F311209
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 203 | 145 | 199 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10337816|Ga0105239_103378161 |
| Length | 215 |
| Sequence | VKQSFTVFAAPPPVSPGDPVSPGLDKTSLRVRLRGLRRRLATEIPDAAQRAAERLPLARLPRYRVFGLYHAMGSEMDPMPLMYELHSGDAKPTLPVALDRDSPLVLRLWSKGMRLEPDALGVPAPVPIMPVLTPDLVVVPLLGFDRKGGRLGQGAGHYDRTLRMLRAKKPVFALGLAYAGQEVEELPLEAHDERLDAILTETDYIEVAPGTRAAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 2 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 3 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 4 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 22 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 23 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 24 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 25 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 30 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 32 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 33 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 34 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 46 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 47 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 78 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 79 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 80 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 81 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 82 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 83 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 84 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 85 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 86 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 87 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 88 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 89 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 90 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 91 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 92 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 93 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 113 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 114 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 115 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 116 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 117 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 119 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 121 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 122 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 123 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 124 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 125 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 126 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 127 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 128 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 129 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 130 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 131 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 132 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 133 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 134 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 135 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 136 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 137 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 138 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 139 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 140 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 141 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 142 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 143 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 144 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 145 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.03 |
| Metatranscriptomes | 0 |
| Isolates | 1.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.21 |
| Nodule | 0 |
| Rhizoplane | 1.48 |
| Rhizosphere | 71.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10045519 | 3300003215 | Bacteria | 1308 |
| 2 | Ga0070670_100064880 | 3300005331 | Bacteria | 3133 |
| 3 | Ga0070680_100063452 | 3300005336 | Bacteria | 3026 |
| 4 | Ga0070680_100295575 | 3300005336 | Bacteria | 1373 |
| 5 | Ga0070660_100187691 | 3300005339 | Bacteria | 1674 |
| 6 | Ga0070660_100383434 | 3300005339 | Bacteria | 1160 |
| 7 | Ga0070660_100719563 | 3300005339 | Bacteria | 837 |
| 8 | Ga0070660_100787207 | 3300005339 | Bacteria | 799 |
| 9 | Ga0070668_100014120 | 3300005347 | Bacteria | 5969 |
| 10 | Ga0070668_100056267 | 3300005347 | Bacteria | 3037 |
| 11 | Ga0070669_100239873 | 3300005353 | Bacteria | 1440 |
| 12 | Ga0070671_100008279 | 3300005355 | Bacteria | 8323 |
| 13 | Ga0070659_100017722 | 3300005366 | Bacteria | 5364 |
| 14 | Ga0070659_100317264 | 3300005366 | Bacteria | 1302 |
| 15 | Ga0070667_100005870 | 3300005367 | Bacteria | 10237 |
| 16 | Ga0070667_100013680 | 3300005367 | Bacteria | 6705 |
| 17 | Ga0070662_100293811 | 3300005457 | Bacteria | 1318 |
| 18 | Ga0070681_10017044 | 3300005458 | Bacteria | 7260 |
| 19 | Ga0070679_100104317 | 3300005530 | Bacteria | 2821 |
| 20 | Ga0068853_100081389 | 3300005539 | Bacteria | 2835 |
| 21 | Ga0070665_100001028 | 3300005548 | Bacteria | 34986 |
| 22 | Ga0070665_100006730 | 3300005548 | Bacteria | 11683 |
| 23 | Ga0070665_100036505 | 3300005548 | Bacteria | 4944 |
| 24 | Ga0068855_100134933 | 3300005563 | Bacteria | 2816 |
| 25 | Ga0070664_100478338 | 3300005564 | Bacteria | 1146 |
| 26 | Ga0068857_100333719 | 3300005577 | Bacteria | 1402 |
| 27 | Ga0068854_100159798 | 3300005578 | Bacteria | 1744 |
| 28 | Ga0068859_100000747 | 3300005617 | Bacteria | 32789 |
| 29 | Ga0068864_100000283 | 3300005618 | Bacteria | 45450 |
| 30 | Ga0068864_100176033 | 3300005618 | Bacteria | 1953 |
| 31 | Ga0068861_100289491 | 3300005719 | Bacteria | 1414 |
| 32 | Ga0068863_100000091 | 3300005841 | Bacteria | 98724 |
| 33 | Ga0068863_100030798 | 3300005841 | Bacteria | 5123 |
| 34 | Ga0068863_100131360 | 3300005841 | Bacteria | 2391 |
| 35 | Ga0068863_100508151 | 3300005841 | Bacteria | 1187 |
| 36 | Ga0068858_100000059 | 3300005842 | Bacteria | 117158 |
| 37 | Ga0068858_100001493 | 3300005842 | Bacteria | 24115 |
| 38 | Ga0068860_100076674 | 3300005843 | Bacteria | 3179 |
| 39 | Ga0068862_100031625 | 3300005844 | Bacteria | 4470 |
| 40 | Ga0068862_100167192 | 3300005844 | Bacteria | 1967 |
| 41 | Ga0070717_10020425 | 3300006028 | Bacteria | 5208 |
| 42 | Ga0075367_10004389 | 3300006178 | Bacteria | 6883 |
| 43 | Ga0075366_10103746 | 3300006195 | Bacteria | 1708 |
| 44 | Ga0068865_100007279 | 3300006881 | Bacteria | 6800 |
| 45 | Ga0097620_100000747 | 3300006931 | Bacteria | 32789 |
| 46 | Ga0105250_10022075 | 3300009092 | Bacteria | 2568 |
| 47 | Ga0105240_10024147 | 3300009093 | Bacteria | 8023 |
| 48 | Ga0105248_10000661 | 3300009177 | Bacteria | 39161 |
| 49 | Ga0105248_10035390 | 3300009177 | Bacteria | 5586 |
| 50 | Ga0105248_10046562 | 3300009177 | Bacteria | 4861 |
| 51 | Ga0105248_10118046 | 3300009177 | Bacteria | 2992 |
| 52 | Ga0105248_10914236 | 3300009177 | Bacteria | 991 |
| 53 | Ga0105238_10144387 | 3300009551 | Bacteria | 2356 |
| 54 | Ga0105238_10550831 | 3300009551 | Bacteria | 1158 |
| 55 | Ga0105249_10242551 | 3300009553 | Bacteria | 1782 |
| 56 | Ga0105249_10503510 | 3300009553 | Bacteria | 1256 |
| 57 | Ga0105239_10337816 | 3300010375 | Bacteria | 1699 |
| 58 | Ga0105239_10589941 | 3300010375 | Bacteria | 1267 |
| 59 | Ga0163162_10059290 | 3300013306 | Bacteria | 3859 |
| 60 | Ga0163163_10018815 | 3300014325 | Bacteria | 6476 |
| 61 | Ga0163163_10136221 | 3300014325 | Bacteria | 2497 |
| 62 | Ga0163163_10921292 | 3300014325 | Bacteria | 937 |
| 63 | Ga0157379_10008799 | 3300014968 | Bacteria | 8805 |
| 64 | Ga0157379_10091117 | 3300014968 | Bacteria | 2735 |
| 65 | Ga0157379_10599943 | 3300014968 | Bacteria | 1028 |
| 66 | Ga0157376_10370331 | 3300014969 | Unclassified | 1377 |
| 67 | Ga0213876_10021862 | 3300021384 | Bacteria | 3384 |
| 68 | Ga0213876_10296084 | 3300021384 | Bacteria | 860 |
| 69 | Ga0209026_1006600 | 3300025250 | Bacteria | 2802 |
| 70 | Ga0209257_1002321 | 3300025304 | Bacteria | 19216 |
| 71 | Ga0207705_10027538 | 3300025909 | Bacteria | 4053 |
| 72 | Ga0207707_10148231 | 3300025912 | Bacteria | 2051 |
| 73 | Ga0207695_10006835 | 3300025913 | Bacteria | 14689 |
| 74 | Ga0207671_10266650 | 3300025914 | Bacteria | 1348 |
| 75 | Ga0207660_10082572 | 3300025917 | Bacteria | 2364 |
| 76 | Ga0207660_10424437 | 3300025917 | Bacteria | 1073 |
| 77 | Ga0207657_10060441 | 3300025919 | Bacteria | 3252 |
| 78 | Ga0207652_10042796 | 3300025921 | Bacteria | 3856 |
| 79 | Ga0207681_10008454 | 3300025923 | Bacteria | 6290 |
| 80 | Ga0207694_10205245 | 3300025924 | Bacteria | 1604 |
| 81 | Ga0207694_10838866 | 3300025924 | Bacteria | 777 |
| 82 | Ga0207650_10045361 | 3300025925 | Bacteria | 3234 |
| 83 | Ga0207644_10004353 | 3300025931 | Bacteria | 9188 |
| 84 | Ga0207690_10000352 | 3300025932 | Bacteria | 30589 |
| 85 | Ga0207706_10687775 | 3300025933 | Bacteria | 874 |
| 86 | Ga0207704_10005508 | 3300025938 | Bacteria | 5837 |
| 87 | Ga0207711_10000316 | 3300025941 | Bacteria | 51683 |
| 88 | Ga0207711_10002787 | 3300025941 | Bacteria | 15373 |
| 89 | Ga0207711_10003586 | 3300025941 | Bacteria | 13425 |
| 90 | Ga0207711_10648232 | 3300025941 | Bacteria | 985 |
| 91 | Ga0207667_10066282 | 3300025949 | Bacteria | 3764 |
| 92 | Ga0207712_10194735 | 3300025961 | Bacteria | 1602 |
| 93 | Ga0207668_10000001 | 3300025972 | Bacteria | 266091 |
| 94 | Ga0207640_10572368 | 3300025981 | Bacteria | 952 |
| 95 | Ga0207658_10009050 | 3300025986 | Bacteria | 6754 |
| 96 | Ga0207658_10274097 | 3300025986 | Bacteria | 1443 |
| 97 | Ga0207703_10000049 | 3300026035 | Bacteria | 149817 |
| 98 | Ga0207703_10015974 | 3300026035 | Bacteria | 5854 |
| 99 | Ga0207639_10050953 | 3300026041 | Bacteria | 3146 |
| 100 | Ga0207639_10298151 | 3300026041 | Bacteria | 1424 |
| 101 | Ga0207639_10718712 | 3300026041 | Bacteria | 927 |
| 102 | Ga0207641_10000011 | 3300026088 | Bacteria | 384362 |
| 103 | Ga0207641_10002650 | 3300026088 | Bacteria | 16363 |
| 104 | Ga0207641_10134887 | 3300026088 | Bacteria | 2221 |
| 105 | Ga0207676_10000503 | 3300026095 | Bacteria | 32970 |
| 106 | Ga0207676_10064194 | 3300026095 | Bacteria | 2919 |
| 107 | Ga0207676_10348152 | 3300026095 | Bacteria | 1369 |
| 108 | Ga0207675_100384273 | 3300026118 | Bacteria | 1381 |
| 109 | Ga0210000_1004560 | 3300027462 | Bacteria | 1998 |
| 110 | Ga0268266_10008732 | 3300028379 | Bacteria | 8981 |
| 111 | Ga0268265_10009526 | 3300028380 | Bacteria | 6560 |
| 112 | Ga0268264_10115179 | 3300028381 | Bacteria | 2361 |
| 113 | Ga0307517_10027161 | 3300028786 | Bacteria | 6886 |
| 114 | Ga0307511_10014383 | 3300030521 | Bacteria | 7706 |
| 115 | Ga0307508_10129112 | 3300031616 | Bacteria | 2131 |
| 116 | Ga0307516_10000035 | 3300031730 | Bacteria | 152658 |
| 117 | Ga0307414_10279168 | 3300032004 | Bacteria | 1403 |
| 118 | Ga0373936_0003766 | 3300035113 | Bacteria | 5702 |
| 119 | Ga0373925_0155754 | 3300037068 | Bacteria | 1797 |
| 120 | Ga0395899_0000485 | 3300037312 | Bacteria | 44590 |
| 121 | Ga0395900_0000072 | 3300037418 | Bacteria | 187428 |
| 122 | Ga0395900_0221733 | 3300037418 | Bacteria | 1905 |
| 123 | Ga0395898_0023051 | 3300037466 | Bacteria | 6294 |
| 124 | Ga0395905_0034368 | 3300037471 | Bacteria | 4760 |
| 125 | Ga0395905_0288326 | 3300037471 | Bacteria | 1528 |
| 126 | Ga0395905_0458312 | 3300037471 | Bacteria | 1173 |
| 127 | Ga0395901_0000052 | 3300038443 | Bacteria | 165888 |
| 128 | Ga0436365_0055061 | 3300039437 | Bacteria | 1046 |
| 129 | Ga0436365_1686452 | 3300039437 | Bacteria | 4788 |
| 130 | Ga0451789_0389863 | 3300041443 | Bacteria | 565 |
| 131 | Ga0439446_0001961 | 3300042156 | Bacteria | 4857 |
| 132 | Ga0466958_0211148 | 3300045836 | Bacteria | 1237 |
| 133 | Ga0495627_005298 | 3300046453 | Bacteria | 5225 |
| 134 | Ga0495629_0036079 | 3300046459 | Bacteria | 3493 |
| 135 | Ga0495594_0298914 | 3300046499 | Bacteria | 917 |
| 136 | Ga0495606_0002470 | 3300046507 | Bacteria | 21413 |
| 137 | Ga0495663_0096088 | 3300046525 | Bacteria | 971 |
| 138 | Ga0495663_0146231 | 3300046525 | Bacteria | 804 |
| 139 | Ga0495642_0297516 | 3300046528 | Bacteria | 707 |
| 140 | Ga0495597_0002075 | 3300046542 | Bacteria | 13367 |
| 141 | Ga0495622_0009065 | 3300046557 | Bacteria | 4607 |
| 142 | Ga0495668_0017817 | 3300046616 | Bacteria | 4115 |
| 143 | Ga0495668_0070228 | 3300046616 | Bacteria | 1925 |
| 144 | Ga0495668_0481912 | 3300046616 | Bacteria | 683 |
| 145 | Ga0495669_0000002 | 3300046684 | Bacteria | 282777 |
| 146 | Ga0495613_0150643 | 3300046689 | Bacteria | 1659 |
| 147 | Ga0495672_0217205 | 3300047320 | Bacteria | 946 |
| 148 | Ga0495687_009102 | 3300047443 | Bacteria | 5592 |
| 149 | Ga0495677_0120084 | 3300047445 | Bacteria | 1002 |
| 150 | Ga0495673_0000025 | 3300047469 | Bacteria | 512352 |
| 151 | Ga0495681_0102885 | 3300047470 | Bacteria | 1246 |
| 152 | Ga0495686_0002645 | 3300047472 | Bacteria | 16532 |
| 153 | Ga0495593_0022213 | 3300047673 | Bacteria | 3539 |
| 154 | Ga0495602_0103336 | 3300048088 | Bacteria | 2333 |
| 155 | Ga0496102_0186821 | 3300048905 | Bacteria | 1953 |
| 156 | Ga0496103_0335164 | 3300048906 | Bacteria | 973 |
| 157 | Ga0496117_0027796 | 3300048920 | Bacteria | 4395 |
| 158 | Ga0496118_0013355 | 3300048921 | Bacteria | 7773 |
| 159 | Ga0496121_0000397 | 3300048924 | Bacteria | 87422 |
| 160 | Ga0501047_0026168 | 3300049581 | Bacteria | 5612 |
| 161 | Ga0501047_0194240 | 3300049581 | Bacteria | 1892 |
| 162 | Ga0501238_009887 | 3300049671 | Bacteria | 1268 |
| 163 | Ga0501238_018182 | 3300049671 | Bacteria | 982 |
| 164 | Ga0501044_0309738 | 3300049823 | Bacteria | 1506 |
| 165 | nmdc:mga00v17_4821_c1 | 3300050491 | Bacteria | 5707 |
| 166 | nmdc:mga0yw44_127364_c1 | 3300050492 | Bacteria | 1645 |
| 167 | Ga0500635_0000270 | 3300053080 | Bacteria | 20001 |
| 168 | Ga0500578_0287883 | 3300053086 | Bacteria | 978 |
| 169 | Ga0500643_001004 | 3300053087 | Bacteria | 17272 |
| 170 | Ga0500651_0009966 | 3300053093 | Bacteria | 5674 |
| 171 | Ga0500566_0070511 | 3300053094 | Bacteria | 1962 |
| 172 | Ga0500641_0001164 | 3300053096 | Bacteria | 9370 |
| 173 | Ga0500641_0005623 | 3300053096 | Bacteria | 4441 |
| 174 | Ga0500555_027282 | 3300053103 | Bacteria | 1629 |
| 175 | Ga0500555_049127 | 3300053103 | Bacteria | 1157 |
| 176 | Ga0500556_0003423 | 3300053104 | Bacteria | 4673 |
| 177 | Ga0500562_012675 | 3300053108 | Bacteria | 2146 |
| 178 | Ga0500562_014974 | 3300053108 | Bacteria | 1987 |
| 179 | Ga0500569_001759 | 3300053109 | Bacteria | 4152 |
| 180 | Ga0500593_053008 | 3300053117 | Bacteria | 1797 |
| 181 | Ga0500595_012678 | 3300053119 | Bacteria | 3251 |
| 182 | Ga0500595_044780 | 3300053119 | Bacteria | 1401 |
| 183 | Ga0500607_056166 | 3300053121 | Bacteria | 2079 |
| 184 | Ga0500608_000296 | 3300053122 | Bacteria | 19335 |
| 185 | Ga0500614_002844 | 3300053123 | Bacteria | 3802 |
| 186 | Ga0500559_0185044 | 3300053136 | Bacteria | 981 |
| 187 | Ga0500577_0048987 | 3300053142 | Bacteria | 1578 |
| 188 | Ga0500590_050828 | 3300053148 | Bacteria | 2107 |
| 189 | Ga0500622_0006679 | 3300053156 | Bacteria | 6648 |
| 190 | Ga0500622_0038700 | 3300053156 | Bacteria | 2488 |
| 191 | Ga0500638_096706 | 3300053162 | Unclassified | 1383 |
| 192 | Ga0500636_0012919 | 3300053177 | Bacteria | 4898 |
| 193 | Ga0500637_0001450 | 3300053178 | Bacteria | 10088 |
| 194 | Ga0500637_0321466 | 3300053178 | Bacteria | 835 |
| 195 | Ga0500645_001214 | 3300053730 | Bacteria | 13625 |
| 196 | Ga0500645_002602 | 3300053730 | Bacteria | 7929 |
| 197 | Ga0500645_003285 | 3300053730 | Bacteria | 6656 |
| 198 | Ga0500645_079408 | 3300053730 | Bacteria | 937 |
| 199 | Ga0500596_002509 | 3300053735 | Bacteria | 3618 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014969 | Ga0157376_10370331 | Ga0157376_103703312 | 166 |
| 2 | 3300041443 | Ga0451789_0389863 | Ga0451789_0389863_42_554 | 170 |
| 3 | 3300046525 | Ga0495663_0096088 | Ga0495663_0096088_315_827 | 170 |
| 4 | 3300037471 | Ga0395905_0288326 | Ga0395905_0288326_619_1197 | 174 |
| 5 | 3300046528 | Ga0495642_0297516 | Ga0495642_0297516_98_631 | 177 |
| 6 | 3300046684 | Ga0495669_0000002 | Ga0495669_0000002_38025_38558 | 177 |
| 7 | 3300047445 | Ga0495677_0120084 | Ga0495677_0120084_361_894 | 177 |
| 8 | 3300005564 | Ga0070664_100478338 | Ga0070664_1004783382 | 178 |
| 9 | 3300005618 | Ga0068864_100176033 | Ga0068864_1001760333 | 178 |
| 10 | 3300005841 | Ga0068863_100131360 | Ga0068863_1001313602 | 178 |
| 11 | 3300005841 | Ga0068863_100508151 | Ga0068863_1005081512 | 178 |
| 12 | 3300009553 | Ga0105249_10503510 | Ga0105249_105035102 | 178 |
| 13 | 3300014325 | Ga0163163_10136221 | Ga0163163_101362212 | 178 |
| 14 | 3300025917 | Ga0207660_10424437 | Ga0207660_104244371 | 178 |
| 15 | 3300026088 | Ga0207641_10134887 | Ga0207641_101348873 | 178 |
| 16 | 3300026095 | Ga0207676_10064194 | Ga0207676_100641942 | 178 |
| 17 | 3300039437 | Ga0436365_1686452 | Ga0436365_1686452_3419_3955 | 178 |
| 18 | 3300053142 | Ga0500577_0048987 | Ga0500577_0048987_763_1362 | 178 |
| 19 | 3300006881 | Ga0068865_100007279 | Ga0068865_1000072797 | 180 |
| 20 | 3300025938 | Ga0207704_10005508 | Ga0207704_100055086 | 180 |
| 21 | 3300026041 | Ga0207639_10718712 | Ga0207639_107187121 | 180 |
| 22 | 3300030521 | Ga0307511_10014383 | Ga0307511_100143832 | 180 |
| 23 | 3300046616 | Ga0495668_0070228 | Ga0495668_0070228_1050_1592 | 180 |
| 24 | 3300046616 | Ga0495668_0481912 | Ga0495668_0481912_10_552 | 180 |
| 25 | 3300050492 | nmdc:mga0yw44_127364_c1 | nmdc:mga0yw44_127364_c1_533_1075 | 180 |
| 26 | 3300006195 | Ga0075366_10103746 | Ga0075366_101037462 | 185 |
| 27 | 3300046525 | Ga0495663_0146231 | Ga0495663_0146231_225_782 | 185 |
| 28 | 3300032004 | Ga0307414_10279168 | Ga0307414_102791682 | 186 |
| 29 | 3300009551 | Ga0105238_10144387 | Ga0105238_101443872 | 187 |
| 30 | 3300014968 | Ga0157379_10599943 | Ga0157379_105999431 | 187 |
| 31 | 3300025304 | Ga0209257_1002321 | Ga0209257_10023216 | 187 |
| 32 | 3300025924 | Ga0207694_10205245 | Ga0207694_102052452 | 187 |
| 33 | 3300047472 | Ga0495686_0002645 | Ga0495686_0002645_3299_3868 | 187 |
| 34 | 3300049581 | Ga0501047_0194240 | Ga0501047_0194240_428_991 | 187 |
| 35 | iso_pu_bacteria | 2643221598 | 2643998813 | 187 |
| 36 | 3300046616 | Ga0495668_0017817 | Ga0495668_0017817_2465_3043 | 188 |
| 37 | 3300047320 | Ga0495672_0217205 | Ga0495672_0217205_282_860 | 188 |
| 38 | 3300053103 | Ga0500555_049127 | Ga0500555_049127_362_931 | 188 |
| 39 | 3300053730 | Ga0500645_003285 | Ga0500645_003285_4949_5527 | 188 |
| 40 | 3300005331 | Ga0070670_100064880 | Ga0070670_1000648804 | 189 |
| 41 | 3300005347 | Ga0070668_100014120 | Ga0070668_1000141205 | 189 |
| 42 | 3300005347 | Ga0070668_100056267 | Ga0070668_1000562675 | 189 |
| 43 | 3300005353 | Ga0070669_100239873 | Ga0070669_1002398732 | 189 |
| 44 | 3300005355 | Ga0070671_100008279 | Ga0070671_1000082795 | 189 |
| 45 | 3300005367 | Ga0070667_100005870 | Ga0070667_1000058705 | 189 |
| 46 | 3300005367 | Ga0070667_100013680 | Ga0070667_1000136805 | 189 |
| 47 | 3300005548 | Ga0070665_100006730 | Ga0070665_1000067309 | 189 |
| 48 | 3300005548 | Ga0070665_100036505 | Ga0070665_1000365054 | 189 |
| 49 | 3300005617 | Ga0068859_100000747 | Ga0068859_1000007475 | 189 |
| 50 | 3300005618 | Ga0068864_100000283 | Ga0068864_1000002837 | 189 |
| 51 | 3300005719 | Ga0068861_100289491 | Ga0068861_1002894912 | 189 |
| 52 | 3300005841 | Ga0068863_100000091 | Ga0068863_10000009197 | 189 |
| 53 | 3300005841 | Ga0068863_100030798 | Ga0068863_1000307984 | 189 |
| 54 | 3300005842 | Ga0068858_100000059 | Ga0068858_10000005926 | 189 |
| 55 | 3300005842 | Ga0068858_100001493 | Ga0068858_1000014935 | 189 |
| 56 | 3300005843 | Ga0068860_100076674 | Ga0068860_1000766741 | 189 |
| 57 | 3300005844 | Ga0068862_100031625 | Ga0068862_1000316253 | 189 |
| 58 | 3300005844 | Ga0068862_100167192 | Ga0068862_1001671922 | 189 |
| 59 | 3300006931 | Ga0097620_100000747 | Ga0097620_10000074736 | 189 |
| 60 | 3300009092 | Ga0105250_10022075 | Ga0105250_100220751 | 189 |
| 61 | 3300009177 | Ga0105248_10046562 | Ga0105248_100465624 | 189 |
| 62 | 3300009177 | Ga0105248_10118046 | Ga0105248_101180464 | 189 |
| 63 | 3300009177 | Ga0105248_10914236 | Ga0105248_109142362 | 189 |
| 64 | 3300009553 | Ga0105249_10242551 | Ga0105249_102425512 | 189 |
| 65 | 3300013306 | Ga0163162_10059290 | Ga0163162_100592903 | 189 |
| 66 | 3300014325 | Ga0163163_10018815 | Ga0163163_100188155 | 189 |
| 67 | 3300014325 | Ga0163163_10921292 | Ga0163163_109212922 | 189 |
| 68 | 3300014968 | Ga0157379_10008799 | Ga0157379_100087995 | 189 |
| 69 | 3300014968 | Ga0157379_10091117 | Ga0157379_100911174 | 189 |
| 70 | 3300025250 | Ga0209026_1006600 | Ga0209026_10066003 | 189 |
| 71 | 3300025923 | Ga0207681_10008454 | Ga0207681_100084542 | 189 |
| 72 | 3300025925 | Ga0207650_10045361 | Ga0207650_100453613 | 189 |
| 73 | 3300025931 | Ga0207644_10004353 | Ga0207644_100043537 | 189 |
| 74 | 3300025941 | Ga0207711_10002787 | Ga0207711_1000278716 | 189 |
| 75 | 3300025941 | Ga0207711_10648232 | Ga0207711_106482321 | 189 |
| 76 | 3300025961 | Ga0207712_10194735 | Ga0207712_101947351 | 189 |
| 77 | 3300025972 | Ga0207668_10000001 | Ga0207668_1000000180 | 189 |
| 78 | 3300025986 | Ga0207658_10009050 | Ga0207658_100090505 | 189 |
| 79 | 3300025986 | Ga0207658_10274097 | Ga0207658_102740972 | 189 |
| 80 | 3300026035 | Ga0207703_10000049 | Ga0207703_1000004933 | 189 |
| 81 | 3300026035 | Ga0207703_10015974 | Ga0207703_100159744 | 189 |
| 82 | 3300026088 | Ga0207641_10000011 | Ga0207641_10000011165 | 189 |
| 83 | 3300026088 | Ga0207641_10002650 | Ga0207641_100026505 | 189 |
| 84 | 3300026095 | Ga0207676_10000503 | Ga0207676_1000050329 | 189 |
| 85 | 3300026118 | Ga0207675_100384273 | Ga0207675_1003842732 | 189 |
| 86 | 3300028379 | Ga0268266_10008732 | Ga0268266_100087329 | 189 |
| 87 | 3300028380 | Ga0268265_10009526 | Ga0268265_100095263 | 189 |
| 88 | 3300028381 | Ga0268264_10115179 | Ga0268264_101151792 | 189 |
| 89 | 3300028786 | Ga0307517_10027161 | Ga0307517_100271614 | 189 |
| 90 | 3300037471 | Ga0395905_0458312 | Ga0395905_0458312_270_842 | 189 |
| 91 | 3300039437 | Ga0436365_0055061 | Ga0436365_0055061_371_940 | 189 |
| 92 | 3300049581 | Ga0501047_0026168 | Ga0501047_0026168_4190_4759 | 189 |
| 93 | 3300053096 | Ga0500641_0005623 | Ga0500641_0005623_3815_4384 | 189 |
| 94 | 3300021384 | Ga0213876_10021862 | Ga0213876_100218622 | 190 |
| 95 | 3300031730 | Ga0307516_10000035 | Ga0307516_10000035135 | 190 |
| 96 | 3300046499 | Ga0495594_0298914 | Ga0495594_0298914_145_759 | 190 |
| 97 | 3300046689 | Ga0495613_0150643 | Ga0495613_0150643_376_990 | 190 |
| 98 | 3300005336 | Ga0070680_100295575 | Ga0070680_1002955751 | 191 |
| 99 | 3300005339 | Ga0070660_100187691 | Ga0070660_1001876913 | 191 |
| 100 | 3300005339 | Ga0070660_100383434 | Ga0070660_1003834342 | 191 |
| 101 | 3300005366 | Ga0070659_100017722 | Ga0070659_1000177226 | 191 |
| 102 | 3300005457 | Ga0070662_100293811 | Ga0070662_1002938112 | 191 |
| 103 | 3300005578 | Ga0068854_100159798 | Ga0068854_1001597983 | 191 |
| 104 | 3300006028 | Ga0070717_10020425 | Ga0070717_100204251 | 191 |
| 105 | 3300006178 | Ga0075367_10004389 | Ga0075367_100043898 | 191 |
| 106 | 3300009093 | Ga0105240_10024147 | Ga0105240_100241478 | 191 |
| 107 | 3300009177 | Ga0105248_10000661 | Ga0105248_100006618 | 191 |
| 108 | 3300009177 | Ga0105248_10035390 | Ga0105248_100353904 | 191 |
| 109 | 3300010375 | Ga0105239_10589941 | Ga0105239_105899412 | 191 |
| 110 | 3300021384 | Ga0213876_10296084 | Ga0213876_102960842 | 191 |
| 111 | 3300025913 | Ga0207695_10006835 | Ga0207695_1000683510 | 191 |
| 112 | 3300025914 | Ga0207671_10266650 | Ga0207671_102666501 | 191 |
| 113 | 3300025932 | Ga0207690_10000352 | Ga0207690_1000035217 | 191 |
| 114 | 3300025933 | Ga0207706_10687775 | Ga0207706_106877752 | 191 |
| 115 | 3300025941 | Ga0207711_10000316 | Ga0207711_1000031624 | 191 |
| 116 | 3300025941 | Ga0207711_10003586 | Ga0207711_100035866 | 191 |
| 117 | 3300025981 | Ga0207640_10572368 | Ga0207640_105723682 | 191 |
| 118 | 3300026095 | Ga0207676_10348152 | Ga0207676_103481522 | 191 |
| 119 | 3300031616 | Ga0307508_10129112 | Ga0307508_101291123 | 191 |
| 120 | 3300035113 | Ga0373936_0003766 | Ga0373936_0003766_4889_5479 | 191 |
| 121 | 3300037312 | Ga0395899_0000485 | Ga0395899_0000485_7129_7719 | 191 |
| 122 | 3300037418 | Ga0395900_0000072 | Ga0395900_0000072_54149_54739 | 191 |
| 123 | 3300037418 | Ga0395900_0221733 | Ga0395900_0221733_668_1243 | 191 |
| 124 | 3300037466 | Ga0395898_0023051 | Ga0395898_0023051_1549_2139 | 191 |
| 125 | 3300037471 | Ga0395905_0034368 | Ga0395905_0034368_15_605 | 191 |
| 126 | 3300038443 | Ga0395901_0000052 | Ga0395901_0000052_72096_72686 | 191 |
| 127 | 3300045836 | Ga0466958_0211148 | Ga0466958_0211148_191_766 | 191 |
| 128 | 3300046459 | Ga0495629_0036079 | Ga0495629_0036079_2860_3447 | 191 |
| 129 | 3300046542 | Ga0495597_0002075 | Ga0495597_0002075_4452_5039 | 191 |
| 130 | 3300046557 | Ga0495622_0009065 | Ga0495622_0009065_3628_4215 | 191 |
| 131 | 3300047443 | Ga0495687_009102 | Ga0495687_009102_973_1560 | 191 |
| 132 | 3300047673 | Ga0495593_0022213 | Ga0495593_0022213_1994_2581 | 191 |
| 133 | 3300048088 | Ga0495602_0103336 | Ga0495602_0103336_444_1031 | 191 |
| 134 | 3300048905 | Ga0496102_0186821 | Ga0496102_0186821_945_1532 | 191 |
| 135 | 3300048906 | Ga0496103_0335164 | Ga0496103_0335164_297_884 | 191 |
| 136 | 3300048920 | Ga0496117_0027796 | Ga0496117_0027796_2766_3353 | 191 |
| 137 | 3300048921 | Ga0496118_0013355 | Ga0496118_0013355_878_1465 | 191 |
| 138 | 3300048924 | Ga0496121_0000397 | Ga0496121_0000397_40183_40770 | 191 |
| 139 | 3300049823 | Ga0501044_0309738 | Ga0501044_0309738_839_1414 | 191 |
| 140 | 3300050491 | nmdc:mga00v17_4821_c1 | nmdc:mga00v17_4821_c1_3667_4248 | 191 |
| 141 | 3300053080 | Ga0500635_0000270 | Ga0500635_0000270_4488_5075 | 191 |
| 142 | 3300053086 | Ga0500578_0287883 | Ga0500578_0287883_305_892 | 191 |
| 143 | 3300053093 | Ga0500651_0009966 | Ga0500651_0009966_2068_2655 | 191 |
| 144 | 3300053094 | Ga0500566_0070511 | Ga0500566_0070511_584_1171 | 191 |
| 145 | 3300053109 | Ga0500569_001759 | Ga0500569_001759_790_1377 | 191 |
| 146 | 3300053119 | Ga0500595_012678 | Ga0500595_012678_1104_1691 | 191 |
| 147 | 3300053119 | Ga0500595_044780 | Ga0500595_044780_241_834 | 191 |
| 148 | 3300053121 | Ga0500607_056166 | Ga0500607_056166_1393_1980 | 191 |
| 149 | 3300053122 | Ga0500608_000296 | Ga0500608_000296_14222_14809 | 191 |
| 150 | 3300053123 | Ga0500614_002844 | Ga0500614_002844_1809_2396 | 191 |
| 151 | 3300053136 | Ga0500559_0185044 | Ga0500559_0185044_209_796 | 191 |
| 152 | 3300053148 | Ga0500590_050828 | Ga0500590_050828_1051_1638 | 191 |
| 153 | 3300053162 | Ga0500638_096706 | Ga0500638_096706_54_641 | 191 |
| 154 | 3300053177 | Ga0500636_0012919 | Ga0500636_0012919_138_725 | 191 |
| 155 | 3300053178 | Ga0500637_0001450 | Ga0500637_0001450_5381_5968 | 191 |
| 156 | 3300053178 | Ga0500637_0321466 | Ga0500637_0321466_166_753 | 191 |
| 157 | 3300053730 | Ga0500645_079408 | Ga0500645_079408_297_884 | 191 |
| 158 | 3300053735 | Ga0500596_002509 | Ga0500596_002509_2047_2634 | 191 |
| 159 | 3300005336 | Ga0070680_100063452 | Ga0070680_1000634521 | 192 |
| 160 | 3300005339 | Ga0070660_100719563 | Ga0070660_1007195631 | 192 |
| 161 | 3300005366 | Ga0070659_100317264 | Ga0070659_1003172642 | 192 |
| 162 | 3300005458 | Ga0070681_10017044 | Ga0070681_100170445 | 192 |
| 163 | 3300005530 | Ga0070679_100104317 | Ga0070679_1001043173 | 192 |
| 164 | 3300005539 | Ga0068853_100081389 | Ga0068853_1000813894 | 192 |
| 165 | 3300005563 | Ga0068855_100134933 | Ga0068855_1001349332 | 192 |
| 166 | 3300005577 | Ga0068857_100333719 | Ga0068857_1003337192 | 192 |
| 167 | 3300009551 | Ga0105238_10550831 | Ga0105238_105508312 | 192 |
| 168 | 3300025909 | Ga0207705_10027538 | Ga0207705_100275384 | 192 |
| 169 | 3300025912 | Ga0207707_10148231 | Ga0207707_101482314 | 192 |
| 170 | 3300025917 | Ga0207660_10082572 | Ga0207660_100825724 | 192 |
| 171 | 3300025919 | Ga0207657_10060441 | Ga0207657_100604411 | 192 |
| 172 | 3300025921 | Ga0207652_10042796 | Ga0207652_100427964 | 192 |
| 173 | 3300025924 | Ga0207694_10838866 | Ga0207694_108388661 | 192 |
| 174 | 3300025949 | Ga0207667_10066282 | Ga0207667_100662824 | 192 |
| 175 | 3300026041 | Ga0207639_10050953 | Ga0207639_100509533 | 192 |
| 176 | 3300053087 | Ga0500643_001004 | Ga0500643_001004_4959_5549 | 192 |
| 177 | 3300053096 | Ga0500641_0001164 | Ga0500641_0001164_3822_4412 | 192 |
| 178 | 3300053103 | Ga0500555_027282 | Ga0500555_027282_11_595 | 192 |
| 179 | 3300053104 | Ga0500556_0003423 | Ga0500556_0003423_2777_3367 | 192 |
| 180 | 3300053108 | Ga0500562_012675 | Ga0500562_012675_1364_1954 | 192 |
| 181 | 3300053108 | Ga0500562_014974 | Ga0500562_014974_146_736 | 192 |
| 182 | 3300053117 | Ga0500593_053008 | Ga0500593_053008_750_1340 | 192 |
| 183 | 3300053156 | Ga0500622_0006679 | Ga0500622_0006679_5422_6012 | 192 |
| 184 | 3300053156 | Ga0500622_0038700 | Ga0500622_0038700_1823_2413 | 192 |
| 185 | 3300053730 | Ga0500645_001214 | Ga0500645_001214_7447_8037 | 192 |
| 186 | 3300053730 | Ga0500645_002602 | Ga0500645_002602_7109_7699 | 192 |
| 187 | 3300005339 | Ga0070660_100787207 | Ga0070660_1007872071 | 193 |
| 188 | 3300005548 | Ga0070665_100001028 | Ga0070665_1000010287 | 193 |
| 189 | 3300010375 | Ga0105239_10337816 | Ga0105239_103378161 | 193 |
| 190 | 3300026041 | Ga0207639_10298151 | Ga0207639_102981512 | 193 |
| 191 | 3300027462 | Ga0210000_1004560 | Ga0210000_10045602 | 193 |
| 192 | 3300037068 | Ga0373925_0155754 | Ga0373925_0155754_665_1252 | 193 |
| 193 | iso_pu_bacteria | 2643221545 | 2643749317 | 195 |
| 194 | iso_pu_bacteria | 2643221583 | 2643923129 | 195 |
| 195 | iso_pu_bacteria | 2643221691 | 2644508909 | 195 |
| 196 | 3300049671 | Ga0501238_018182 | Ga0501238_018182_22_618 | 198 |
| 197 | 3300042156 | Ga0439446_0001961 | Ga0439446_0001961_3550_4149 | 199 |
| 198 | 3300046453 | Ga0495627_005298 | Ga0495627_005298_1437_2036 | 199 |
| 199 | 3300046507 | Ga0495606_0002470 | Ga0495606_0002470_2598_3197 | 199 |
| 200 | 3300047469 | Ga0495673_0000025 | Ga0495673_0000025_450302_450901 | 199 |
| 201 | 3300049671 | Ga0501238_009887 | Ga0501238_009887_531_1130 | 199 |
| 202 | 3300003215 | JGI25153J46596_10045519 | JGI25153J46596_100455192 | 204 |
| 203 | 3300047470 | Ga0495681_0102885 | Ga0495681_0102885_101_715 | 204 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1sou-assembly1.cif.gz_A | nmr structure of aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: northeast structural genomics consortium target qr46 | 0.8163 | 10 | 204 |
| 1u3g-assembly1.cif.gz_A | structural and functional characterization of a 5,10-methenyltetrahydrofolate synthetase from mycoplasma pneumoniae (gi: 13508087) | 0.8103 | 10 | 196 |
| 1u3g-assembly1.cif.gz_A | structural and functional characterization of a 5,10-methenyltetrahydrofolate synthetase from mycoplasma pneumoniae (gi: 13508087) | 0.7971 | 10 | 196 |
| 1wkc-assembly1.cif.gz_A | crystal structure of a 5-formyltetrahydrofolate cycloligase-related protein from thermus thermophilus hb8 | 0.7897 | 10 | 204 |
| 1wkc-assembly1.cif.gz_A | crystal structure of a 5-formyltetrahydrofolate cycloligase-related protein from thermus thermophilus hb8 | 0.777 | 10 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AC28_1_181_3.40.50.10420 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.8227 | 17 | 199 | 3.40.50.10420 |
| af_Q9XWE6_1_200_3.40.50.10420 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.8194 | 7 | 197 | 3.40.50.10420 |
| 1souA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.8163 | 10 | 204 | 3.40.50.10420 |
| af_O05575_1_191_3.40.50.10420 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.8153 | 1 | 199 | 3.40.50.10420 |
| af_O05575_1_191_3.40.50.10420 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.8114 | 1 | 199 | 3.40.50.10420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7LKH7-F1-model_v4 | 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) | 0.9564 | 1 | 203 |
GO:0005524
GO:0009396 GO:0030272 GO:0035999 GO:0046872 |
| AF-D5VEP1-F1-model_v4 | 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) | 0.9554 | 1 | 203 |
GO:0005524
GO:0009396 GO:0030272 GO:0035999 GO:0046872 |
| AF-A0A3C1B6M5-F1-model_v4 | 5-formyltetrahydrofolate cyclo-ligase | 0.9513 | 126 | 201 |
GO:0005524
GO:0009396 GO:0030272 GO:0035999 |
| AF-D5VEP1-F1-model_v4 | 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) | 0.9507 | 1 | 203 |
GO:0005524
GO:0009396 GO:0030272 GO:0035999 GO:0046872 |
| AF-A0A371BAX2-F1-model_v4 | 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) | 0.9463 | 49 | 200 |
GO:0005524
GO:0009396 GO:0030272 GO:0035999 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar