F311578

General Info

Members Datasets Scaffolds Average Seq Length
203 141 406 250

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0165191|Ga0466958_0165191_25_912
Length 290
Sequence LGAAAHLVAVCQGAKSLHRPAILSAAAADRETFARQCRSNLEMSSKPSYLAVVPAYNESASIVGVVESLRERAPDFDVLVVDDGSTDDTAAMARLAGARVLKLPFNLGIGGAVQAGFVFAHDHHYDYMAQVDGDGQHEPAELRKLIAEMKCPPHPDMVCGSRFLSDDYHYPAPVSRRTGIHIFASLLSRIVSQRVSDPTSGFRLYNRRAIELFAHDYEVEAVLMLHHHRLRMREIPVKMYTRTGGVSSISSGKSAYYMVKVLLAVLVGLARRRPVIEPGDGAPVTAEQGV

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
94 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
95 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
98 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
99 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0
Rhizoplane 6.4
Rhizosphere 87.19
Stem 0
Stem Tuber 0
Unclassified 2.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0165191 3300045836 Bacteria 1400
2 LJQas_1004734 3300000549 Bacteria 1759
3 JGI24744J21845_10004720 3300002077 Bacteria 2815
4 JGI25406J46586_10028427 3300003203 Bacteria 2131
5 JGI25407J50210_10006660 3300003373 Bacteria 2883
6 JGI25407J50210_10008405 3300003373 Bacteria 2602
7 Ga0070658_10297031 3300005327 Bacteria 1377
8 Ga0068869_100056904 3300005334 Bacteria 2853
9 Ga0070680_100246157 3300005336 Bacteria 1511
10 Ga0070682_100011633 3300005337 Bacteria 5033
11 Ga0068868_100032900 3300005338 Bacteria 3992
12 Ga0068868_100087625 3300005338 Bacteria 2504
13 Ga0068868_100422085 3300005338 Bacteria 1155
14 Ga0070689_100181639 3300005340 Bacteria 1709
15 Ga0070674_100022880 3300005356 Bacteria 4035
16 Ga0070709_10079340 3300005434 Bacteria 2138
17 Ga0070714_100419999 3300005435 Bacteria 1267
18 Ga0070662_100377504 3300005457 Bacteria 1166
19 Ga0070684_100235888 3300005535 Bacteria 1671
20 Ga0070695_100255592 3300005545 Bacteria 1277
21 Ga0068854_100324205 3300005578 Bacteria 1253
22 Ga0068856_100105134 3300005614 Bacteria 2817
23 Ga0068859_100308765 3300005617 Bacteria 1675
24 Ga0068861_100419087 3300005719 Bacteria 1192
25 Ga0081455_10249251 3300005937 Bacteria 1300
26 Ga0081538_10000137 3300005981 Bacteria 75608
27 Ga0081538_10001665 3300005981 Bacteria 22709
28 Ga0081538_10001698 3300005981 Bacteria 22437
29 Ga0081538_10002409 3300005981 Bacteria 18362
30 Ga0081538_10014826 3300005981 Bacteria 6076
31 Ga0081538_10099161 3300005981 Bacteria 1473
32 Ga0081539_10003593 3300005985 Bacteria 18760
33 Ga0081539_10041687 3300005985 Bacteria 2681
34 Ga0075428_100088907 3300006844 Bacteria 3370
35 Ga0075428_100093356 3300006844 Bacteria 3281
36 Ga0075428_100719767 3300006844 Unclassified 1063
37 Ga0075434_100438127 3300006871 Bacteria 1328
38 Ga0075429_100162645 3300006880 Bacteria 1955
39 Ga0068865_100038308 3300006881 Bacteria 3244
40 Ga0097620_100308761 3300006931 Bacteria 1675
41 Ga0105240_10000538 3300009093 Bacteria 70068
42 Ga0105240_10007914 3300009093 Bacteria 15331
43 Ga0111539_10007691 3300009094 Bacteria 13758
44 Ga0111539_10468003 3300009094 Bacteria 1468
45 Ga0105245_10033392 3300009098 Bacteria 4561
46 Ga0105245_10304293 3300009098 Bacteria 1565
47 Ga0105247_10129410 3300009101 Bacteria 1644
48 Ga0114129_10059965 3300009147 Bacteria 5320
49 Ga0114129_11201492 3300009147 Bacteria 944
50 Ga0105243_10022319 3300009148 Bacteria 4809
51 Ga0105243_10166594 3300009148 Bacteria 1905
52 Ga0105242_10169574 3300009176 Bacteria 1917
53 Ga0105242_10494469 3300009176 Bacteria 1162
54 Ga0105237_10000608 3300009545 Bacteria 49978
55 Ga0105249_10111047 3300009553 Bacteria 2592
56 Ga0157374_10006638 3300013296 Bacteria 9829
57 Ga0163162_10272375 3300013306 Bacteria 1825
58 Ga0157372_10108656 3300013307 Bacteria 3175
59 Ga0213876_10012826 3300021384 Bacteria 4456
60 Ga0213876_10016397 3300021384 Bacteria 3917
61 Ga0213875_10000150 3300021388 Bacteria 73975
62 Ga0213875_10007794 3300021388 Bacteria 5501
63 Ga0207699_10243452 3300025906 Bacteria 1237
64 Ga0207684_10538152 3300025910 Bacteria 1000
65 Ga0207695_10003897 3300025913 Bacteria 20644
66 Ga0207695_10062265 3300025913 Bacteria 3852
67 Ga0207671_10004826 3300025914 Bacteria 12700
68 Ga0207657_10217260 3300025919 Bacteria 1533
69 Ga0207652_10301328 3300025921 Bacteria 1446
70 Ga0207687_10074947 3300025927 Bacteria 2427
71 Ga0207664_10038820 3300025929 Bacteria 3694
72 Ga0207644_10229083 3300025931 Bacteria 1476
73 Ga0207709_10029829 3300025935 Bacteria 3168
74 Ga0207709_10180145 3300025935 Bacteria 1491
75 Ga0207670_10136636 3300025936 Bacteria 1803
76 Ga0207669_10032964 3300025937 Bacteria 2917
77 Ga0207669_10300682 3300025937 Bacteria 1219
78 Ga0207669_10464311 3300025937 Bacteria 1006
79 Ga0207704_10014451 3300025938 Bacteria 3986
80 Ga0207661_10007343 3300025944 Bacteria 7841
81 Ga0207640_10019129 3300025981 Bacteria 4040
82 Ga0207677_10085995 3300026023 Bacteria 2271
83 Ga0207708_10027794 3300026075 Bacteria 4284
84 Ga0207708_10224523 3300026075 Bacteria 1506
85 Ga0207702_10080961 3300026078 Bacteria 2819
86 Ga0207648_10085209 3300026089 Bacteria 2757
87 Ga0207676_10456927 3300026095 Bacteria 1205
88 Ga0207675_100022731 3300026118 Bacteria 5834
89 Ga0207675_100481718 3300026118 Bacteria 1233
90 Ga0207428_10072108 3300027907 Bacteria 2712
91 Ga0307408_100072236 3300031548 Bacteria 2554
92 Ga0307410_10210318 3300031852 Bacteria 1490
93 Ga0307406_10090856 3300031901 Bacteria 2056
94 Ga0307406_10188331 3300031901 Bacteria 1508
95 Ga0307407_10065762 3300031903 Bacteria 2136
96 Ga0307407_10072203 3300031903 Bacteria 2058
97 Ga0307416_100171853 3300032002 Bacteria 2019
98 Ga0307411_10392350 3300032005 Bacteria 1145
99 Ga0307415_100260866 3300032126 Bacteria 1414
100 Ga0307415_100410574 3300032126 Bacteria 1159
101 Ga0395899_0160645 3300037312 Bacteria 1588
102 Ga0395900_0056545 3300037418 Bacteria 4038
103 Ga0395898_0013037 3300037466 Bacteria 8564
104 Ga0395898_0202949 3300037466 Bacteria 1892
105 Ga0395898_0380539 3300037466 Bacteria 1346
106 Ga0395898_0478218 3300037466 Bacteria 1185
107 Ga0395905_0055947 3300037471 Bacteria 3692
108 Ga0436364_0143007 3300037853 Unclassified 3394
109 Ga0436364_0169833 3300037853 Bacteria 83429
110 Ga0436364_0443454 3300037853 Bacteria 3916
111 Ga0436364_0566835 3300037853 Unclassified 1139
112 Ga0395901_0007916 3300038443 Bacteria 10722
113 Ga0395901_0144321 3300038443 Bacteria 2502
114 Ga0395901_0713774 3300038443 Bacteria 999
115 Ga0436365_1370684 3300039437 Bacteria 10172
116 Ga0436365_1933077 3300039437 Bacteria 10129
117 Ga0466969_0027970 3300044656 Unclassified 2885
118 Ga0466965_0227665 3300044683 Bacteria 995
119 Ga0466965_0281736 3300044683 Bacteria 898
120 Ga0466961_0002845 3300044693 Bacteria 10731
121 Ga0466963_0002030 3300044694 Bacteria 11133
122 Ga0466963_0058815 3300044694 Bacteria 2564
123 Ga0466963_0091109 3300044694 Bacteria 2076
124 Ga0466963_0160346 3300044694 Bacteria 1565
125 Ga0466971_0046597 3300044719 Bacteria 1948
126 Ga0466968_0069039 3300044735 Unclassified 1536
127 Ga0466968_0109834 3300044735 Bacteria 1239
128 Ga0466968_0177963 3300044735 Bacteria 988
129 Ga0466957_0161664 3300044842 Bacteria 1455
130 Ga0466960_0055309 3300044901 Bacteria 1930
131 Ga0466959_0002248 3300045049 Bacteria 12297
132 Ga0466958_0010361 3300045836 Bacteria 5220
133 Ga0466967_0005456 3300045976 Bacteria 8819
134 Ga0466967_0007259 3300045976 Bacteria 7971
135 Ga0466967_0008449 3300045976 Bacteria 7547
136 Ga0466967_0030741 3300045976 Bacteria 4509
137 Ga0466967_0098832 3300045976 Bacteria 2665
138 Ga0466967_0154490 3300045976 Bacteria 2148
139 Ga0466967_0245630 3300045976 Bacteria 1708
140 Ga0466967_0258476 3300045976 Bacteria 1666
141 Ga0466967_0530152 3300045976 Bacteria 1158
142 Ga0495603_0005016 3300046455 Bacteria 7918
143 Ga0495582_0015194 3300046473 Bacteria 4234
144 Ga0495594_0003934 3300046499 Bacteria 7643
145 Ga0495666_0049334 3300046526 Bacteria 2025
146 Ga0495647_0057110 3300046681 Bacteria 1531
147 Ga0495581_0015717 3300047315 Bacteria 4394
148 Ga0495676_0084693 3300047321 Bacteria 2391
149 Ga0495684_0010727 3300047471 Bacteria 7084
150 Ga0495614_0154761 3300048089 Unclassified 1024
151 Ga0496100_0373011 3300048903 Bacteria 1082
152 Ga0496100_0488162 3300048903 Bacteria 948
153 Ga0496104_0000036 3300048907 Bacteria 180472
154 Ga0496106_0030750 3300048909 Bacteria 4002
155 Ga0496107_0004774 3300048910 Bacteria 9206
156 Ga0496108_0145241 3300048911 Bacteria 2045
157 Ga0496109_0072643 3300048912 Bacteria 3161
158 Ga0496110_0003993 3300048913 Bacteria 11360
159 Ga0496110_0439239 3300048913 Bacteria 1189
160 Ga0496111_0000792 3300048914 Bacteria 16930
161 Ga0496111_0455382 3300048914 Bacteria 944
162 Ga0496112_0065747 3300048915 Bacteria 3579
163 Ga0496113_0022515 3300048916 Bacteria 4458
164 Ga0501031_0062781 3300049568 Bacteria 2421
165 Ga0501032_0371802 3300049569 Bacteria 920
166 Ga0501033_0026020 3300049570 Bacteria 4403
167 Ga0501034_0031398 3300049571 Bacteria 5395
168 Ga0501034_0627929 3300049571 Bacteria 978
169 Ga0501036_0296482 3300049572 Bacteria 1352
170 Ga0501037_0292576 3300049573 Bacteria 1132
171 Ga0501038_0275551 3300049574 Bacteria 1325
172 Ga0501039_0325591 3300049575 Bacteria 1208
173 Ga0501039_0352419 3300049575 Bacteria 1156
174 Ga0501043_0057926 3300049579 Bacteria 3041
175 Ga0501046_0065611 3300049580 Bacteria 2831
176 Ga0501047_0021570 3300049581 Bacteria 6186
177 Ga0501047_0050175 3300049581 Bacteria 4029
178 Ga0501048_0068160 3300049582 Bacteria 2514
179 Ga0501067_0129472 3300049583 Bacteria 1404
180 Ga0501068_0145920 3300049584 Bacteria 1485
181 Ga0501069_0100516 3300049585 Bacteria 1641
182 Ga0501070_0260767 3300049586 Bacteria 1416
183 Ga0501072_0129299 3300049588 Bacteria 2013
184 Ga0501073_0065699 3300049589 Bacteria 2529
185 Ga0501074_0132961 3300049590 Bacteria 1779
186 Ga0501074_0211973 3300049590 Bacteria 1380
187 Ga0501076_0096622 3300049592 Bacteria 2380
188 Ga0501076_0370336 3300049592 Bacteria 1177
189 Ga0501079_0149531 3300049741 Bacteria 1820
190 Ga0501080_0003636 3300049742 Bacteria 13601
191 Ga0501081_0158885 3300049743 Bacteria 1628
192 Ga0501044_0058017 3300049823 Bacteria 3971
193 Ga0501044_0149176 3300049823 Bacteria 2321
194 Ga0501045_0456579 3300049824 Bacteria 950
195 Ga0501045_0717431 3300049824 Bacteria 737
196 nmdc:mga05p37_211334_c1 3300050507 Bacteria 2345
197 nmdc:mga09592_179496_c1 3300050508 Bacteria 1831
198 nmdc:mga06r32_265375_c1 3300050510 Bacteria 1704
199 nmdc:mga08y16_4150_c1 3300050511 Bacteria 15125
200 Ga0500556_0000661 3300053104 Bacteria 21448
201 Ga0500616_0005280 3300053153 Bacteria 8827
202 Ga0500599_005235 3300053736 Bacteria 1625
203 Ga0501084_0393604 3300054114 Bacteria 1171
204 Ga0466958_0165191
205 LJQas_1004734
206 JGI24744J21845_10004720
207 JGI25406J46586_10028427
208 JGI25407J50210_10006660
209 JGI25407J50210_10008405
210 Ga0070658_10297031
211 Ga0068869_100056904
212 Ga0070680_100246157
213 Ga0070682_100011633
214 Ga0068868_100032900
215 Ga0068868_100087625
216 Ga0068868_100422085
217 Ga0070689_100181639
218 Ga0070674_100022880
219 Ga0070709_10079340
220 Ga0070714_100419999
221 Ga0070662_100377504
222 Ga0070684_100235888
223 Ga0070695_100255592
224 Ga0068854_100324205
225 Ga0068856_100105134
226 Ga0068859_100308765
227 Ga0068861_100419087
228 Ga0081455_10249251
229 Ga0081538_10000137
230 Ga0081538_10001665
231 Ga0081538_10001698
232 Ga0081538_10002409
233 Ga0081538_10014826
234 Ga0081538_10099161
235 Ga0081539_10003593
236 Ga0081539_10041687
237 Ga0075428_100088907
238 Ga0075428_100093356
239 Ga0075428_100719767
240 Ga0075434_100438127
241 Ga0075429_100162645
242 Ga0068865_100038308
243 Ga0097620_100308761
244 Ga0105240_10000538
245 Ga0105240_10007914
246 Ga0111539_10007691
247 Ga0111539_10468003
248 Ga0105245_10033392
249 Ga0105245_10304293
250 Ga0105247_10129410
251 Ga0114129_10059965
252 Ga0114129_11201492
253 Ga0105243_10022319
254 Ga0105243_10166594
255 Ga0105242_10169574
256 Ga0105242_10494469
257 Ga0105237_10000608
258 Ga0105249_10111047
259 Ga0157374_10006638
260 Ga0163162_10272375
261 Ga0157372_10108656
262 Ga0213876_10012826
263 Ga0213876_10016397
264 Ga0213875_10000150
265 Ga0213875_10007794
266 Ga0207699_10243452
267 Ga0207684_10538152
268 Ga0207695_10003897
269 Ga0207695_10062265
270 Ga0207671_10004826
271 Ga0207657_10217260
272 Ga0207652_10301328
273 Ga0207687_10074947
274 Ga0207664_10038820
275 Ga0207644_10229083
276 Ga0207709_10029829
277 Ga0207709_10180145
278 Ga0207670_10136636
279 Ga0207669_10032964
280 Ga0207669_10300682
281 Ga0207669_10464311
282 Ga0207704_10014451
283 Ga0207661_10007343
284 Ga0207640_10019129
285 Ga0207677_10085995
286 Ga0207708_10027794
287 Ga0207708_10224523
288 Ga0207702_10080961
289 Ga0207648_10085209
290 Ga0207676_10456927
291 Ga0207675_100022731
292 Ga0207675_100481718
293 Ga0207428_10072108
294 Ga0307408_100072236
295 Ga0307410_10210318
296 Ga0307406_10090856
297 Ga0307406_10188331
298 Ga0307407_10065762
299 Ga0307407_10072203
300 Ga0307416_100171853
301 Ga0307411_10392350
302 Ga0307415_100260866
303 Ga0307415_100410574
304 Ga0395899_0160645
305 Ga0395900_0056545
306 Ga0395898_0013037
307 Ga0395898_0202949
308 Ga0395898_0380539
309 Ga0395898_0478218
310 Ga0395905_0055947
311 Ga0436364_0143007
312 Ga0436364_0169833
313 Ga0436364_0443454
314 Ga0436364_0566835
315 Ga0395901_0007916
316 Ga0395901_0144321
317 Ga0395901_0713774
318 Ga0436365_1370684
319 Ga0436365_1933077
320 Ga0466969_0027970
321 Ga0466965_0227665
322 Ga0466965_0281736
323 Ga0466961_0002845
324 Ga0466963_0002030
325 Ga0466963_0058815
326 Ga0466963_0091109
327 Ga0466963_0160346
328 Ga0466971_0046597
329 Ga0466968_0069039
330 Ga0466968_0109834
331 Ga0466968_0177963
332 Ga0466957_0161664
333 Ga0466960_0055309
334 Ga0466959_0002248
335 Ga0466958_0010361
336 Ga0466967_0005456
337 Ga0466967_0007259
338 Ga0466967_0008449
339 Ga0466967_0030741
340 Ga0466967_0098832
341 Ga0466967_0154490
342 Ga0466967_0245630
343 Ga0466967_0258476
344 Ga0466967_0530152
345 Ga0495603_0005016
346 Ga0495582_0015194
347 Ga0495594_0003934
348 Ga0495666_0049334
349 Ga0495647_0057110
350 Ga0495581_0015717
351 Ga0495676_0084693
352 Ga0495684_0010727
353 Ga0495614_0154761
354 Ga0496100_0373011
355 Ga0496100_0488162
356 Ga0496104_0000036
357 Ga0496106_0030750
358 Ga0496107_0004774
359 Ga0496108_0145241
360 Ga0496109_0072643
361 Ga0496110_0003993
362 Ga0496110_0439239
363 Ga0496111_0000792
364 Ga0496111_0455382
365 Ga0496112_0065747
366 Ga0496113_0022515
367 Ga0501031_0062781
368 Ga0501032_0371802
369 Ga0501033_0026020
370 Ga0501034_0031398
371 Ga0501034_0627929
372 Ga0501036_0296482
373 Ga0501037_0292576
374 Ga0501038_0275551
375 Ga0501039_0325591
376 Ga0501039_0352419
377 Ga0501043_0057926
378 Ga0501046_0065611
379 Ga0501047_0021570
380 Ga0501047_0050175
381 Ga0501048_0068160
382 Ga0501067_0129472
383 Ga0501068_0145920
384 Ga0501069_0100516
385 Ga0501070_0260767
386 Ga0501072_0129299
387 Ga0501073_0065699
388 Ga0501074_0132961
389 Ga0501074_0211973
390 Ga0501076_0096622
391 Ga0501076_0370336
392 Ga0501079_0149531
393 Ga0501080_0003636
394 Ga0501081_0158885
395 Ga0501044_0058017
396 Ga0501044_0149176
397 Ga0501045_0456579
398 Ga0501045_0717431
399 nmdc:mga05p37_211334_c1
400 nmdc:mga09592_179496_c1
401 nmdc:mga06r32_265375_c1
402 nmdc:mga08y16_4150_c1
403 Ga0500556_0000661
404 Ga0500616_0005280
405 Ga0500599_005235
406 Ga0501084_0393604

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

50

213

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.7729 7 231
3ckj-assembly1.cif.gz_A crystal structure of a mycobacterial protein 0.7686 2 230
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.7685 1 228
7qib-assembly1.cif.gz_B crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 8.5 in complex with udp 0.7502 2 228
3e25-assembly1.cif.gz_A-2 crystal structure of m. tuberculosis glucosyl-3-phosphoglycerate synthase 0.7384 2 241
ID Description Score Start End Superfamily
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8625 6 222 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8578 6 220 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8399 6 222 3.90.550.10
af_O60061_43_318_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8137 1 238 3.90.550.10
af_Q9VLQ1_42_326_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8083 2 229 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A1F9DBT3-F1-model_v4 Glycosyl transferase family 2 0.9693 4 208 GO:0016740
AF-A0A1F9DBT3-F1-model_v4 Glycosyl transferase family 2 0.9647 4 208 GO:0016740
AF-A0A7V2K6N9-F1-model_v4 Glycosyltransferase family 2 protein 0.9527 7 131 GO:0016757
AF-A0A534PEG3-F1-model_v4 Glycosyltransferase family 2 protein 0.9477 7 233 GO:0016757
AF-A0A522UJC5-F1-model_v4 Glycosyltransferase family 2 protein 0.9461 6 236 GO:0016740

Map