F311692

General Info

Members Datasets Scaffolds Average Seq Length
203 144 406 176

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0710737|Ga0496110_0710737_265_861
Length 198
Sequence LKTLEAKSWKLQAESSDMRLDITGRHVDITPALRQMIDRRIARLERMLNDSAISAQVILTKEKYRHRTELVVHARGDQTLGGRGEGTSWQTSLRLATAKIEQQAQKVKGKWAARKRRAAVSRVAGAAVDGENAVVPAAAAPRVIRASRYAVKPMSVEDAALQVGARSESFVVFRNADTDAVSILYKRRDGHFGLIEPD

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
91 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
92 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
93 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
94 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
95 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
128 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.94
Nodule 0
Rhizoplane 4.93
Rhizosphere 91.13
Stem 0
Stem Tuber 0
Unclassified 13.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0710737 3300048913 Bacteria 907
2 MBSR1b_contig_10806727 2162886012 Unclassified 802
3 Ga0065712_10005994 3300005290 Bacteria 3085
4 Ga0065712_10086344 3300005290 Bacteria 2641
5 Ga0065712_10099678 3300005290 Bacteria 2084
6 Ga0065712_10216331 3300005290 Unclassified 1055
7 Ga0065715_10239158 3300005293 Bacteria 1205
8 Ga0070676_10488274 3300005328 Unclassified 872
9 Ga0070683_100565992 3300005329 Bacteria 1087
10 Ga0070670_100031749 3300005331 Bacteria 4549
11 Ga0070670_100033060 3300005331 Bacteria 4456
12 Ga0070670_100255914 3300005331 Bacteria 1526
13 Ga0070670_100613186 3300005331 Bacteria 974
14 Ga0070682_101054354 3300005337 Unclassified 678
15 Ga0070660_100240319 3300005339 Bacteria 1475
16 Ga0070660_100455262 3300005339 Bacteria 1062
17 Ga0070689_100424427 3300005340 Bacteria 1128
18 Ga0070661_100420259 3300005344 Bacteria 1060
19 Ga0070661_100437491 3300005344 Bacteria 1039
20 Ga0070661_100680389 3300005344 Bacteria 837
21 Ga0070669_100429338 3300005353 Bacteria 1086
22 Ga0070675_100090594 3300005354 Bacteria 2561
23 Ga0070675_101440502 3300005354 Unclassified 635
24 Ga0070671_100144255 3300005355 Bacteria 2010
25 Ga0070674_100053490 3300005356 Bacteria 2788
26 Ga0070674_100125807 3300005356 Bacteria 1903
27 Ga0070673_100275238 3300005364 Bacteria 1475
28 Ga0070659_100085693 3300005366 Bacteria 2520
29 Ga0070659_100614518 3300005366 Bacteria 935
30 Ga0070713_100618641 3300005436 Bacteria 1030
31 Ga0070711_100681962 3300005439 Unclassified 864
32 Ga0070708_100865457 3300005445 Unclassified 849
33 Ga0070678_100035446 3300005456 Bacteria 3484
34 Ga0070678_100401002 3300005456 Bacteria 1191
35 Ga0070678_101026608 3300005456 Bacteria 759
36 Ga0068867_100598540 3300005459 Unclassified 961
37 Ga0070706_100633704 3300005467 Bacteria 993
38 Ga0070706_100673541 3300005467 Bacteria 960
39 Ga0070707_100729592 3300005468 Unclassified 954
40 Ga0070672_100350270 3300005543 Bacteria 1259
41 Ga0070696_100075949 3300005546 Bacteria 2371
42 Ga0070704_100198100 3300005549 Bacteria 1619
43 Ga0070664_100385695 3300005564 Bacteria 1279
44 Ga0070664_100657017 3300005564 Bacteria 975
45 Ga0068852_100407706 3300005616 Bacteria 1338
46 Ga0081455_10367706 3300005937 Bacteria 1009
47 Ga0075365_10000848 3300006038 Bacteria 12684
48 Ga0075365_10034124 3300006038 Bacteria 3284
49 Ga0075368_10117857 3300006042 Bacteria 1098
50 Ga0075367_10241836 3300006178 Bacteria 1131
51 Ga0075428_100005322 3300006844 Bacteria 14305
52 Ga0075428_100017975 3300006844 Bacteria 7813
53 Ga0075428_100351335 3300006844 Bacteria 1582
54 Ga0075430_100002192 3300006846 Bacteria 16177
55 Ga0075430_100004410 3300006846 Bacteria 11881
56 Ga0075430_100020167 3300006846 Bacteria 5672
57 Ga0075431_100005306 3300006847 Bacteria 12703
58 Ga0075431_100100948 3300006847 Bacteria 2977
59 Ga0075431_100171395 3300006847 Bacteria 2230
60 Ga0075431_100404633 3300006847 Bacteria 1366
61 Ga0075434_100004109 3300006871 Bacteria 13054
62 Ga0075434_100268151 3300006871 Bacteria 1727
63 Ga0075434_100824915 3300006871 Unclassified 943
64 Ga0075429_100102486 3300006880 Bacteria 2499
65 Ga0075429_100150089 3300006880 Bacteria 2040
66 Ga0105240_10784234 3300009093 Bacteria 1033
67 Ga0105240_11335803 3300009093 Bacteria 755
68 Ga0111539_10132027 3300009094 Bacteria 2924
69 Ga0114129_10005595 3300009147 Bacteria 17784
70 Ga0114129_10012048 3300009147 Bacteria 12300
71 Ga0105248_10346060 3300009177 Bacteria 1674
72 Ga0105249_11121791 3300009553 Unclassified 857
73 Ga0105246_10240234 3300011119 Bacteria 1431
74 Ga0157369_10463747 3300013105 Bacteria 1311
75 Ga0157372_10209425 3300013307 Bacteria 2259
76 Ga0157372_10524868 3300013307 Bacteria 1380
77 Ga0157375_10271480 3300013308 Bacteria 1858
78 Ga0163163_10089101 3300014325 Bacteria 3097
79 Ga0157376_10791574 3300014969 Bacteria 960
80 Ga0206356_11080214 3300020070 Bacteria 1383
81 Ga0207697_10002800 3300025315 Bacteria 8881
82 Ga0207682_10228698 3300025893 Unclassified 862
83 Ga0207688_10008140 3300025901 Bacteria 5698
84 Ga0207688_10419343 3300025901 Bacteria 832
85 Ga0207684_10409250 3300025910 Bacteria 1166
86 Ga0207684_10582959 3300025910 Bacteria 956
87 Ga0207695_10079430 3300025913 Bacteria 3325
88 Ga0207695_10898229 3300025913 Bacteria 766
89 Ga0207663_10582106 3300025916 Unclassified 878
90 Ga0207657_10184809 3300025919 Bacteria 1684
91 Ga0207649_10370850 3300025920 Bacteria 1065
92 Ga0207681_10153986 3300025923 Bacteria 1726
93 Ga0207650_10042348 3300025925 Bacteria 3340
94 Ga0207650_10466463 3300025925 Bacteria 1052
95 Ga0207650_11021419 3300025925 Unclassified 703
96 Ga0207659_10057460 3300025926 Bacteria 2790
97 Ga0207659_10554258 3300025926 Unclassified 977
98 Ga0207644_10045576 3300025931 Bacteria 3120
99 Ga0207690_10060059 3300025932 Bacteria 2578
100 Ga0207690_10539666 3300025932 Bacteria 947
101 Ga0207690_10739953 3300025932 Unclassified 810
102 Ga0207669_10032429 3300025937 Bacteria 2934
103 Ga0207679_10470249 3300025945 Bacteria 1118
104 Ga0207651_10261047 3300025960 Bacteria 1422
105 Ga0207702_11443823 3300026078 Bacteria 682
106 Ga0207648_10580081 3300026089 Bacteria 1032
107 Ga0207676_10033004 3300026095 Bacteria 3908
108 Ga0207676_10860918 3300026095 Unclassified 887
109 Ga0207674_10889352 3300026116 Bacteria 858
110 Ga0207683_10051827 3300026121 Bacteria 3595
111 Ga0207683_10179406 3300026121 Bacteria 1920
112 Ga0268266_10065309 3300028379 Bacteria 3146
113 Ga0307408_100422295 3300031548 Bacteria 1150
114 Ga0307405_10040415 3300031731 Bacteria 2825
115 Ga0307413_10268822 3300031824 Unclassified 1275
116 Ga0307410_10035814 3300031852 Bacteria 3227
117 Ga0307406_10280918 3300031901 Unclassified 1270
118 Ga0307407_10025954 3300031903 Bacteria 3097
119 Ga0307409_100065375 3300031995 Bacteria 2862
120 Ga0307409_100353637 3300031995 Bacteria 1387
121 Ga0307416_100030799 3300032002 Bacteria 4030
122 Ga0307416_100062783 3300032002 Bacteria 3039
123 Ga0307416_100457156 3300032002 Bacteria 1331
124 Ga0307414_10036980 3300032004 Bacteria 3265
125 Ga0307414_10363461 3300032004 Bacteria 1246
126 Ga0307411_10287255 3300032005 Bacteria 1312
127 Ga0307411_10314697 3300032005 Bacteria 1261
128 Ga0307415_100119289 3300032126 Bacteria 1974
129 Ga0373926_0131417 3300035083 Bacteria 948
130 Ga0373943_0181398 3300035170 Bacteria 1157
131 Ga0373935_0584381 3300035692 Bacteria 816
132 Ga0373947_0046956 3300035725 Bacteria 2587
133 Ga0373937_0011799 3300036401 Bacteria 7669
134 Ga0373925_0013384 3300037068 Bacteria 5937
135 Ga0439439_0013827 3300041406 Bacteria 1959
136 Ga0439453_0001330 3300041408 Bacteria 3145
137 Ga0439449_0083673 3300042007 Unclassified 1177
138 Ga0439450_140936 3300042008 Bacteria 629
139 Ga0439446_0019324 3300042156 Bacteria 1915
140 Ga0439446_0058856 3300042156 Unclassified 1159
141 Ga0439435_0029142 3300042436 Bacteria 1488
142 Ga0466967_0459785 3300045976 Bacteria 1245
143 Ga0495638_0003167 3300046460 Bacteria 13003
144 Ga0495653_0450241 3300046463 Bacteria 810
145 Ga0495586_0098470 3300046535 Bacteria 1621
146 Ga0495674_0137613 3300047319 Bacteria 2054
147 Ga0496100_0435643 3300048903 Bacteria 1003
148 Ga0496102_0130513 3300048905 Bacteria 2351
149 Ga0496106_0151921 3300048909 Bacteria 1827
150 Ga0496108_0158662 3300048911 Bacteria 1954
151 Ga0496108_0191218 3300048911 Bacteria 1774
152 Ga0496112_0043027 3300048915 Bacteria 4421
153 Ga0496112_1051653 3300048915 Unclassified 733
154 Ga0496113_0088825 3300048916 Bacteria 2378
155 Ga0496113_0148364 3300048916 Bacteria 1849
156 Ga0501034_0234470 3300049571 Bacteria 1783
157 Ga0501036_0134118 3300049572 Bacteria 2090
158 Ga0501037_0243075 3300049573 Unclassified 1261
159 Ga0501040_0006745 3300049576 Bacteria 7450
160 Ga0501042_0021275 3300049578 Bacteria 4518
161 Ga0501046_0275992 3300049580 Bacteria 1232
162 Ga0501048_0011914 3300049582 Bacteria 6484
163 Ga0501070_0979374 3300049586 Unclassified 657
164 Ga0501071_0023521 3300049587 Bacteria 4304
165 Ga0501072_0220310 3300049588 Bacteria 1512
166 Ga0501074_0116334 3300049590 Bacteria 1913
167 Ga0501075_0005883 3300049591 Bacteria 8387
168 Ga0501076_0229085 3300049592 Bacteria 1519
169 Ga0501077_0093489 3300049593 Bacteria 1906
170 Ga0501246_026922 3300049676 Unclassified 627
171 Ga0501079_0309340 3300049741 Bacteria 1236
172 Ga0501079_0565898 3300049741 Bacteria 894
173 Ga0501080_1199433 3300049742 Bacteria 652
174 Ga0501081_0063246 3300049743 Bacteria 2568
175 Ga0501045_0318377 3300049824 Bacteria 1157
176 nmdc:mga0yw44_7262_c1 3300050492 Bacteria 5432
177 nmdc:mga0k408_126329_c2 3300050493 Bacteria 797
178 nmdc:mga04h51_100546_c1 3300050495 Bacteria 1053
179 nmdc:mga05p37_202541_c1 3300050507 Bacteria 2403
180 nmdc:mga05p37_7973_c1 3300050507 Bacteria 12501
181 nmdc:mga09592_133751_c1 3300050508 Bacteria 2135
182 nmdc:mga09592_149735_c1 3300050508 Bacteria 2013
183 nmdc:mga0qj67_10087_c1 3300050509 Bacteria 7048
184 nmdc:mga0qj67_27840_c1 3300050509 Bacteria 4383
185 nmdc:mga0qj67_775897_c1 3300050509 Unclassified 760
186 nmdc:mga06r32_173956_c1 3300050510 Bacteria 2137
187 nmdc:mga06r32_224327_c1 3300050510 Bacteria 1868
188 nmdc:mga06r32_25356_c1 3300050510 Bacteria 5516
189 nmdc:mga06r32_585421_c1 3300050510 Bacteria 1088
190 nmdc:mga06r32_73156_c1 3300050510 Bacteria 3320
191 nmdc:mga08y16_425831_c1 3300050511 Bacteria 1356
192 nmdc:mga0n895_22299_c1 3300050512 Bacteria 5936
193 nmdc:mga0rr50_195645_c1 3300050513 Bacteria 1659
194 nmdc:mga0a205_11613_c1 3300050515 Bacteria 8116
195 Ga0495595_0316993 3300053084 Unclassified 785
196 Ga0500641_0031850 3300053096 Bacteria 2081
197 Ga0501084_0208614 3300054114 Bacteria 1648
198 Ga0590071_000083 3300059421 Bacteria 26037
199 Ga0590074_000497 3300059423 Bacteria 5808
200 Ga0590077_000042 3300059426 Bacteria 29090
201 Ga0501082_0028112 3300060353 Bacteria 4846
202 Ga0501082_0410801 3300060353 Bacteria 1182
203 Ga0530510_0023245 3300061734 Bacteria 4415
204 Ga0496110_0710737
205 MBSR1b_contig_10806727
206 Ga0065712_10005994
207 Ga0065712_10086344
208 Ga0065712_10099678
209 Ga0065712_10216331
210 Ga0065715_10239158
211 Ga0070676_10488274
212 Ga0070683_100565992
213 Ga0070670_100031749
214 Ga0070670_100033060
215 Ga0070670_100255914
216 Ga0070670_100613186
217 Ga0070682_101054354
218 Ga0070660_100240319
219 Ga0070660_100455262
220 Ga0070689_100424427
221 Ga0070661_100420259
222 Ga0070661_100437491
223 Ga0070661_100680389
224 Ga0070669_100429338
225 Ga0070675_100090594
226 Ga0070675_101440502
227 Ga0070671_100144255
228 Ga0070674_100053490
229 Ga0070674_100125807
230 Ga0070673_100275238
231 Ga0070659_100085693
232 Ga0070659_100614518
233 Ga0070713_100618641
234 Ga0070711_100681962
235 Ga0070708_100865457
236 Ga0070678_100035446
237 Ga0070678_100401002
238 Ga0070678_101026608
239 Ga0068867_100598540
240 Ga0070706_100633704
241 Ga0070706_100673541
242 Ga0070707_100729592
243 Ga0070672_100350270
244 Ga0070696_100075949
245 Ga0070704_100198100
246 Ga0070664_100385695
247 Ga0070664_100657017
248 Ga0068852_100407706
249 Ga0081455_10367706
250 Ga0075365_10000848
251 Ga0075365_10034124
252 Ga0075368_10117857
253 Ga0075367_10241836
254 Ga0075428_100005322
255 Ga0075428_100017975
256 Ga0075428_100351335
257 Ga0075430_100002192
258 Ga0075430_100004410
259 Ga0075430_100020167
260 Ga0075431_100005306
261 Ga0075431_100100948
262 Ga0075431_100171395
263 Ga0075431_100404633
264 Ga0075434_100004109
265 Ga0075434_100268151
266 Ga0075434_100824915
267 Ga0075429_100102486
268 Ga0075429_100150089
269 Ga0105240_10784234
270 Ga0105240_11335803
271 Ga0111539_10132027
272 Ga0114129_10005595
273 Ga0114129_10012048
274 Ga0105248_10346060
275 Ga0105249_11121791
276 Ga0105246_10240234
277 Ga0157369_10463747
278 Ga0157372_10209425
279 Ga0157372_10524868
280 Ga0157375_10271480
281 Ga0163163_10089101
282 Ga0157376_10791574
283 Ga0206356_11080214
284 Ga0207697_10002800
285 Ga0207682_10228698
286 Ga0207688_10008140
287 Ga0207688_10419343
288 Ga0207684_10409250
289 Ga0207684_10582959
290 Ga0207695_10079430
291 Ga0207695_10898229
292 Ga0207663_10582106
293 Ga0207657_10184809
294 Ga0207649_10370850
295 Ga0207681_10153986
296 Ga0207650_10042348
297 Ga0207650_10466463
298 Ga0207650_11021419
299 Ga0207659_10057460
300 Ga0207659_10554258
301 Ga0207644_10045576
302 Ga0207690_10060059
303 Ga0207690_10539666
304 Ga0207690_10739953
305 Ga0207669_10032429
306 Ga0207679_10470249
307 Ga0207651_10261047
308 Ga0207702_11443823
309 Ga0207648_10580081
310 Ga0207676_10033004
311 Ga0207676_10860918
312 Ga0207674_10889352
313 Ga0207683_10051827
314 Ga0207683_10179406
315 Ga0268266_10065309
316 Ga0307408_100422295
317 Ga0307405_10040415
318 Ga0307413_10268822
319 Ga0307410_10035814
320 Ga0307406_10280918
321 Ga0307407_10025954
322 Ga0307409_100065375
323 Ga0307409_100353637
324 Ga0307416_100030799
325 Ga0307416_100062783
326 Ga0307416_100457156
327 Ga0307414_10036980
328 Ga0307414_10363461
329 Ga0307411_10287255
330 Ga0307411_10314697
331 Ga0307415_100119289
332 Ga0373926_0131417
333 Ga0373943_0181398
334 Ga0373935_0584381
335 Ga0373947_0046956
336 Ga0373937_0011799
337 Ga0373925_0013384
338 Ga0439439_0013827
339 Ga0439453_0001330
340 Ga0439449_0083673
341 Ga0439450_140936
342 Ga0439446_0019324
343 Ga0439446_0058856
344 Ga0439435_0029142
345 Ga0466967_0459785
346 Ga0495638_0003167
347 Ga0495653_0450241
348 Ga0495586_0098470
349 Ga0495674_0137613
350 Ga0496100_0435643
351 Ga0496102_0130513
352 Ga0496106_0151921
353 Ga0496108_0158662
354 Ga0496108_0191218
355 Ga0496112_0043027
356 Ga0496112_1051653
357 Ga0496113_0088825
358 Ga0496113_0148364
359 Ga0501034_0234470
360 Ga0501036_0134118
361 Ga0501037_0243075
362 Ga0501040_0006745
363 Ga0501042_0021275
364 Ga0501046_0275992
365 Ga0501048_0011914
366 Ga0501070_0979374
367 Ga0501071_0023521
368 Ga0501072_0220310
369 Ga0501074_0116334
370 Ga0501075_0005883
371 Ga0501076_0229085
372 Ga0501077_0093489
373 Ga0501246_026922
374 Ga0501079_0309340
375 Ga0501079_0565898
376 Ga0501080_1199433
377 Ga0501081_0063246
378 Ga0501045_0318377
379 nmdc:mga0yw44_7262_c1
380 nmdc:mga0k408_126329_c2
381 nmdc:mga04h51_100546_c1
382 nmdc:mga05p37_202541_c1
383 nmdc:mga05p37_7973_c1
384 nmdc:mga09592_133751_c1
385 nmdc:mga09592_149735_c1
386 nmdc:mga0qj67_10087_c1
387 nmdc:mga0qj67_27840_c1
388 nmdc:mga0qj67_775897_c1
389 nmdc:mga06r32_173956_c1
390 nmdc:mga06r32_224327_c1
391 nmdc:mga06r32_25356_c1
392 nmdc:mga06r32_585421_c1
393 nmdc:mga06r32_73156_c1
394 nmdc:mga08y16_425831_c1
395 nmdc:mga0n895_22299_c1
396 nmdc:mga0rr50_195645_c1
397 nmdc:mga0a205_11613_c1
398 Ga0495595_0316993
399 Ga0500641_0031850
400 Ga0501084_0208614
401 Ga0590071_000083
402 Ga0590074_000497
403 Ga0590077_000042
404 Ga0501082_0028112
405 Ga0501082_0410801
406 Ga0530510_0023245

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16321

Ribosom_S30AE_C

Sigma 54 modulation/S30EA ribosomal protein C terminus

138

194

0.98

PF02482

Ribosomal_S30AE

Sigma 54 modulation protein / S30EA ribosomal protein

20

112

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hei-assembly1.cif.gz_A 2a x-ray structure of hpf from vibrio cholerae 0.941 1 93
4v8h-assembly2.cif.gz_CX crystal structure of hpf bound to the 70s ribosome. 0.9403 1 96
6h4n-assembly1.cif.gz_x structure of a hibernating 100s ribosome reveals an inactive conformation of the ribosomal protein s1 - 70s hibernating e. coli ribosome 0.9329 1 96
3tqm-assembly1.cif.gz_A structure of an ribosomal subunit interface protein from coxiella burnetii 0.9281 1 92
4v8h-assembly2.cif.gz_CX crystal structure of hpf bound to the 70s ribosome. 0.9218 1 96
ID Description Score Start End Superfamily
3v26X00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.9359 1 96 3.30.160.100
2ywqA00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.9233 4 90 3.30.160.100
af_I1KB15_71_175_3.30.160.100 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.9229 2 97 3.30.160.100
af_O05886_21_120_3.30.160.100 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.9215 4 93 3.30.160.100
af_I1KB15_223_272_3.30.505.50 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;Sigma 54 modulation/S30EA ribosomal protein, C-terminal domain 0.9177 132 177 3.30.505.50
ID Description Score Start End GO Terms
AF-A0A2E5Y790-F1-model_v4 Ribosome hibernation promoting factor (Hibernation factor HPF) 0.9567 1 97 GO:0022627
GO:0043024
GO:0045900
AF-A0A380MZ33-F1-model_v4 Ribosome hibernation promoting factor (Hibernation factor HPF) 0.9537 1 95 GO:0022627
GO:0043024
GO:0045900
AF-A0A6B1F2Q0-F1-model_v4 Ribosome hibernation promoting factor 0.9529 1 96 GO:0022627
GO:0043024
GO:0045900
AF-A0A3L7T7T0-F1-model_v4 Ribosome-associated translation inhibitor RaiA 0.9503 1 99 GO:0022627
GO:0043024
GO:0045900
AF-A0A2E3Q633-F1-model_v4 Ribosomal subunit interface protein 0.9461 2 98 GO:0022627
GO:0043024
GO:0045900

Map