F311209

General Info

Members Datasets Scaffolds Average Seq Length
203 145 199 192

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10337816|Ga0105239_103378161
Length 215
Sequence VKQSFTVFAAPPPVSPGDPVSPGLDKTSLRVRLRGLRRRLATEIPDAAQRAAERLPLARLPRYRVFGLYHAMGSEMDPMPLMYELHSGDAKPTLPVALDRDSPLVLRLWSKGMRLEPDALGVPAPVPIMPVLTPDLVVVPLLGFDRKGGRLGQGAGHYDRTLRMLRAKKPVFALGLAYAGQEVEELPLEAHDERLDAILTETDYIEVAPGTRAAD

Samples

Sample ID Description Type Environment
1 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
2 2643221583 Caulobacter sp. Root655 Isolate Unclassified
3 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
4 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
91 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
98 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
99 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
100 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
101 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
106 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
107 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
108 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
121 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
122 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
123 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
124 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
125 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
126 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
127 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
128 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
129 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
130 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
131 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
132 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
133 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
134 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
135 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
136 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
137 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
138 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
139 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
142 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
143 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
144 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
145 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 0
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.21
Nodule 0
Rhizoplane 1.48
Rhizosphere 71.43
Stem 0
Stem Tuber 0
Unclassified 7.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10045519 3300003215 Bacteria 1308
2 Ga0070670_100064880 3300005331 Bacteria 3133
3 Ga0070680_100063452 3300005336 Bacteria 3026
4 Ga0070680_100295575 3300005336 Bacteria 1373
5 Ga0070660_100187691 3300005339 Bacteria 1674
6 Ga0070660_100383434 3300005339 Bacteria 1160
7 Ga0070660_100719563 3300005339 Bacteria 837
8 Ga0070660_100787207 3300005339 Bacteria 799
9 Ga0070668_100014120 3300005347 Bacteria 5969
10 Ga0070668_100056267 3300005347 Bacteria 3037
11 Ga0070669_100239873 3300005353 Bacteria 1440
12 Ga0070671_100008279 3300005355 Bacteria 8323
13 Ga0070659_100017722 3300005366 Bacteria 5364
14 Ga0070659_100317264 3300005366 Bacteria 1302
15 Ga0070667_100005870 3300005367 Bacteria 10237
16 Ga0070667_100013680 3300005367 Bacteria 6705
17 Ga0070662_100293811 3300005457 Bacteria 1318
18 Ga0070681_10017044 3300005458 Bacteria 7260
19 Ga0070679_100104317 3300005530 Bacteria 2821
20 Ga0068853_100081389 3300005539 Bacteria 2835
21 Ga0070665_100001028 3300005548 Bacteria 34986
22 Ga0070665_100006730 3300005548 Bacteria 11683
23 Ga0070665_100036505 3300005548 Bacteria 4944
24 Ga0068855_100134933 3300005563 Bacteria 2816
25 Ga0070664_100478338 3300005564 Bacteria 1146
26 Ga0068857_100333719 3300005577 Bacteria 1402
27 Ga0068854_100159798 3300005578 Bacteria 1744
28 Ga0068859_100000747 3300005617 Bacteria 32789
29 Ga0068864_100000283 3300005618 Bacteria 45450
30 Ga0068864_100176033 3300005618 Bacteria 1953
31 Ga0068861_100289491 3300005719 Bacteria 1414
32 Ga0068863_100000091 3300005841 Bacteria 98724
33 Ga0068863_100030798 3300005841 Bacteria 5123
34 Ga0068863_100131360 3300005841 Bacteria 2391
35 Ga0068863_100508151 3300005841 Bacteria 1187
36 Ga0068858_100000059 3300005842 Bacteria 117158
37 Ga0068858_100001493 3300005842 Bacteria 24115
38 Ga0068860_100076674 3300005843 Bacteria 3179
39 Ga0068862_100031625 3300005844 Bacteria 4470
40 Ga0068862_100167192 3300005844 Bacteria 1967
41 Ga0070717_10020425 3300006028 Bacteria 5208
42 Ga0075367_10004389 3300006178 Bacteria 6883
43 Ga0075366_10103746 3300006195 Bacteria 1708
44 Ga0068865_100007279 3300006881 Bacteria 6800
45 Ga0097620_100000747 3300006931 Bacteria 32789
46 Ga0105250_10022075 3300009092 Bacteria 2568
47 Ga0105240_10024147 3300009093 Bacteria 8023
48 Ga0105248_10000661 3300009177 Bacteria 39161
49 Ga0105248_10035390 3300009177 Bacteria 5586
50 Ga0105248_10046562 3300009177 Bacteria 4861
51 Ga0105248_10118046 3300009177 Bacteria 2992
52 Ga0105248_10914236 3300009177 Bacteria 991
53 Ga0105238_10144387 3300009551 Bacteria 2356
54 Ga0105238_10550831 3300009551 Bacteria 1158
55 Ga0105249_10242551 3300009553 Bacteria 1782
56 Ga0105249_10503510 3300009553 Bacteria 1256
57 Ga0105239_10337816 3300010375 Bacteria 1699
58 Ga0105239_10589941 3300010375 Bacteria 1267
59 Ga0163162_10059290 3300013306 Bacteria 3859
60 Ga0163163_10018815 3300014325 Bacteria 6476
61 Ga0163163_10136221 3300014325 Bacteria 2497
62 Ga0163163_10921292 3300014325 Bacteria 937
63 Ga0157379_10008799 3300014968 Bacteria 8805
64 Ga0157379_10091117 3300014968 Bacteria 2735
65 Ga0157379_10599943 3300014968 Bacteria 1028
66 Ga0157376_10370331 3300014969 Unclassified 1377
67 Ga0213876_10021862 3300021384 Bacteria 3384
68 Ga0213876_10296084 3300021384 Bacteria 860
69 Ga0209026_1006600 3300025250 Bacteria 2802
70 Ga0209257_1002321 3300025304 Bacteria 19216
71 Ga0207705_10027538 3300025909 Bacteria 4053
72 Ga0207707_10148231 3300025912 Bacteria 2051
73 Ga0207695_10006835 3300025913 Bacteria 14689
74 Ga0207671_10266650 3300025914 Bacteria 1348
75 Ga0207660_10082572 3300025917 Bacteria 2364
76 Ga0207660_10424437 3300025917 Bacteria 1073
77 Ga0207657_10060441 3300025919 Bacteria 3252
78 Ga0207652_10042796 3300025921 Bacteria 3856
79 Ga0207681_10008454 3300025923 Bacteria 6290
80 Ga0207694_10205245 3300025924 Bacteria 1604
81 Ga0207694_10838866 3300025924 Bacteria 777
82 Ga0207650_10045361 3300025925 Bacteria 3234
83 Ga0207644_10004353 3300025931 Bacteria 9188
84 Ga0207690_10000352 3300025932 Bacteria 30589
85 Ga0207706_10687775 3300025933 Bacteria 874
86 Ga0207704_10005508 3300025938 Bacteria 5837
87 Ga0207711_10000316 3300025941 Bacteria 51683
88 Ga0207711_10002787 3300025941 Bacteria 15373
89 Ga0207711_10003586 3300025941 Bacteria 13425
90 Ga0207711_10648232 3300025941 Bacteria 985
91 Ga0207667_10066282 3300025949 Bacteria 3764
92 Ga0207712_10194735 3300025961 Bacteria 1602
93 Ga0207668_10000001 3300025972 Bacteria 266091
94 Ga0207640_10572368 3300025981 Bacteria 952
95 Ga0207658_10009050 3300025986 Bacteria 6754
96 Ga0207658_10274097 3300025986 Bacteria 1443
97 Ga0207703_10000049 3300026035 Bacteria 149817
98 Ga0207703_10015974 3300026035 Bacteria 5854
99 Ga0207639_10050953 3300026041 Bacteria 3146
100 Ga0207639_10298151 3300026041 Bacteria 1424
101 Ga0207639_10718712 3300026041 Bacteria 927
102 Ga0207641_10000011 3300026088 Bacteria 384362
103 Ga0207641_10002650 3300026088 Bacteria 16363
104 Ga0207641_10134887 3300026088 Bacteria 2221
105 Ga0207676_10000503 3300026095 Bacteria 32970
106 Ga0207676_10064194 3300026095 Bacteria 2919
107 Ga0207676_10348152 3300026095 Bacteria 1369
108 Ga0207675_100384273 3300026118 Bacteria 1381
109 Ga0210000_1004560 3300027462 Bacteria 1998
110 Ga0268266_10008732 3300028379 Bacteria 8981
111 Ga0268265_10009526 3300028380 Bacteria 6560
112 Ga0268264_10115179 3300028381 Bacteria 2361
113 Ga0307517_10027161 3300028786 Bacteria 6886
114 Ga0307511_10014383 3300030521 Bacteria 7706
115 Ga0307508_10129112 3300031616 Bacteria 2131
116 Ga0307516_10000035 3300031730 Bacteria 152658
117 Ga0307414_10279168 3300032004 Bacteria 1403
118 Ga0373936_0003766 3300035113 Bacteria 5702
119 Ga0373925_0155754 3300037068 Bacteria 1797
120 Ga0395899_0000485 3300037312 Bacteria 44590
121 Ga0395900_0000072 3300037418 Bacteria 187428
122 Ga0395900_0221733 3300037418 Bacteria 1905
123 Ga0395898_0023051 3300037466 Bacteria 6294
124 Ga0395905_0034368 3300037471 Bacteria 4760
125 Ga0395905_0288326 3300037471 Bacteria 1528
126 Ga0395905_0458312 3300037471 Bacteria 1173
127 Ga0395901_0000052 3300038443 Bacteria 165888
128 Ga0436365_0055061 3300039437 Bacteria 1046
129 Ga0436365_1686452 3300039437 Bacteria 4788
130 Ga0451789_0389863 3300041443 Bacteria 565
131 Ga0439446_0001961 3300042156 Bacteria 4857
132 Ga0466958_0211148 3300045836 Bacteria 1237
133 Ga0495627_005298 3300046453 Bacteria 5225
134 Ga0495629_0036079 3300046459 Bacteria 3493
135 Ga0495594_0298914 3300046499 Bacteria 917
136 Ga0495606_0002470 3300046507 Bacteria 21413
137 Ga0495663_0096088 3300046525 Bacteria 971
138 Ga0495663_0146231 3300046525 Bacteria 804
139 Ga0495642_0297516 3300046528 Bacteria 707
140 Ga0495597_0002075 3300046542 Bacteria 13367
141 Ga0495622_0009065 3300046557 Bacteria 4607
142 Ga0495668_0017817 3300046616 Bacteria 4115
143 Ga0495668_0070228 3300046616 Bacteria 1925
144 Ga0495668_0481912 3300046616 Bacteria 683
145 Ga0495669_0000002 3300046684 Bacteria 282777
146 Ga0495613_0150643 3300046689 Bacteria 1659
147 Ga0495672_0217205 3300047320 Bacteria 946
148 Ga0495687_009102 3300047443 Bacteria 5592
149 Ga0495677_0120084 3300047445 Bacteria 1002
150 Ga0495673_0000025 3300047469 Bacteria 512352
151 Ga0495681_0102885 3300047470 Bacteria 1246
152 Ga0495686_0002645 3300047472 Bacteria 16532
153 Ga0495593_0022213 3300047673 Bacteria 3539
154 Ga0495602_0103336 3300048088 Bacteria 2333
155 Ga0496102_0186821 3300048905 Bacteria 1953
156 Ga0496103_0335164 3300048906 Bacteria 973
157 Ga0496117_0027796 3300048920 Bacteria 4395
158 Ga0496118_0013355 3300048921 Bacteria 7773
159 Ga0496121_0000397 3300048924 Bacteria 87422
160 Ga0501047_0026168 3300049581 Bacteria 5612
161 Ga0501047_0194240 3300049581 Bacteria 1892
162 Ga0501238_009887 3300049671 Bacteria 1268
163 Ga0501238_018182 3300049671 Bacteria 982
164 Ga0501044_0309738 3300049823 Bacteria 1506
165 nmdc:mga00v17_4821_c1 3300050491 Bacteria 5707
166 nmdc:mga0yw44_127364_c1 3300050492 Bacteria 1645
167 Ga0500635_0000270 3300053080 Bacteria 20001
168 Ga0500578_0287883 3300053086 Bacteria 978
169 Ga0500643_001004 3300053087 Bacteria 17272
170 Ga0500651_0009966 3300053093 Bacteria 5674
171 Ga0500566_0070511 3300053094 Bacteria 1962
172 Ga0500641_0001164 3300053096 Bacteria 9370
173 Ga0500641_0005623 3300053096 Bacteria 4441
174 Ga0500555_027282 3300053103 Bacteria 1629
175 Ga0500555_049127 3300053103 Bacteria 1157
176 Ga0500556_0003423 3300053104 Bacteria 4673
177 Ga0500562_012675 3300053108 Bacteria 2146
178 Ga0500562_014974 3300053108 Bacteria 1987
179 Ga0500569_001759 3300053109 Bacteria 4152
180 Ga0500593_053008 3300053117 Bacteria 1797
181 Ga0500595_012678 3300053119 Bacteria 3251
182 Ga0500595_044780 3300053119 Bacteria 1401
183 Ga0500607_056166 3300053121 Bacteria 2079
184 Ga0500608_000296 3300053122 Bacteria 19335
185 Ga0500614_002844 3300053123 Bacteria 3802
186 Ga0500559_0185044 3300053136 Bacteria 981
187 Ga0500577_0048987 3300053142 Bacteria 1578
188 Ga0500590_050828 3300053148 Bacteria 2107
189 Ga0500622_0006679 3300053156 Bacteria 6648
190 Ga0500622_0038700 3300053156 Bacteria 2488
191 Ga0500638_096706 3300053162 Unclassified 1383
192 Ga0500636_0012919 3300053177 Bacteria 4898
193 Ga0500637_0001450 3300053178 Bacteria 10088
194 Ga0500637_0321466 3300053178 Bacteria 835
195 Ga0500645_001214 3300053730 Bacteria 13625
196 Ga0500645_002602 3300053730 Bacteria 7929
197 Ga0500645_003285 3300053730 Bacteria 6656
198 Ga0500645_079408 3300053730 Bacteria 937
199 Ga0500596_002509 3300053735 Bacteria 3618

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014969 Ga0157376_10370331 Ga0157376_103703312 166
2 3300041443 Ga0451789_0389863 Ga0451789_0389863_42_554 170
3 3300046525 Ga0495663_0096088 Ga0495663_0096088_315_827 170
4 3300037471 Ga0395905_0288326 Ga0395905_0288326_619_1197 174
5 3300046528 Ga0495642_0297516 Ga0495642_0297516_98_631 177
6 3300046684 Ga0495669_0000002 Ga0495669_0000002_38025_38558 177
7 3300047445 Ga0495677_0120084 Ga0495677_0120084_361_894 177
8 3300005564 Ga0070664_100478338 Ga0070664_1004783382 178
9 3300005618 Ga0068864_100176033 Ga0068864_1001760333 178
10 3300005841 Ga0068863_100131360 Ga0068863_1001313602 178
11 3300005841 Ga0068863_100508151 Ga0068863_1005081512 178
12 3300009553 Ga0105249_10503510 Ga0105249_105035102 178
13 3300014325 Ga0163163_10136221 Ga0163163_101362212 178
14 3300025917 Ga0207660_10424437 Ga0207660_104244371 178
15 3300026088 Ga0207641_10134887 Ga0207641_101348873 178
16 3300026095 Ga0207676_10064194 Ga0207676_100641942 178
17 3300039437 Ga0436365_1686452 Ga0436365_1686452_3419_3955 178
18 3300053142 Ga0500577_0048987 Ga0500577_0048987_763_1362 178
19 3300006881 Ga0068865_100007279 Ga0068865_1000072797 180
20 3300025938 Ga0207704_10005508 Ga0207704_100055086 180
21 3300026041 Ga0207639_10718712 Ga0207639_107187121 180
22 3300030521 Ga0307511_10014383 Ga0307511_100143832 180
23 3300046616 Ga0495668_0070228 Ga0495668_0070228_1050_1592 180
24 3300046616 Ga0495668_0481912 Ga0495668_0481912_10_552 180
25 3300050492 nmdc:mga0yw44_127364_c1 nmdc:mga0yw44_127364_c1_533_1075 180
26 3300006195 Ga0075366_10103746 Ga0075366_101037462 185
27 3300046525 Ga0495663_0146231 Ga0495663_0146231_225_782 185
28 3300032004 Ga0307414_10279168 Ga0307414_102791682 186
29 3300009551 Ga0105238_10144387 Ga0105238_101443872 187
30 3300014968 Ga0157379_10599943 Ga0157379_105999431 187
31 3300025304 Ga0209257_1002321 Ga0209257_10023216 187
32 3300025924 Ga0207694_10205245 Ga0207694_102052452 187
33 3300047472 Ga0495686_0002645 Ga0495686_0002645_3299_3868 187
34 3300049581 Ga0501047_0194240 Ga0501047_0194240_428_991 187
35 iso_pu_bacteria 2643221598 2643998813 187
36 3300046616 Ga0495668_0017817 Ga0495668_0017817_2465_3043 188
37 3300047320 Ga0495672_0217205 Ga0495672_0217205_282_860 188
38 3300053103 Ga0500555_049127 Ga0500555_049127_362_931 188
39 3300053730 Ga0500645_003285 Ga0500645_003285_4949_5527 188
40 3300005331 Ga0070670_100064880 Ga0070670_1000648804 189
41 3300005347 Ga0070668_100014120 Ga0070668_1000141205 189
42 3300005347 Ga0070668_100056267 Ga0070668_1000562675 189
43 3300005353 Ga0070669_100239873 Ga0070669_1002398732 189
44 3300005355 Ga0070671_100008279 Ga0070671_1000082795 189
45 3300005367 Ga0070667_100005870 Ga0070667_1000058705 189
46 3300005367 Ga0070667_100013680 Ga0070667_1000136805 189
47 3300005548 Ga0070665_100006730 Ga0070665_1000067309 189
48 3300005548 Ga0070665_100036505 Ga0070665_1000365054 189
49 3300005617 Ga0068859_100000747 Ga0068859_1000007475 189
50 3300005618 Ga0068864_100000283 Ga0068864_1000002837 189
51 3300005719 Ga0068861_100289491 Ga0068861_1002894912 189
52 3300005841 Ga0068863_100000091 Ga0068863_10000009197 189
53 3300005841 Ga0068863_100030798 Ga0068863_1000307984 189
54 3300005842 Ga0068858_100000059 Ga0068858_10000005926 189
55 3300005842 Ga0068858_100001493 Ga0068858_1000014935 189
56 3300005843 Ga0068860_100076674 Ga0068860_1000766741 189
57 3300005844 Ga0068862_100031625 Ga0068862_1000316253 189
58 3300005844 Ga0068862_100167192 Ga0068862_1001671922 189
59 3300006931 Ga0097620_100000747 Ga0097620_10000074736 189
60 3300009092 Ga0105250_10022075 Ga0105250_100220751 189
61 3300009177 Ga0105248_10046562 Ga0105248_100465624 189
62 3300009177 Ga0105248_10118046 Ga0105248_101180464 189
63 3300009177 Ga0105248_10914236 Ga0105248_109142362 189
64 3300009553 Ga0105249_10242551 Ga0105249_102425512 189
65 3300013306 Ga0163162_10059290 Ga0163162_100592903 189
66 3300014325 Ga0163163_10018815 Ga0163163_100188155 189
67 3300014325 Ga0163163_10921292 Ga0163163_109212922 189
68 3300014968 Ga0157379_10008799 Ga0157379_100087995 189
69 3300014968 Ga0157379_10091117 Ga0157379_100911174 189
70 3300025250 Ga0209026_1006600 Ga0209026_10066003 189
71 3300025923 Ga0207681_10008454 Ga0207681_100084542 189
72 3300025925 Ga0207650_10045361 Ga0207650_100453613 189
73 3300025931 Ga0207644_10004353 Ga0207644_100043537 189
74 3300025941 Ga0207711_10002787 Ga0207711_1000278716 189
75 3300025941 Ga0207711_10648232 Ga0207711_106482321 189
76 3300025961 Ga0207712_10194735 Ga0207712_101947351 189
77 3300025972 Ga0207668_10000001 Ga0207668_1000000180 189
78 3300025986 Ga0207658_10009050 Ga0207658_100090505 189
79 3300025986 Ga0207658_10274097 Ga0207658_102740972 189
80 3300026035 Ga0207703_10000049 Ga0207703_1000004933 189
81 3300026035 Ga0207703_10015974 Ga0207703_100159744 189
82 3300026088 Ga0207641_10000011 Ga0207641_10000011165 189
83 3300026088 Ga0207641_10002650 Ga0207641_100026505 189
84 3300026095 Ga0207676_10000503 Ga0207676_1000050329 189
85 3300026118 Ga0207675_100384273 Ga0207675_1003842732 189
86 3300028379 Ga0268266_10008732 Ga0268266_100087329 189
87 3300028380 Ga0268265_10009526 Ga0268265_100095263 189
88 3300028381 Ga0268264_10115179 Ga0268264_101151792 189
89 3300028786 Ga0307517_10027161 Ga0307517_100271614 189
90 3300037471 Ga0395905_0458312 Ga0395905_0458312_270_842 189
91 3300039437 Ga0436365_0055061 Ga0436365_0055061_371_940 189
92 3300049581 Ga0501047_0026168 Ga0501047_0026168_4190_4759 189
93 3300053096 Ga0500641_0005623 Ga0500641_0005623_3815_4384 189
94 3300021384 Ga0213876_10021862 Ga0213876_100218622 190
95 3300031730 Ga0307516_10000035 Ga0307516_10000035135 190
96 3300046499 Ga0495594_0298914 Ga0495594_0298914_145_759 190
97 3300046689 Ga0495613_0150643 Ga0495613_0150643_376_990 190
98 3300005336 Ga0070680_100295575 Ga0070680_1002955751 191
99 3300005339 Ga0070660_100187691 Ga0070660_1001876913 191
100 3300005339 Ga0070660_100383434 Ga0070660_1003834342 191
101 3300005366 Ga0070659_100017722 Ga0070659_1000177226 191
102 3300005457 Ga0070662_100293811 Ga0070662_1002938112 191
103 3300005578 Ga0068854_100159798 Ga0068854_1001597983 191
104 3300006028 Ga0070717_10020425 Ga0070717_100204251 191
105 3300006178 Ga0075367_10004389 Ga0075367_100043898 191
106 3300009093 Ga0105240_10024147 Ga0105240_100241478 191
107 3300009177 Ga0105248_10000661 Ga0105248_100006618 191
108 3300009177 Ga0105248_10035390 Ga0105248_100353904 191
109 3300010375 Ga0105239_10589941 Ga0105239_105899412 191
110 3300021384 Ga0213876_10296084 Ga0213876_102960842 191
111 3300025913 Ga0207695_10006835 Ga0207695_1000683510 191
112 3300025914 Ga0207671_10266650 Ga0207671_102666501 191
113 3300025932 Ga0207690_10000352 Ga0207690_1000035217 191
114 3300025933 Ga0207706_10687775 Ga0207706_106877752 191
115 3300025941 Ga0207711_10000316 Ga0207711_1000031624 191
116 3300025941 Ga0207711_10003586 Ga0207711_100035866 191
117 3300025981 Ga0207640_10572368 Ga0207640_105723682 191
118 3300026095 Ga0207676_10348152 Ga0207676_103481522 191
119 3300031616 Ga0307508_10129112 Ga0307508_101291123 191
120 3300035113 Ga0373936_0003766 Ga0373936_0003766_4889_5479 191
121 3300037312 Ga0395899_0000485 Ga0395899_0000485_7129_7719 191
122 3300037418 Ga0395900_0000072 Ga0395900_0000072_54149_54739 191
123 3300037418 Ga0395900_0221733 Ga0395900_0221733_668_1243 191
124 3300037466 Ga0395898_0023051 Ga0395898_0023051_1549_2139 191
125 3300037471 Ga0395905_0034368 Ga0395905_0034368_15_605 191
126 3300038443 Ga0395901_0000052 Ga0395901_0000052_72096_72686 191
127 3300045836 Ga0466958_0211148 Ga0466958_0211148_191_766 191
128 3300046459 Ga0495629_0036079 Ga0495629_0036079_2860_3447 191
129 3300046542 Ga0495597_0002075 Ga0495597_0002075_4452_5039 191
130 3300046557 Ga0495622_0009065 Ga0495622_0009065_3628_4215 191
131 3300047443 Ga0495687_009102 Ga0495687_009102_973_1560 191
132 3300047673 Ga0495593_0022213 Ga0495593_0022213_1994_2581 191
133 3300048088 Ga0495602_0103336 Ga0495602_0103336_444_1031 191
134 3300048905 Ga0496102_0186821 Ga0496102_0186821_945_1532 191
135 3300048906 Ga0496103_0335164 Ga0496103_0335164_297_884 191
136 3300048920 Ga0496117_0027796 Ga0496117_0027796_2766_3353 191
137 3300048921 Ga0496118_0013355 Ga0496118_0013355_878_1465 191
138 3300048924 Ga0496121_0000397 Ga0496121_0000397_40183_40770 191
139 3300049823 Ga0501044_0309738 Ga0501044_0309738_839_1414 191
140 3300050491 nmdc:mga00v17_4821_c1 nmdc:mga00v17_4821_c1_3667_4248 191
141 3300053080 Ga0500635_0000270 Ga0500635_0000270_4488_5075 191
142 3300053086 Ga0500578_0287883 Ga0500578_0287883_305_892 191
143 3300053093 Ga0500651_0009966 Ga0500651_0009966_2068_2655 191
144 3300053094 Ga0500566_0070511 Ga0500566_0070511_584_1171 191
145 3300053109 Ga0500569_001759 Ga0500569_001759_790_1377 191
146 3300053119 Ga0500595_012678 Ga0500595_012678_1104_1691 191
147 3300053119 Ga0500595_044780 Ga0500595_044780_241_834 191
148 3300053121 Ga0500607_056166 Ga0500607_056166_1393_1980 191
149 3300053122 Ga0500608_000296 Ga0500608_000296_14222_14809 191
150 3300053123 Ga0500614_002844 Ga0500614_002844_1809_2396 191
151 3300053136 Ga0500559_0185044 Ga0500559_0185044_209_796 191
152 3300053148 Ga0500590_050828 Ga0500590_050828_1051_1638 191
153 3300053162 Ga0500638_096706 Ga0500638_096706_54_641 191
154 3300053177 Ga0500636_0012919 Ga0500636_0012919_138_725 191
155 3300053178 Ga0500637_0001450 Ga0500637_0001450_5381_5968 191
156 3300053178 Ga0500637_0321466 Ga0500637_0321466_166_753 191
157 3300053730 Ga0500645_079408 Ga0500645_079408_297_884 191
158 3300053735 Ga0500596_002509 Ga0500596_002509_2047_2634 191
159 3300005336 Ga0070680_100063452 Ga0070680_1000634521 192
160 3300005339 Ga0070660_100719563 Ga0070660_1007195631 192
161 3300005366 Ga0070659_100317264 Ga0070659_1003172642 192
162 3300005458 Ga0070681_10017044 Ga0070681_100170445 192
163 3300005530 Ga0070679_100104317 Ga0070679_1001043173 192
164 3300005539 Ga0068853_100081389 Ga0068853_1000813894 192
165 3300005563 Ga0068855_100134933 Ga0068855_1001349332 192
166 3300005577 Ga0068857_100333719 Ga0068857_1003337192 192
167 3300009551 Ga0105238_10550831 Ga0105238_105508312 192
168 3300025909 Ga0207705_10027538 Ga0207705_100275384 192
169 3300025912 Ga0207707_10148231 Ga0207707_101482314 192
170 3300025917 Ga0207660_10082572 Ga0207660_100825724 192
171 3300025919 Ga0207657_10060441 Ga0207657_100604411 192
172 3300025921 Ga0207652_10042796 Ga0207652_100427964 192
173 3300025924 Ga0207694_10838866 Ga0207694_108388661 192
174 3300025949 Ga0207667_10066282 Ga0207667_100662824 192
175 3300026041 Ga0207639_10050953 Ga0207639_100509533 192
176 3300053087 Ga0500643_001004 Ga0500643_001004_4959_5549 192
177 3300053096 Ga0500641_0001164 Ga0500641_0001164_3822_4412 192
178 3300053103 Ga0500555_027282 Ga0500555_027282_11_595 192
179 3300053104 Ga0500556_0003423 Ga0500556_0003423_2777_3367 192
180 3300053108 Ga0500562_012675 Ga0500562_012675_1364_1954 192
181 3300053108 Ga0500562_014974 Ga0500562_014974_146_736 192
182 3300053117 Ga0500593_053008 Ga0500593_053008_750_1340 192
183 3300053156 Ga0500622_0006679 Ga0500622_0006679_5422_6012 192
184 3300053156 Ga0500622_0038700 Ga0500622_0038700_1823_2413 192
185 3300053730 Ga0500645_001214 Ga0500645_001214_7447_8037 192
186 3300053730 Ga0500645_002602 Ga0500645_002602_7109_7699 192
187 3300005339 Ga0070660_100787207 Ga0070660_1007872071 193
188 3300005548 Ga0070665_100001028 Ga0070665_1000010287 193
189 3300010375 Ga0105239_10337816 Ga0105239_103378161 193
190 3300026041 Ga0207639_10298151 Ga0207639_102981512 193
191 3300027462 Ga0210000_1004560 Ga0210000_10045602 193
192 3300037068 Ga0373925_0155754 Ga0373925_0155754_665_1252 193
193 iso_pu_bacteria 2643221545 2643749317 195
194 iso_pu_bacteria 2643221583 2643923129 195
195 iso_pu_bacteria 2643221691 2644508909 195
196 3300049671 Ga0501238_018182 Ga0501238_018182_22_618 198
197 3300042156 Ga0439446_0001961 Ga0439446_0001961_3550_4149 199
198 3300046453 Ga0495627_005298 Ga0495627_005298_1437_2036 199
199 3300046507 Ga0495606_0002470 Ga0495606_0002470_2598_3197 199
200 3300047469 Ga0495673_0000025 Ga0495673_0000025_450302_450901 199
201 3300049671 Ga0501238_009887 Ga0501238_009887_531_1130 199
202 3300003215 JGI25153J46596_10045519 JGI25153J46596_100455192 204
203 3300047470 Ga0495681_0102885 Ga0495681_0102885_101_715 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01812

5-FTHF_cyc-lig

5-formyltetrahydrofolate cyclo-ligase family

26

201

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sou-assembly1.cif.gz_A nmr structure of aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: northeast structural genomics consortium target qr46 0.8163 10 204
1u3g-assembly1.cif.gz_A structural and functional characterization of a 5,10-methenyltetrahydrofolate synthetase from mycoplasma pneumoniae (gi: 13508087) 0.8103 10 196
1u3g-assembly1.cif.gz_A structural and functional characterization of a 5,10-methenyltetrahydrofolate synthetase from mycoplasma pneumoniae (gi: 13508087) 0.7971 10 196
1wkc-assembly1.cif.gz_A crystal structure of a 5-formyltetrahydrofolate cycloligase-related protein from thermus thermophilus hb8 0.7897 10 204
1wkc-assembly1.cif.gz_A crystal structure of a 5-formyltetrahydrofolate cycloligase-related protein from thermus thermophilus hb8 0.777 10 204
ID Description Score Start End Superfamily
af_P0AC28_1_181_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8227 17 199 3.40.50.10420
af_Q9XWE6_1_200_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8194 7 197 3.40.50.10420
1souA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8163 10 204 3.40.50.10420
af_O05575_1_191_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8153 1 199 3.40.50.10420
af_O05575_1_191_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8114 1 199 3.40.50.10420
ID Description Score Start End GO Terms
AF-A0A2R7LKH7-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9564 1 203 GO:0005524
GO:0009396
GO:0030272
GO:0035999
GO:0046872
AF-D5VEP1-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9554 1 203 GO:0005524
GO:0009396
GO:0030272
GO:0035999
GO:0046872
AF-A0A3C1B6M5-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase 0.9513 126 201 GO:0005524
GO:0009396
GO:0030272
GO:0035999
AF-D5VEP1-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9507 1 203 GO:0005524
GO:0009396
GO:0030272
GO:0035999
GO:0046872
AF-A0A371BAX2-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9463 49 200 GO:0005524
GO:0009396
GO:0030272
GO:0035999
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.32 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map