F311463

General Info

Members Datasets Scaffolds Average Seq Length
203 142 406 106

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_1128059|Ga0373925_1128059_102_464
Length 120
Sequence MNQVNRDQWSRLWTTNMAVPTTTTAQPRLEAYQVILRPLVTEKGMHRSTRNNQYAFEVHLQATKDDVRRAVQELFNVEVDKVRTQNRRGKPRKHRFKQGQTKGWKKAIVTLNAEHRIDFF

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
89 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 4.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.46
Nodule 0
Rhizoplane 3.94
Rhizosphere 93.1
Stem 0
Stem Tuber 0
Unclassified 33.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_1128059 3300037068 Unclassified 645
2 MRS1b_contig_2969689 2162886011 Unclassified 857
3 Ga0058862_11758771 3300004803 Unclassified 554
4 Ga0058862_11972976 3300004803 Bacteria 576
5 Ga0065704_10147403 3300005289 Bacteria 1459
6 Ga0065712_10068720 3300005290 Bacteria 9237
7 Ga0065707_10094855 3300005295 Bacteria 3444
8 Ga0070676_11474475 3300005328 Unclassified 523
9 Ga0070689_100174518 3300005340 Bacteria 1743
10 Ga0070689_101690263 3300005340 Bacteria 576
11 Ga0070689_102183728 3300005340 Unclassified 507
12 Ga0070688_100222321 3300005365 Bacteria 1331
13 Ga0070714_100707678 3300005435 Bacteria 972
14 Ga0070710_10824843 3300005437 Bacteria 664
15 Ga0070711_101352438 3300005439 Unclassified 619
16 Ga0070663_101139286 3300005455 Unclassified 683
17 Ga0070707_101262079 3300005468 Unclassified 705
18 Ga0070698_100475062 3300005471 Bacteria 1187
19 Ga0070698_100541851 3300005471 Bacteria 1103
20 Ga0070699_100538726 3300005518 Bacteria 1062
21 Ga0070699_100907071 3300005518 Bacteria 807
22 Ga0070679_101656873 3300005530 Unclassified 587
23 Ga0070696_101456701 3300005546 Unclassified 585
24 Ga0070665_100000611 3300005548 Bacteria 48974
25 Ga0070665_101692042 3300005548 Unclassified 640
26 Ga0070704_100405071 3300005549 Bacteria 1165
27 Ga0070704_101230506 3300005549 Bacteria 683
28 Ga0068861_100456405 3300005719 Bacteria 1146
29 Ga0068861_100783979 3300005719 Bacteria 893
30 Ga0068851_10381019 3300005834 Unclassified 826
31 Ga0068863_100729044 3300005841 Bacteria 986
32 Ga0068858_100095684 3300005842 Bacteria 2767
33 Ga0068860_101019907 3300005843 Bacteria 846
34 Ga0068862_101305862 3300005844 Unclassified 727
35 Ga0081455_10131194 3300005937 Bacteria 1959
36 Ga0075364_10604320 3300006051 Bacteria 749
37 Ga0070716_101110467 3300006173 Unclassified 631
38 Ga0075367_10834612 3300006178 Bacteria 587
39 Ga0075367_10919664 3300006178 Bacteria 558
40 Ga0097621_102017246 3300006237 Bacteria 551
41 Ga0068871_101465993 3300006358 Bacteria 644
42 Ga0075428_100046660 3300006844 Bacteria 4758
43 Ga0075428_100079638 3300006844 Bacteria 3575
44 Ga0075431_100519527 3300006847 Bacteria 1180
45 Ga0075431_100642587 3300006847 Bacteria 1042
46 Ga0075431_100677233 3300006847 Unclassified 1010
47 Ga0075429_100152203 3300006880 Bacteria 2026
48 Ga0075435_101764613 3300007076 Unclassified 543
49 Ga0099795_10250906 3300007788 Bacteria 763
50 Ga0111539_10433928 3300009094 Bacteria 1530
51 Ga0111539_11591593 3300009094 Bacteria 758
52 Ga0111539_12254854 3300009094 Unclassified 632
53 Ga0105245_11177183 3300009098 Bacteria 814
54 Ga0105245_12836442 3300009098 Unclassified 537
55 Ga0105247_10718840 3300009101 Bacteria 754
56 Ga0105247_11168538 3300009101 Unclassified 611
57 Ga0105247_11721879 3300009101 Unclassified 519
58 Ga0114129_10681957 3300009147 Bacteria 1323
59 Ga0114129_11043009 3300009147 Unclassified 1027
60 Ga0105243_10515112 3300009148 Bacteria 1136
61 Ga0105242_11023596 3300009176 Bacteria 835
62 Ga0105248_10276881 3300009177 Bacteria 1889
63 Ga0105248_12730619 3300009177 Unclassified 563
64 Ga0105238_11089628 3300009551 Unclassified 821
65 Ga0105249_10592555 3300009553 Bacteria 1163
66 Ga0105249_11060895 3300009553 Bacteria 880
67 Ga0105249_12977222 3300009553 Unclassified 544
68 Ga0105239_10425800 3300010375 Bacteria 1504
69 Ga0105239_11305304 3300010375 Unclassified 837
70 Ga0105246_10741604 3300011119 Unclassified 865
71 Ga0105246_12104367 3300011119 Bacteria 547
72 Ga0157374_11624619 3300013296 Unclassified 671
73 Ga0157374_12555537 3300013296 Unclassified 538
74 Ga0163162_11581769 3300013306 Bacteria 748
75 Ga0163162_12014269 3300013306 Bacteria 662
76 Ga0157375_11080138 3300013308 Bacteria 939
77 Ga0163163_10311159 3300014325 Bacteria 1628
78 Ga0163163_13038393 3300014325 Unclassified 523
79 Ga0157380_11570500 3300014326 Bacteria 713
80 Ga0157380_12635296 3300014326 Bacteria 569
81 Ga0157379_10695549 3300014968 Bacteria 954
82 Ga0157376_11016277 3300014969 Bacteria 852
83 Ga0157376_11553739 3300014969 Unclassified 695
84 Ga0163161_11888873 3300017792 Unclassified 531
85 Ga0207692_10614076 3300025898 Bacteria 700
86 Ga0207680_10620532 3300025903 Unclassified 774
87 Ga0207646_11723418 3300025922 Unclassified 538
88 Ga0207687_10718513 3300025927 Bacteria 849
89 Ga0207687_11446738 3300025927 Unclassified 590
90 Ga0207664_10501638 3300025929 Unclassified 1087
91 Ga0207686_10505642 3300025934 Bacteria 938
92 Ga0207686_11543148 3300025934 Unclassified 548
93 Ga0207709_10358717 3300025935 Bacteria 1103
94 Ga0207670_10037263 3300025936 Bacteria 3168
95 Ga0207704_11110961 3300025938 Unclassified 672
96 Ga0207704_11410841 3300025938 Unclassified 597
97 Ga0207689_11171918 3300025942 Unclassified 647
98 Ga0207640_10943807 3300025981 Bacteria 756
99 Ga0207703_10125321 3300026035 Bacteria 2211
100 Ga0207678_10448911 3300026067 Unclassified 1121
101 Ga0207678_11069896 3300026067 Bacteria 714
102 Ga0207641_10413211 3300026088 Bacteria 1298
103 Ga0207676_11348508 3300026095 Unclassified 709
104 Ga0207675_100311035 3300026118 Bacteria 1536
105 Ga0268266_10003698 3300028379 Bacteria 15081
106 Ga0268266_11059727 3300028379 Unclassified 784
107 Ga0268265_10125679 3300028380 Bacteria 2122
108 Ga0268265_11793894 3300028380 Unclassified 620
109 Ga0265338_10001664 3300028800 Bacteria 35394
110 Ga0265338_10182418 3300028800 Bacteria 1599
111 Ga0265325_10002078 3300031241 Bacteria 13700
112 Ga0265339_10000368 3300031249 Bacteria 35412
113 Ga0265331_10001827 3300031250 Bacteria 15080
114 Ga0265313_10000050 3300031595 Bacteria 111425
115 Ga0265314_10000306 3300031711 Bacteria 70032
116 Ga0265342_10022572 3300031712 Bacteria 3999
117 Ga0307413_10722221 3300031824 Bacteria 830
118 Ga0307409_102322327 3300031995 Bacteria 566
119 Ga0307415_101403527 3300032126 Bacteria 665
120 Ga0316574_0728745 3300035398 Unclassified 607
121 Ga0373947_1226652 3300035725 Unclassified 511
122 Ga0373937_0611717 3300036401 Bacteria 1034
123 Ga0373925_1006734 3300037068 Bacteria 686
124 Ga0373925_1658713 3300037068 Bacteria 522
125 Ga0451791_0263097 3300041451 Bacteria 512
126 Ga0451841_0768512 3300041498 Bacteria 766
127 Ga0495628_0121416 3300046516 Bacteria 2004
128 Ga0495630_1155730 3300046517 Bacteria 586
129 Ga0495630_1372050 3300046517 Unclassified 532
130 Ga0495587_0484097 3300046536 Unclassified 685
131 Ga0495587_0589307 3300046536 Unclassified 612
132 Ga0495657_0659027 3300046675 Unclassified 603
133 Ga0495647_0154581 3300046681 Bacteria 985
134 Ga0495604_0989426 3300047317 Bacteria 521
135 Ga0495680_0219509 3300047322 Bacteria 1358
136 Ga0495684_0628574 3300047471 Bacteria 721
137 Ga0496104_0093834 3300048907 Bacteria 2871
138 Ga0496105_0308780 3300048908 Bacteria 1270
139 Ga0496105_1305192 3300048908 Unclassified 530
140 Ga0496108_0272047 3300048911 Bacteria 1475
141 Ga0496108_1331648 3300048911 Unclassified 603
142 Ga0496109_0223761 3300048912 Bacteria 1770
143 Ga0496115_0012294 3300048918 Bacteria 6438
144 Ga0501031_0583048 3300049568 Bacteria 720
145 Ga0501034_0005285 3300049571 Bacteria 14165
146 Ga0501034_0009257 3300049571 Bacteria 10322
147 Ga0501036_1120501 3300049572 Bacteria 643
148 Ga0501036_1712544 3300049572 Bacteria 507
149 Ga0501039_0492241 3300049575 Bacteria 963
150 Ga0501039_1557887 3300049575 Bacteria 508
151 Ga0501040_1088814 3300049576 Bacteria 580
152 Ga0501042_0113549 3300049578 Bacteria 1951
153 Ga0501042_0924178 3300049578 Bacteria 635
154 Ga0501043_0033898 3300049579 Bacteria 4017
155 Ga0501046_0004645 3300049580 Bacteria 12408
156 Ga0501047_0082385 3300049581 Bacteria 3092
157 Ga0501047_0123199 3300049581 Bacteria 2473
158 Ga0501048_0081827 3300049582 Bacteria 2278
159 Ga0501068_0996395 3300049584 Unclassified 553
160 Ga0501070_0006209 3300049586 Bacteria 10181
161 Ga0501070_0244324 3300049586 Bacteria 1469
162 Ga0501071_0039054 3300049587 Bacteria 3395
163 Ga0501072_0592477 3300049588 Bacteria 874
164 Ga0501072_1453268 3300049588 Unclassified 530
165 Ga0501073_1020637 3300049589 Bacteria 569
166 Ga0501075_0521192 3300049591 Bacteria 907
167 Ga0501075_0550440 3300049591 Bacteria 881
168 Ga0501075_1058484 3300049591 Bacteria 616
169 Ga0501075_1061909 3300049591 Bacteria 615
170 Ga0501077_0687109 3300049593 Unclassified 658
171 Ga0501079_1253893 3300049741 Bacteria 584
172 Ga0501079_1499081 3300049741 Unclassified 530
173 Ga0501080_1065902 3300049742 Unclassified 699
174 Ga0501080_1568411 3300049742 Unclassified 558
175 Ga0501081_0289359 3300049743 Bacteria 1201
176 Ga0501081_0741037 3300049743 Unclassified 738
177 Ga0501083_0611916 3300049744 Unclassified 709
178 Ga0501035_1229573 3300049822 Bacteria 580
179 Ga0501044_0681835 3300049823 Unclassified 914
180 Ga0501045_0220615 3300049824 Bacteria 1412
181 Ga0501045_0419719 3300049824 Bacteria 995
182 Ga0501045_1045641 3300049824 Bacteria 598
183 nmdc:mga00v17_495448_c1 3300050491 Bacteria 792
184 nmdc:mga09592_835802_c1 3300050508 Bacteria 777
185 nmdc:mga06r32_490340_c1 3300050510 Bacteria 1206
186 nmdc:mga06r32_777502_c1 3300050510 Bacteria 919
187 Ga0495601_0556610 3300053077 Bacteria 738
188 Ga0495619_0036988 3300053085 Bacteria 3180
189 Ga0500593_136252 3300053117 Bacteria 972
190 Ga0501084_0541294 3300054114 Unclassified 984
191 Ga0501084_1134451 3300054114 Unclassified 656
192 Ga0587070_072746 3300059491 Bacteria 737
193 Ga0587077_000395 3300059493 Bacteria 3600
194 Ga0587101_005067 3300059623 Bacteria 1443
195 Ga0587067_088213 3300059640 Unclassified 698
196 Ga0587069_008996 3300059642 Bacteria 1278
197 Ga0587072_036104 3300059643 Unclassified 944
198 Ga0587107_084632 3300059652 Unclassified 602
199 Ga0501082_0412717 3300060353 Unclassified 1179
200 Ga0501082_0821434 3300060353 Unclassified 813
201 Ga0501082_0958508 3300060353 Unclassified 748
202 Ga0530510_0436867 3300061734 Bacteria 989
203 Ga0530510_1260456 3300061734 Unclassified 567
204 Ga0373925_1128059
205 MRS1b_contig_2969689
206 Ga0058862_11758771
207 Ga0058862_11972976
208 Ga0065704_10147403
209 Ga0065712_10068720
210 Ga0065707_10094855
211 Ga0070676_11474475
212 Ga0070689_100174518
213 Ga0070689_101690263
214 Ga0070689_102183728
215 Ga0070688_100222321
216 Ga0070714_100707678
217 Ga0070710_10824843
218 Ga0070711_101352438
219 Ga0070663_101139286
220 Ga0070707_101262079
221 Ga0070698_100475062
222 Ga0070698_100541851
223 Ga0070699_100538726
224 Ga0070699_100907071
225 Ga0070679_101656873
226 Ga0070696_101456701
227 Ga0070665_100000611
228 Ga0070665_101692042
229 Ga0070704_100405071
230 Ga0070704_101230506
231 Ga0068861_100456405
232 Ga0068861_100783979
233 Ga0068851_10381019
234 Ga0068863_100729044
235 Ga0068858_100095684
236 Ga0068860_101019907
237 Ga0068862_101305862
238 Ga0081455_10131194
239 Ga0075364_10604320
240 Ga0070716_101110467
241 Ga0075367_10834612
242 Ga0075367_10919664
243 Ga0097621_102017246
244 Ga0068871_101465993
245 Ga0075428_100046660
246 Ga0075428_100079638
247 Ga0075431_100519527
248 Ga0075431_100642587
249 Ga0075431_100677233
250 Ga0075429_100152203
251 Ga0075435_101764613
252 Ga0099795_10250906
253 Ga0111539_10433928
254 Ga0111539_11591593
255 Ga0111539_12254854
256 Ga0105245_11177183
257 Ga0105245_12836442
258 Ga0105247_10718840
259 Ga0105247_11168538
260 Ga0105247_11721879
261 Ga0114129_10681957
262 Ga0114129_11043009
263 Ga0105243_10515112
264 Ga0105242_11023596
265 Ga0105248_10276881
266 Ga0105248_12730619
267 Ga0105238_11089628
268 Ga0105249_10592555
269 Ga0105249_11060895
270 Ga0105249_12977222
271 Ga0105239_10425800
272 Ga0105239_11305304
273 Ga0105246_10741604
274 Ga0105246_12104367
275 Ga0157374_11624619
276 Ga0157374_12555537
277 Ga0163162_11581769
278 Ga0163162_12014269
279 Ga0157375_11080138
280 Ga0163163_10311159
281 Ga0163163_13038393
282 Ga0157380_11570500
283 Ga0157380_12635296
284 Ga0157379_10695549
285 Ga0157376_11016277
286 Ga0157376_11553739
287 Ga0163161_11888873
288 Ga0207692_10614076
289 Ga0207680_10620532
290 Ga0207646_11723418
291 Ga0207687_10718513
292 Ga0207687_11446738
293 Ga0207664_10501638
294 Ga0207686_10505642
295 Ga0207686_11543148
296 Ga0207709_10358717
297 Ga0207670_10037263
298 Ga0207704_11110961
299 Ga0207704_11410841
300 Ga0207689_11171918
301 Ga0207640_10943807
302 Ga0207703_10125321
303 Ga0207678_10448911
304 Ga0207678_11069896
305 Ga0207641_10413211
306 Ga0207676_11348508
307 Ga0207675_100311035
308 Ga0268266_10003698
309 Ga0268266_11059727
310 Ga0268265_10125679
311 Ga0268265_11793894
312 Ga0265338_10001664
313 Ga0265338_10182418
314 Ga0265325_10002078
315 Ga0265339_10000368
316 Ga0265331_10001827
317 Ga0265313_10000050
318 Ga0265314_10000306
319 Ga0265342_10022572
320 Ga0307413_10722221
321 Ga0307409_102322327
322 Ga0307415_101403527
323 Ga0316574_0728745
324 Ga0373947_1226652
325 Ga0373937_0611717
326 Ga0373925_1006734
327 Ga0373925_1658713
328 Ga0451791_0263097
329 Ga0451841_0768512
330 Ga0495628_0121416
331 Ga0495630_1155730
332 Ga0495630_1372050
333 Ga0495587_0484097
334 Ga0495587_0589307
335 Ga0495657_0659027
336 Ga0495647_0154581
337 Ga0495604_0989426
338 Ga0495680_0219509
339 Ga0495684_0628574
340 Ga0496104_0093834
341 Ga0496105_0308780
342 Ga0496105_1305192
343 Ga0496108_0272047
344 Ga0496108_1331648
345 Ga0496109_0223761
346 Ga0496115_0012294
347 Ga0501031_0583048
348 Ga0501034_0005285
349 Ga0501034_0009257
350 Ga0501036_1120501
351 Ga0501036_1712544
352 Ga0501039_0492241
353 Ga0501039_1557887
354 Ga0501040_1088814
355 Ga0501042_0113549
356 Ga0501042_0924178
357 Ga0501043_0033898
358 Ga0501046_0004645
359 Ga0501047_0082385
360 Ga0501047_0123199
361 Ga0501048_0081827
362 Ga0501068_0996395
363 Ga0501070_0006209
364 Ga0501070_0244324
365 Ga0501071_0039054
366 Ga0501072_0592477
367 Ga0501072_1453268
368 Ga0501073_1020637
369 Ga0501075_0521192
370 Ga0501075_0550440
371 Ga0501075_1058484
372 Ga0501075_1061909
373 Ga0501077_0687109
374 Ga0501079_1253893
375 Ga0501079_1499081
376 Ga0501080_1065902
377 Ga0501080_1568411
378 Ga0501081_0289359
379 Ga0501081_0741037
380 Ga0501083_0611916
381 Ga0501035_1229573
382 Ga0501044_0681835
383 Ga0501045_0220615
384 Ga0501045_0419719
385 Ga0501045_1045641
386 nmdc:mga00v17_495448_c1
387 nmdc:mga09592_835802_c1
388 nmdc:mga06r32_490340_c1
389 nmdc:mga06r32_777502_c1
390 Ga0495601_0556610
391 Ga0495619_0036988
392 Ga0500593_136252
393 Ga0501084_0541294
394 Ga0501084_1134451
395 Ga0587070_072746
396 Ga0587077_000395
397 Ga0587101_005067
398 Ga0587067_088213
399 Ga0587069_008996
400 Ga0587072_036104
401 Ga0587107_084632
402 Ga0501082_0412717
403 Ga0501082_0821434
404 Ga0501082_0958508
405 Ga0530510_0436867
406 Ga0530510_1260456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

33

119

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9125 21 103
6th6-assembly1.cif.gz_BW cryo-em structure of t. kodakarensis 70s ribosome 0.9099 19 106
5xxb-assembly1.cif.gz_W large subunit of toxoplasma gondii ribosome 0.9079 19 106
7bt6-assembly1.cif.gz_X cryo-em structure of pre-60s ribosome from saccharomyces cerevisiae rpl4delta63-87 strain at 3.12 angstroms resolution(state r1) 0.9075 19 106
6ppf-assembly1.cif.gz_T bacterial 45srbga ribosomal particle class b 0.8992 20 103
ID Description Score Start End Superfamily
af_P54016_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9172 19 106 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8881 20 110 3.30.70.330
5x8tU01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8848 24 106 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8789 20 110 3.30.70.330
1w2bR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8752 24 106 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A353GDZ5-F1-model_v4 50S ribosomal protein L23 0.9436 43 110 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-Q49ZG6-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9269 19 110 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0G0CPG0-F1-model_v4 Large ribosomal subunit protein uL23 0.9236 19 109 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G1ZPL1-F1-model_v4 50S ribosomal protein L23 0.9224 40 110 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2E6XXD7-F1-model_v4 Large ribosomal subunit protein uL23 0.9222 19 110 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map