F311682

General Info

Members Datasets Scaffolds Average Seq Length
203 149 203 491

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0000001|Ga0496104_0000001_3004_4602
Length 532
Sequence MGVRSPDVSRPASPASTVKRRSPAGARSVAGTPDGLLQVDSQSAEQLRSLSDRDVRSKRPPALSFLLRMDTLRRVVRVLLXXXXDLLGVSLAIFTALALKAVVLSSFDLQRAYDGTREILAFVYLLTALLFARSGLYAERSQRPGLSRIVGSLFQVAFVALLFAVVSGQRFSSFYIFYGSLAFALFYVSSLRYLYERGTAALLRAAGYRRRAILVGTGKHIHDVAHALGDGPRAPIEVVGFVSPNPLSAEGVRRLGSLDCLQGAIAEQRVDEVIIADPDFPQPEAVELVDQCHRRGVRVRIAPSTMEILVHRAEFVPGQSVPLFELGPPVFEGIDFALKRAFDLIGATLLLVLLSPLLAAIVLAVKLSSRGPVLYRSKRPGIGQLPFDCLKFRTMYWDAEHRQAALEELNEADGALFKIRDDPRLTRVGRALRRFSLDELPQLVNVLRGEMSLVGPRPLPERDFEMLEDWHRKRYLVLPGITGLWQVSGRSELDFDDLVHLDFIYLERWSLALDLAILLKTVPAVAMQRGAY

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
75 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
99 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
100 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
147 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.97
Nodule 0
Rhizoplane 16.26
Rhizosphere 77.34
Stem 0
Stem Tuber 0
Unclassified 4.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10011299 3300003203 Bacteria 3923
2 Ga0070682_100041452 3300005337 Bacteria 2838
3 Ga0068868_100025651 3300005338 Bacteria 4486
4 Ga0070660_100000141 3300005339 Bacteria 46136
5 Ga0070660_100012557 3300005339 Bacteria 6052
6 Ga0070659_100000003 3300005366 Bacteria 309142
7 Ga0070713_100048059 3300005436 Bacteria 3511
8 Ga0070701_10053655 3300005438 Bacteria 2099
9 Ga0070711_100008132 3300005439 Bacteria 6413
10 Ga0070705_100019885 3300005440 Bacteria 3541
11 Ga0070663_100032972 3300005455 Bacteria 3575
12 Ga0070678_100000100 3300005456 Bacteria 33228
13 Ga0070662_100086565 3300005457 Bacteria 2344
14 Ga0070681_10004230 3300005458 Bacteria 13602
15 Ga0068867_100094844 3300005459 Bacteria 2270
16 Ga0070679_100003430 3300005530 Bacteria 14515
17 Ga0070679_100154037 3300005530 Bacteria 2274
18 Ga0070684_100065166 3300005535 Bacteria 3197
19 Ga0070696_100136426 3300005546 Bacteria 1789
20 Ga0070665_100001058 3300005548 Bacteria 34437
21 Ga0070704_100045267 3300005549 Bacteria 3061
22 Ga0070664_100006116 3300005564 Bacteria 9740
23 Ga0070664_100123773 3300005564 Bacteria 2266
24 Ga0068856_100086891 3300005614 Bacteria 3108
25 Ga0068866_10016140 3300005718 Bacteria 3332
26 Ga0068861_100166495 3300005719 Bacteria 1823
27 Ga0068860_100040288 3300005843 Bacteria 4465
28 Ga0081455_10009339 3300005937 Bacteria 10095
29 Ga0081538_10002556 3300005981 Bacteria 17689
30 Ga0081538_10028495 3300005981 Bacteria 3839
31 Ga0081540_1003973 3300005983 Bacteria 11485
32 Ga0081539_10001368 3300005985 Bacteria 42269
33 Ga0081539_10001690 3300005985 Bacteria 35584
34 Ga0081539_10004747 3300005985 Bacteria 14685
35 Ga0081539_10031569 3300005985 Bacteria 3262
36 Ga0081539_10045302 3300005985 Bacteria 2531
37 Ga0081539_10052376 3300005985 Bacteria 2293
38 Ga0075365_10108645 3300006038 Bacteria 1905
39 Ga0070712_100000172 3300006175 Bacteria 35623
40 Ga0070712_100007700 3300006175 Bacteria 6737
41 Ga0097621_100003935 3300006237 Bacteria 10290
42 Ga0068871_100004315 3300006358 Bacteria 9876
43 Ga0075430_100001039 3300006846 Bacteria 21945
44 Ga0105240_10008169 3300009093 Bacteria 15007
45 Ga0105247_10006454 3300009101 Bacteria 7263
46 Ga0105243_10025443 3300009148 Bacteria 4523
47 Ga0105241_10011873 3300009174 Bacteria 6400
48 Ga0105242_10012232 3300009176 Bacteria 6606
49 Ga0105237_10003594 3300009545 Bacteria 18335
50 Ga0105249_10136474 3300009553 Bacteria 2348
51 Ga0105239_10230996 3300010375 Bacteria 2075
52 Ga0105246_10081845 3300011119 Bacteria 2303
53 Ga0157378_10004342 3300013297 Bacteria 12470
54 Ga0163162_10231424 3300013306 Bacteria 1978
55 Ga0157376_10008306 3300014969 Bacteria 7484
56 Ga0206356_10537767 3300020070 Bacteria 3039
57 Ga0213876_10004687 3300021384 Bacteria 7618
58 Ga0213876_10059407 3300021384 Bacteria 2018
59 Ga0213875_10000146 3300021388 Bacteria 75051
60 Ga0213875_10022260 3300021388 Bacteria 3033
61 Ga0207642_10042392 3300025899 Bacteria 2000
62 Ga0207688_10014176 3300025901 Bacteria 4337
63 Ga0207654_10037924 3300025911 Bacteria 2700
64 Ga0207707_10088967 3300025912 Bacteria 2698
65 Ga0207695_10008917 3300025913 Bacteria 12487
66 Ga0207671_10007363 3300025914 Bacteria 9559
67 Ga0207693_10000185 3300025915 Bacteria 56784
68 Ga0207663_10005527 3300025916 Bacteria 6375
69 Ga0207660_10021936 3300025917 Bacteria 4299
70 Ga0207657_10000109 3300025919 Bacteria 80516
71 Ga0207657_10025027 3300025919 Bacteria 5514
72 Ga0207700_10026527 3300025928 Bacteria 4041
73 Ga0207690_10000021 3300025932 Bacteria 217710
74 Ga0207690_10062417 3300025932 Bacteria 2536
75 Ga0207706_10054760 3300025933 Bacteria 3520
76 Ga0207709_10070307 3300025935 Bacteria 2219
77 Ga0207711_10054609 3300025941 Bacteria 3429
78 Ga0207661_10097640 3300025944 Bacteria 2460
79 Ga0207679_10102644 3300025945 Bacteria 2240
80 Ga0207703_10022057 3300026035 Bacteria 4990
81 Ga0207678_10054534 3300026067 Bacteria 3443
82 Ga0207708_10066214 3300026075 Bacteria 2762
83 Ga0207702_10082107 3300026078 Bacteria 2802
84 Ga0207675_100211918 3300026118 Bacteria 1864
85 Ga0207683_10000380 3300026121 Bacteria 40971
86 Ga0207683_10081346 3300026121 Bacteria 2875
87 Ga0268266_10012879 3300028379 Bacteria 7221
88 Ga0268266_10072509 3300028379 Bacteria 2987
89 Ga0268264_10028116 3300028381 Bacteria 4598
90 Ga0265337_1003519 3300028556 Bacteria 6764
91 Ga0265326_10000538 3300028558 Bacteria 14355
92 Ga0265319_1000769 3300028563 Bacteria 20833
93 Ga0265336_10000019 3300028666 Bacteria 218636
94 Ga0265338_10000272 3300028800 Bacteria 94567
95 Ga0265320_10037641 3300031240 Bacteria 2436
96 Ga0265340_10000004 3300031247 Bacteria 218649
97 Ga0265327_10001901 3300031251 Bacteria 24126
98 Ga0265316_10008842 3300031344 Bacteria 9302
99 Ga0307408_100066770 3300031548 Bacteria 2643
100 Ga0307405_10086465 3300031731 Bacteria 2064
101 Ga0307413_10044588 3300031824 Bacteria 2622
102 Ga0307410_10022731 3300031852 Bacteria 3883
103 Ga0307406_10092901 3300031901 Bacteria 2036
104 Ga0307407_10078293 3300031903 Bacteria 1991
105 Ga0307407_10089291 3300031903 Bacteria 1885
106 Ga0307409_100094790 3300031995 Bacteria 2457
107 Ga0307416_100175696 3300032002 Bacteria 2000
108 Ga0307416_100198150 3300032002 Bacteria 1902
109 Ga0307414_10137745 3300032004 Bacteria 1906
110 Ga0307415_100028383 3300032126 Bacteria 3559
111 Ga0307415_100103346 3300032126 Bacteria 2096
112 Ga0395900_0284301 3300037418 Bacteria 1645
113 Ga0395900_0295792 3300037418 Bacteria 1606
114 Ga0395898_0185324 3300037466 Bacteria 1989
115 Ga0436364_0942527 3300037853 Bacteria 46992
116 Ga0436364_1108923 3300037853 Bacteria 4784
117 Ga0395901_0039706 3300038443 Bacteria 4872
118 Ga0395901_0320415 3300038443 Bacteria 1604
119 Ga0436365_0350652 3300039437 Bacteria 2859
120 Ga0436365_1331607 3300039437 Bacteria 3731
121 Ga0451791_0376386 3300041451 Bacteria 1757
122 Ga0451837_1383537 3300041494 Bacteria 1948
123 Ga0439463_006777 3300042016 Bacteria 2834
124 Ga0466966_0022109 3300044684 Bacteria 4176
125 Ga0466961_0030900 3300044693 Bacteria 3442
126 Ga0466961_0119380 3300044693 Bacteria 1656
127 Ga0466963_0010342 3300044694 Bacteria 5647
128 Ga0466963_0017432 3300044694 Bacteria 4477
129 Ga0466968_0050199 3300044735 Bacteria 1779
130 Ga0466960_0000245 3300044901 Bacteria 18825
131 Ga0466960_0024815 3300044901 Bacteria 2708
132 Ga0466960_0028591 3300044901 Bacteria 2552
133 Ga0466959_0003454 3300045049 Bacteria 10340
134 Ga0466959_0101059 3300045049 Bacteria 2064
135 Ga0466958_0018175 3300045836 Bacteria 4075
136 Ga0466958_0037910 3300045836 Bacteria 2890
137 Ga0466958_0051318 3300045836 Bacteria 2497
138 Ga0466967_0018272 3300045976 Bacteria 5598
139 Ga0466967_0025706 3300045976 Bacteria 4858
140 Ga0466967_0039025 3300045976 Bacteria 4079
141 Ga0495653_0000576 3300046463 Bacteria 28174
142 Ga0495650_0000012 3300046471 Bacteria 613144
143 Ga0495664_0000133 3300046477 Bacteria 37867
144 Ga0495618_0000023 3300046514 Bacteria 123643
145 Ga0495630_0000540 3300046517 Bacteria 27715
146 Ga0495645_0000043 3300046543 Bacteria 91036
147 Ga0495645_0009603 3300046543 Bacteria 6766
148 Ga0495657_0000021 3300046675 Bacteria 153590
149 Ga0495658_0031673 3300046683 Bacteria 2882
150 Ga0495600_0047165 3300046809 Bacteria 2810
151 Ga0495604_0000813 3300047317 Bacteria 26163
152 Ga0495672_0008935 3300047320 Bacteria 7317
153 Ga0495676_0017262 3300047321 Bacteria 6386
154 Ga0495684_0001445 3300047471 Bacteria 19013
155 Ga0495684_0015105 3300047471 Bacteria 5947
156 Ga0496100_0002590 3300048903 Bacteria 9216
157 Ga0496100_0014044 3300048903 Bacteria 4640
158 Ga0496100_0049047 3300048903 Bacteria 2728
159 Ga0496102_0000091 3300048905 Bacteria 127153
160 Ga0496102_0009650 3300048905 Bacteria 8302
161 Ga0496103_0000665 3300048906 Bacteria 25877
162 Ga0496104_0000001 3300048907 Bacteria 711867
163 Ga0496104_0002182 3300048907 Bacteria 16964
164 Ga0496104_0027177 3300048907 Bacteria 5294
165 Ga0496104_0031924 3300048907 Bacteria 4900
166 Ga0496104_0071643 3300048907 Bacteria 3295
167 Ga0496105_0010270 3300048908 Bacteria 7361
168 Ga0496105_0011393 3300048908 Bacteria 7024
169 Ga0496105_0120342 3300048908 Bacteria 2165
170 Ga0496106_0017831 3300048909 Bacteria 5249
171 Ga0496106_0112374 3300048909 Bacteria 2123
172 Ga0496107_0001806 3300048910 Bacteria 13500
173 Ga0496107_0019491 3300048910 Bacteria 4786
174 Ga0496109_0007724 3300048912 Bacteria 9108
175 Ga0496110_0000034 3300048913 Bacteria 65177
176 Ga0496110_0068659 3300048913 Bacteria 3137
177 Ga0496110_0088958 3300048913 Bacteria 2759
178 Ga0496111_0000468 3300048914 Bacteria 20561
179 Ga0496111_0030117 3300048914 Bacteria 3859
180 Ga0496112_0081043 3300048915 Bacteria 3209
181 Ga0496112_0142275 3300048915 Bacteria 2368
182 Ga0496112_0259798 3300048915 Bacteria 1686
183 Ga0496113_0010239 3300048916 Bacteria 6192
184 Ga0496114_0008346 3300048917 Bacteria 8206
185 Ga0496115_0000053 3300048918 Bacteria 106425
186 Ga0496115_0000270 3300048918 Bacteria 45613
187 Ga0496115_0108752 3300048918 Bacteria 2276
188 Ga0501034_0056429 3300049571 Bacteria 3952
189 Ga0501042_0042838 3300049578 Bacteria 3223
190 Ga0501043_0003256 3300049579 Bacteria 13388
191 Ga0501047_0027204 3300049581 Bacteria 5509
192 Ga0501048_0058692 3300049582 Bacteria 2727
193 Ga0501080_0009241 3300049742 Bacteria 8985
194 Ga0501080_0118863 3300049742 Bacteria 2450
195 Ga0501035_0014996 3300049822 Bacteria 7151
196 Ga0501044_0006509 3300049823 Bacteria 12904
197 nmdc:mga0qj67_3440_c1 3300050509 Bacteria 11408
198 Ga0495601_0002665 3300053077 Bacteria 10120
199 Ga0495612_0000037 3300053078 Bacteria 64138
200 Ga0500556_0000471 3300053104 Bacteria 28323
201 Ga0500616_0013613 3300053153 Bacteria 4714
202 Ga0500616_0018375 3300053153 Bacteria 3954
203 Ga0501082_0011421 3300060353 Bacteria 7640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100041452 Ga0070682_1000414522 428
2 3300005438 Ga0070701_10053655 Ga0070701_100536552 428
3 3300005455 Ga0070663_100032972 Ga0070663_1000329722 428
4 3300005456 Ga0070678_100000100 Ga0070678_10000010015 428
5 3300005549 Ga0070704_100045267 Ga0070704_1000452672 428
6 3300009101 Ga0105247_10006454 Ga0105247_100064545 428
7 3300009174 Ga0105241_10011873 Ga0105241_100118732 428
8 3300009176 Ga0105242_10012232 Ga0105242_100122322 428
9 3300013297 Ga0157378_10004342 Ga0157378_100043426 428
10 3300014969 Ga0157376_10008306 Ga0157376_100083064 428
11 3300025899 Ga0207642_10042392 Ga0207642_100423922 428
12 3300048903 Ga0496100_0002590 Ga0496100_0002590_5634_7013 428
13 3300048905 Ga0496102_0009650 Ga0496102_0009650_867_2246 428
14 3300048907 Ga0496104_0002182 Ga0496104_0002182_6707_8086 428
15 3300048908 Ga0496105_0011393 Ga0496105_0011393_2966_4345 428
16 3300048909 Ga0496106_0017831 Ga0496106_0017831_2731_4110 428
17 3300048910 Ga0496107_0001806 Ga0496107_0001806_6354_7733 428
18 3300048915 Ga0496112_0259798 Ga0496112_0259798_122_1501 428
19 3300048917 Ga0496114_0008346 Ga0496114_0008346_6456_7835 428
20 3300048918 Ga0496115_0108752 Ga0496115_0108752_501_1880 428
21 3300037466 Ga0395898_0185324 Ga0395898_0185324_590_1945 430
22 3300005530 Ga0070679_100154037 Ga0070679_1001540372 434
23 3300047317 Ga0495604_0000813 Ga0495604_0000813_21631_23073 440
24 3300005339 Ga0070660_100000141 Ga0070660_10000014142 443
25 3300005458 Ga0070681_10004230 Ga0070681_1000423011 443
26 3300005530 Ga0070679_100003430 Ga0070679_10000343014 443
27 3300005546 Ga0070696_100136426 Ga0070696_1001364262 443
28 3300025912 Ga0207707_10088967 Ga0207707_100889672 443
29 3300025917 Ga0207660_10021936 Ga0207660_100219363 443
30 3300025919 Ga0207657_10000109 Ga0207657_1000010951 443
31 3300049581 Ga0501047_0027204 Ga0501047_0027204_806_2221 448
32 3300046463 Ga0495653_0000576 Ga0495653_0000576_3029_4444 449
33 3300005436 Ga0070713_100048059 Ga0070713_1000480593 450
34 3300025928 Ga0207700_10026527 Ga0207700_100265273 450
35 3300042016 Ga0439463_006777 Ga0439463_006777_186_1604 451
36 3300045976 Ga0466967_0039025 Ga0466967_0039025_2166_3599 451
37 3300037418 Ga0395900_0295792 Ga0395900_0295792_85_1518 453
38 3300041451 Ga0451791_0376386 Ga0451791_0376386_114_1664 453
39 3300006175 Ga0070712_100000172 Ga0070712_1000001724 454
40 3300025915 Ga0207693_10000185 Ga0207693_1000018548 454
41 3300039437 Ga0436365_0350652 Ga0436365_0350652_56_1516 456
42 3300005366 Ga0070659_100000003 Ga0070659_100000003191 457
43 3300005564 Ga0070664_100006116 Ga0070664_1000061162 457
44 3300020070 Ga0206356_10537767 Ga0206356_105377672 457
45 3300021388 Ga0213875_10022260 Ga0213875_100222602 457
46 3300025932 Ga0207690_10000021 Ga0207690_10000021142 457
47 3300046477 Ga0495664_0000133 Ga0495664_0000133_3384_4823 457
48 3300046809 Ga0495600_0047165 Ga0495600_0047165_109_1548 457
49 3300048903 Ga0496100_0049047 Ga0496100_0049047_666_2183 457
50 3300048905 Ga0496102_0000091 Ga0496102_0000091_25445_26884 457
51 3300048906 Ga0496103_0000665 Ga0496103_0000665_21584_23023 457
52 3300048907 Ga0496104_0031924 Ga0496104_0031924_1744_3261 457
53 3300048908 Ga0496105_0120342 Ga0496105_0120342_275_1792 457
54 3300048912 Ga0496109_0007724 Ga0496109_0007724_6533_8050 457
55 3300048913 Ga0496110_0068659 Ga0496110_0068659_746_2263 457
56 3300005719 Ga0068861_100166495 Ga0068861_1001664952 458
57 3300005981 Ga0081538_10028495 Ga0081538_100284951 458
58 3300026118 Ga0207675_100211918 Ga0207675_1002119182 458
59 3300009093 Ga0105240_10008169 Ga0105240_100081697 459
60 3300025913 Ga0207695_10008917 Ga0207695_100089175 459
61 3300046543 Ga0495645_0000043 Ga0495645_0000043_18305_19786 459
62 3300025932 Ga0207690_10062417 Ga0207690_100624171 462
63 3300038443 Ga0395901_0320415 Ga0395901_0320415_51_1505 462
64 3300005614 Ga0068856_100086891 Ga0068856_1000868912 463
65 3300021388 Ga0213875_10000146 Ga0213875_1000014657 463
66 3300026078 Ga0207702_10082107 Ga0207702_100821072 463
67 3300037853 Ga0436364_0942527 Ga0436364_0942527_30390_31916 463
68 3300005440 Ga0070705_100019885 Ga0070705_1000198853 465
69 3300005535 Ga0070684_100065166 Ga0070684_1000651662 465
70 3300005718 Ga0068866_10016140 Ga0068866_100161402 465
71 3300005843 Ga0068860_100040288 Ga0068860_1000402883 465
72 3300006237 Ga0097621_100003935 Ga0097621_1000039355 465
73 3300006358 Ga0068871_100004315 Ga0068871_1000043153 465
74 3300011119 Ga0105246_10081845 Ga0105246_100818452 465
75 3300025911 Ga0207654_10037924 Ga0207654_100379242 465
76 3300025941 Ga0207711_10054609 Ga0207711_100546092 465
77 3300025944 Ga0207661_10097640 Ga0207661_100976402 465
78 3300026035 Ga0207703_10022057 Ga0207703_100220573 465
79 3300026067 Ga0207678_10054534 Ga0207678_100545342 465
80 3300026121 Ga0207683_10000380 Ga0207683_1000038016 465
81 3300028381 Ga0268264_10028116 Ga0268264_100281163 465
82 3300048914 Ga0496111_0030117 Ga0496111_0030117_765_2282 465
83 3300044901 Ga0466960_0028591 Ga0466960_0028591_129_1658 466
84 3300049578 Ga0501042_0042838 Ga0501042_0042838_58_1524 466
85 3300049579 Ga0501043_0003256 Ga0501043_0003256_2457_3923 466
86 3300049582 Ga0501048_0058692 Ga0501048_0058692_1170_2636 466
87 3300049742 Ga0501080_0118863 Ga0501080_0118863_558_2024 466
88 3300049822 Ga0501035_0014996 Ga0501035_0014996_691_2157 466
89 3300049823 Ga0501044_0006509 Ga0501044_0006509_1158_2624 466
90 3300060353 Ga0501082_0011421 Ga0501082_0011421_853_2319 466
91 3300041494 Ga0451837_1383537 Ga0451837_1383537_298_1848 467
92 3300044735 Ga0466968_0050199 Ga0466968_0050199_56_1546 467
93 3300005439 Ga0070711_100008132 Ga0070711_1000081323 468
94 3300009545 Ga0105237_10003594 Ga0105237_1000359412 468
95 3300025916 Ga0207663_10005527 Ga0207663_100055277 468
96 3300028556 Ga0265337_1003519 Ga0265337_10035195 468
97 3300028558 Ga0265326_10000538 Ga0265326_1000053811 468
98 3300028563 Ga0265319_1000769 Ga0265319_100076914 468
99 3300028666 Ga0265336_10000019 Ga0265336_10000019123 468
100 3300028800 Ga0265338_10000272 Ga0265338_1000027275 468
101 3300031240 Ga0265320_10037641 Ga0265320_100376412 468
102 3300031247 Ga0265340_10000004 Ga0265340_10000004123 468
103 3300031344 Ga0265316_10008842 Ga0265316_100088427 468
104 3300046514 Ga0495618_0000023 Ga0495618_0000023_62150_63631 468
105 3300046517 Ga0495630_0000540 Ga0495630_0000540_26051_27532 468
106 3300046675 Ga0495657_0000021 Ga0495657_0000021_23852_25333 468
107 3300047471 Ga0495684_0015105 Ga0495684_0015105_3015_4496 468
108 3300048903 Ga0496100_0014044 Ga0496100_0014044_387_1868 468
109 3300048918 Ga0496115_0000053 Ga0496115_0000053_20089_21570 468
110 3300048918 Ga0496115_0000270 Ga0496115_0000270_25705_27186 468
111 3300053077 Ga0495601_0002665 Ga0495601_0002665_3028_4509 468
112 3300053078 Ga0495612_0000037 Ga0495612_0000037_54768_56249 468
113 3300045836 Ga0466958_0051318 Ga0466958_0051318_335_1852 469
114 3300005457 Ga0070662_100086565 Ga0070662_1000865652 470
115 3300005564 Ga0070664_100123773 Ga0070664_1001237732 470
116 3300006175 Ga0070712_100007700 Ga0070712_1000077002 470
117 3300025933 Ga0207706_10054760 Ga0207706_100547603 470
118 3300025945 Ga0207679_10102644 Ga0207679_101026442 470
119 3300031731 Ga0307405_10086465 Ga0307405_100864652 470
120 3300031903 Ga0307407_10089291 Ga0307407_100892911 470
121 3300032002 Ga0307416_100198150 Ga0307416_1001981502 470
122 3300013306 Ga0163162_10231424 Ga0163162_102314242 471
123 3300025914 Ga0207671_10007363 Ga0207671_100073635 471
124 3300044901 Ga0466960_0000245 Ga0466960_0000245_1332_2849 471
125 3300044901 Ga0466960_0024815 Ga0466960_0024815_594_2156 471
126 3300046471 Ga0495650_0000012 Ga0495650_0000012_446259_447773 471
127 3300046543 Ga0495645_0009603 Ga0495645_0009603_3260_4753 471
128 3300047471 Ga0495684_0001445 Ga0495684_0001445_3071_4603 471
129 3300049571 Ga0501034_0056429 Ga0501034_0056429_553_2115 471
130 3300053153 Ga0500616_0013613 Ga0500616_0013613_2976_4490 471
131 3300005937 Ga0081455_10009339 Ga0081455_100093392 472
132 3300031251 Ga0265327_10001901 Ga0265327_1000190121 472
133 3300032126 Ga0307415_100103346 Ga0307415_1001033462 472
134 3300046683 Ga0495658_0031673 Ga0495658_0031673_809_2407 472
135 3300047321 Ga0495676_0017262 Ga0495676_0017262_3734_5332 472
136 3300049742 Ga0501080_0009241 Ga0501080_0009241_7143_8648 472
137 3300006846 Ga0075430_100001039 Ga0075430_1000010392 473
138 3300050509 nmdc:mga0qj67_3440_c1 nmdc:mga0qj67_3440_c1_8922_10439 473
139 3300005338 Ga0068868_100025651 Ga0068868_1000256512 475
140 3300005339 Ga0070660_100012557 Ga0070660_1000125576 475
141 3300005983 Ga0081540_1003973 Ga0081540_10039739 475
142 3300005985 Ga0081539_10004747 Ga0081539_1000474712 475
143 3300006038 Ga0075365_10108645 Ga0075365_101086452 475
144 3300009148 Ga0105243_10025443 Ga0105243_100254432 475
145 3300009553 Ga0105249_10136474 Ga0105249_101364742 475
146 3300010375 Ga0105239_10230996 Ga0105239_102309962 475
147 3300025901 Ga0207688_10014176 Ga0207688_100141763 475
148 3300025919 Ga0207657_10025027 Ga0207657_100250274 475
149 3300025935 Ga0207709_10070307 Ga0207709_100703072 475
150 3300053104 Ga0500556_0000471 Ga0500556_0000471_12539_14086 475
151 3300053153 Ga0500616_0018375 Ga0500616_0018375_293_1840 475
152 3300005548 Ga0070665_100001058 Ga0070665_10000105835 476
153 3300005981 Ga0081538_10002556 Ga0081538_1000255617 476
154 3300005985 Ga0081539_10001368 Ga0081539_1000136841 476
155 3300005985 Ga0081539_10045302 Ga0081539_100453023 476
156 3300005985 Ga0081539_10052376 Ga0081539_100523762 476
157 3300028379 Ga0268266_10012879 Ga0268266_100128791 476
158 3300031548 Ga0307408_100066770 Ga0307408_1000667702 476
159 3300031824 Ga0307413_10044588 Ga0307413_100445882 476
160 3300031852 Ga0307410_10022731 Ga0307410_100227313 476
161 3300031901 Ga0307406_10092901 Ga0307406_100929012 476
162 3300031903 Ga0307407_10078293 Ga0307407_100782931 476
163 3300032004 Ga0307414_10137745 Ga0307414_101377451 476
164 3300005985 Ga0081539_10031569 Ga0081539_100315692 477
165 3300021384 Ga0213876_10004687 Ga0213876_100046875 477
166 3300021384 Ga0213876_10059407 Ga0213876_100594072 477
167 3300028379 Ga0268266_10072509 Ga0268266_100725092 477
168 3300031995 Ga0307409_100094790 Ga0307409_1000947902 477
169 3300032002 Ga0307416_100175696 Ga0307416_1001756962 477
170 3300032126 Ga0307415_100028383 Ga0307415_1000283834 477
171 3300037853 Ga0436364_1108923 Ga0436364_1108923_1545_3068 477
172 3300039437 Ga0436365_1331607 Ga0436365_1331607_1145_2668 477
173 3300044684 Ga0466966_0022109 Ga0466966_0022109_1483_3003 477
174 3300044693 Ga0466961_0030900 Ga0466961_0030900_630_2150 477
175 3300044694 Ga0466963_0010342 Ga0466963_0010342_1502_3022 477
176 3300045049 Ga0466959_0003454 Ga0466959_0003454_1647_3167 477
177 3300045836 Ga0466958_0018175 Ga0466958_0018175_269_1789 477
178 3300045836 Ga0466958_0037910 Ga0466958_0037910_1340_2860 477
179 3300045976 Ga0466967_0018272 Ga0466967_0018272_662_2182 477
180 3300047320 Ga0495672_0008935 Ga0495672_0008935_3471_5009 477
181 3300045049 Ga0466959_0101059 Ga0466959_0101059_197_1735 478
182 3300037418 Ga0395900_0284301 Ga0395900_0284301_49_1584 480
183 3300044693 Ga0466961_0119380 Ga0466961_0119380_71_1612 480
184 3300048907 Ga0496104_0000001 Ga0496104_0000001_3004_4602 480
185 3300048907 Ga0496104_0027177 Ga0496104_0027177_1932_3467 480
186 3300048907 Ga0496104_0071643 Ga0496104_0071643_662_2197 480
187 3300048908 Ga0496105_0010270 Ga0496105_0010270_1803_3338 480
188 3300048909 Ga0496106_0112374 Ga0496106_0112374_573_2108 480
189 3300048910 Ga0496107_0019491 Ga0496107_0019491_504_2039 480
190 3300048913 Ga0496110_0000034 Ga0496110_0000034_51403_53001 480
191 3300048913 Ga0496110_0088958 Ga0496110_0088958_843_2378 480
192 3300048914 Ga0496111_0000468 Ga0496111_0000468_2657_4255 480
193 3300048915 Ga0496112_0081043 Ga0496112_0081043_368_1903 480
194 3300048915 Ga0496112_0142275 Ga0496112_0142275_297_1832 480
195 3300048916 Ga0496113_0010239 Ga0496113_0010239_2493_4028 480
196 3300003203 JGI25406J46586_10011299 JGI25406J46586_100112995 481
197 3300005459 Ga0068867_100094844 Ga0068867_1000948442 481
198 3300005985 Ga0081539_10001690 Ga0081539_1000169027 481
199 3300026075 Ga0207708_10066214 Ga0207708_100662142 481
200 3300026121 Ga0207683_10081346 Ga0207683_100813462 481
201 3300038443 Ga0395901_0039706 Ga0395901_0039706_2499_4022 481
202 3300044694 Ga0466963_0017432 Ga0466963_0017432_1735_3252 481
203 3300045976 Ga0466967_0025706 Ga0466967_0025706_274_1794 481

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02397

Bac_transf

Bacterial sugar transferase

339

527

0.95

PF13727

CoA_binding_3

CoA-binding domain

133

303

0.66

Feature Viewer

pLDDT pTM Quality
70.39 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map