 117 | 3300028666 | Ga0265336_10000493 | Ga0265336_100004936 | 353 |
| 118 | 3300028800 | Ga0265338_10000084 | Ga0265338_1000008421 | 353 |
| 119 | 3300028800 | Ga0265338_10000616 | Ga0265338_1000061620 | 353 |
| 120 | 3300028800 | Ga0265338_10001074 | Ga0265338_1000107442 | 353 |
| 121 | 3300028800 | Ga0265338_10001675 | Ga0265338_1000167518 | 353 |
| 122 | 3300028800 | Ga0265338_10001829 | Ga0265338_1000182917 | 353 |
| 123 | 3300028800 | Ga0265338_10005250 | Ga0265338_1000525013 | 353 |
| 124 | 3300028800 | Ga0265338_10011262 | Ga0265338_100112624 | 353 |
| 125 | 3300028800 | Ga0265338_10021119 | Ga0265338_100211192 | 353 |
| 126 | 3300028800 | Ga0265338_10030886 | Ga0265338_100308865 | 353 |
| 127 | 3300028800 | Ga0265338_10078264 | Ga0265338_100782643 | 353 |
| 128 | 3300029957 | Ga0265324_10000064 | Ga0265324_1000006457 | 353 |
| 129 | 3300029957 | Ga0265324_10000188 | Ga0265324_1000018814 | 353 |
| 130 | 3300029957 | Ga0265324_10010515 | Ga0265324_100105154 | 353 |
| 131 | 3300029957 | Ga0265324_10018332 | Ga0265324_100183322 | 353 |
| 132 | 3300031240 | Ga0265320_10000551 | Ga0265320_1000055118 | 353 |
| 133 | 3300031240 | Ga0265320_10001912 | Ga0265320_100019125 | 353 |
| 134 | 3300031240 | Ga0265320_10009719 | Ga0265320_100097192 | 353 |
| 135 | 3300031241 | Ga0265325_10039526 | Ga0265325_100395262 | 353 |
| 136 | 3300031242 | Ga0265329_10057339 | Ga0265329_100573391 | 353 |
| 137 | 3300031249 | Ga0265339_10037622 | Ga0265339_100376224 | 353 |
| 138 | 3300031251 | Ga0265327_10001590 | Ga0265327_1000159011 | 353 |
| 139 | 3300031344 | Ga0265316_10015764 | Ga0265316_100157645 | 353 |
| 140 | 3300031344 | Ga0265316_10019404 | Ga0265316_100194044 | 353 |
| 141 | 3300031344 | Ga0265316_10028671 | Ga0265316_100286714 | 353 |
| 142 | 3300034816 | Ga0373930_0013595 | Ga0373930_0013595_385_1446 | 353 |
| 143 | 3300035084 | Ga0373928_0000018 | Ga0373928_0000018_79_1140 | 353 |
| 144 | 3300035090 | Ga0373949_0003211 | Ga0373949_0003211_74_1135 | 353 |
| 145 | 3300035091 | Ga0373951_0020264 | Ga0373951_0020264_347_1408 | 353 |
| 146 | 3300035112 | Ga0373932_0000004 | Ga0373932_0000004_269599_270660 | 353 |
| 147 | 3300035117 | Ga0373953_0089524 | Ga0373953_0089524_147_1226 | 353 |
| 148 | 3300035118 | Ga0373954_0007892 | Ga0373954_0007892_2033_3112 | 353 |
| 149 | 3300035119 | Ga0373956_0015355 | Ga0373956_0015355_1013_2092 | 353 |
| 150 | 3300035242 | Ga0373962_0000015 | Ga0373962_0000015_37779_38840 | 353 |
| 151 | 3300035691 | Ga0373931_0000009 | Ga0373931_0000009_348512_349573 | 353 |
| 152 | 3300035695 | Ga0373927_0003007 | Ga0373927_0003007_8457_9518 | 353 |
| 153 | 3300035695 | Ga0373927_0036178 | Ga0373927_0036178_64_1125 | 353 |
| 154 | 3300036401 | Ga0373937_0006478 | Ga0373937_0006478_1825_2922 | 353 |
| 155 | 3300036401 | Ga0373937_0074312 | Ga0373937_0074312_1001_2080 | 353 |
| 156 | 3300036401 | Ga0373937_0226058 | Ga0373937_0226058_301_1362 | 353 |
| 157 | 3300037068 | Ga0373925_0000522 | Ga0373925_0000522_33849_34910 | 353 |
| 158 | 3300037068 | Ga0373925_0014275 | Ga0373925_0014275_3460_4521 | 353 |
| 159 | 3300037418 | Ga0395900_0105522 | Ga0395900_0105522_1442_2512 | 353 |
| 160 | 3300037471 | Ga0395905_0054252 | Ga0395905_0054252_1040_2110 | 353 |
| 161 | 3300042876 | Ga0451577_0009096 | Ga0451577_0009096_1308_2369 | 353 |
| 162 | 3300042876 | Ga0451577_0011209 | Ga0451577_0011209_7383_8450 | 353 |
| 163 | 3300042876 | Ga0451577_0032935 | Ga0451577_0032935_107_1168 | 353 |
| 164 | 3300042876 | Ga0451577_0121709 | Ga0451577_0121709_1237_2298 | 353 |
| 165 | 3300044712 | Ga0453684_0000532 | Ga0453684_0000532_88801_89862 | 353 |
| 166 | 3300044712 | Ga0453684_0021422 | Ga0453684_0021422_7240_8301 | 353 |
| 167 | 3300044712 | Ga0453684_0623154 | Ga0453684_0623154_34_1095 | 353 |
| 168 | 3300045051 | Ga0451576_0195948 | Ga0451576_0195948_409_1476 | 353 |
| 169 | 3300046476 | Ga0495662_0005683 | Ga0495662_0005683_2272_3333 | 353 |
| 170 | 3300046511 | Ga0495608_0199335 | Ga0495608_0199335_92_1156 | 353 |
| 171 | 3300046514 | Ga0495618_0000968 | Ga0495618_0000968_12199_13278 | 353 |
| 172 | 3300046517 | Ga0495630_0025129 | Ga0495630_0025129_702_1763 | 353 |
| 173 | 3300046533 | Ga0495640_0017451 | Ga0495640_0017451_3612_4691 | 353 |
| 174 | 3300046533 | Ga0495640_0044332 | Ga0495640_0044332_398_1459 | 353 |
| 175 | 3300046535 | Ga0495586_0000350 | Ga0495586_0000350_19338_20399 | 353 |
| 176 | 3300046535 | Ga0495586_0006634 | Ga0495586_0006634_2107_3186 | 353 |
| 177 | 3300046535 | Ga0495586_0066681 | Ga0495586_0066681_59_1120 | 353 |
| 178 | 3300046543 | Ga0495645_0110695 | Ga0495645_0110695_318_1388 | 353 |
| 179 | 3300046557 | Ga0495622_0005382 | Ga0495622_0005382_1462_2523 | 353 |
| 180 | 3300046559 | Ga0495667_0151116 | Ga0495667_0151116_89_1150 | 353 |
| 181 | 3300046642 | Ga0495634_0002583 | Ga0495634_0002583_869_1948 | 353 |
| 182 | 3300046678 | Ga0495599_0074867 | Ga0495599_0074867_1008_2075 | 353 |
| 183 | 3300046689 | Ga0495613_0002225 | Ga0495613_0002225_12064_13143 | 353 |
| 184 | 3300046690 | Ga0495624_0012647 | Ga0495624_0012647_181_1242 | 353 |
| 185 | 3300047319 | Ga0495674_0090628 | Ga0495674_0090628_32_1093 | 353 |
| 186 | 3300047322 | Ga0495680_0003659 | Ga0495680_0003659_7774_8853 | 353 |
| 187 | 3300047444 | Ga0495675_0017939 | Ga0495675_0017939_1141_2202 | 353 |
| 188 | 3300047471 | Ga0495684_0007937 | Ga0495684_0007937_2737_3816 | 353 |
| 189 | 3300048909 | Ga0496106_0060206 | Ga0496106_0060206_1478_2539 | 353 |
| 190 | 3300048910 | Ga0496107_0068305 | Ga0496107_0068305_1233_2294 | 353 |
| 191 | 3300049568 | Ga0501031_0005653 | Ga0501031_0005653_945_2006 | 353 |
| 192 | 3300049569 | Ga0501032_0045327 | Ga0501032_0045327_906_1967 | 353 |
| 193 | 3300049570 | Ga0501033_0001002 | Ga0501033_0001002_892_1953 | 353 |
| 194 | 3300049571 | Ga0501034_0070036 | Ga0501034_0070036_1653_2759 | 353 |
| 195 | 3300049573 | Ga0501037_0130937 | Ga0501037_0130937_726_1787 | 353 |
| 196 | 3300049575 | Ga0501039_0188385 | Ga0501039_0188385_84_1145 | 353 |
| 197 | 3300049579 | Ga0501043_0126994 | Ga0501043_0126994_73_1134 | 353 |
| 198 | 3300049822 | Ga0501035_0021292 | Ga0501035_0021292_4013_5074 | 353 |
| 199 | 3300049822 | Ga0501035_0033088 | Ga0501035_0033088_801_1862 | 353 |
| 200 | 3300049823 | Ga0501044_0000611 | Ga0501044_0000611_31470_32531 | 353 |
| 201 | 3300049823 | Ga0501044_0052560 | Ga0501044_0052560_2532_3593 | 353 |
| 202 | 3300050511 | nmdc:mga08y16_13869_c1 | nmdc:mga08y16_13869_c1_4607_5668 | 353 |
| 203 | 3300050511 | nmdc:mga08y16_65259_c1 | nmdc:mga08y16_65259_c1_800_1870 | 353 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8afu-assembly2.cif.gz_A-2 | daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus | 0.933 | 2 | 353 |
| 8afv-assembly2.cif.gz_C | daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) | 0.9259 | 5 | 353 |
| 8afu-assembly2.cif.gz_B | daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus | 0.9251 | 2 | 353 |
| 8afv-assembly1.cif.gz_A | daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) | 0.9247 | 5 | 353 |
| 8afv-assembly1.cif.gz_B | daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) | 0.9244 | 5 | 353 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58496_2_123_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9563 | 4 | 124 | 3.40.50.720 |
| af_Q58496_2_146_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9445 | 4 | 151 | 3.40.50.720 |
| 1vknA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9431 | 4 | 152 | 3.40.50.720 |
| af_Q58496_2_146_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.932 | 4 | 151 | 3.40.50.720 |
| af_Q58496_2_123_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9186 | 4 | 124 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350EXB2-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) | 0.9979 | 2 | 85 |
GO:0003942
GO:0008652 GO:0051287 |
| AF-A0A382QN42-F1-model_v4 | Semialdehyde dehydrogenase dimerisation domain-containing protein | 0.9837 | 241 | 353 |
|
| AF-X1VXP1-F1-model_v4 | Semialdehyde dehydrogenase NAD-binding domain-containing protein | 0.9822 | 73 | 153 |
GO:0006526
GO:0016620 GO:0051287 |
| AF-A0A538R4F2-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) | 0.9806 | 2 | 172 |
GO:0003942
GO:0008652 GO:0051287 |
| AF-A0A7X9AWL7-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) | 0.9775 | 1 | 150 |
GO:0003942
GO:0006526 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar