F311157

General Info

Members Datasets Scaffolds Average Seq Length
203 126 406 229

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10240198|Ga0111539_102401981
Length 239
Sequence MTPATILIIEDDPTILRVVKDNCVAKGHRVITARQGEEGLDAALNRRPDLVLLDIMLPKVNGYEICRAIRAEKLEMPILMLTAKGQEEDIVRGLELGADDYITKPFGVRELMARVQAFLRRHRAGATAVFEFGDCQLDTVSHRLLRRGREVPLASKEFRLLEFFLQRPGRALTRDSIMNAVWGNTVLVTARSVDRCVTTLRAKIEPDPHHPTFIHTIREIGYRFEMEDESKSGSARFAT

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
81 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
82 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
85 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
93 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
126 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.97
Nodule 0
Rhizoplane 0
Rhizosphere 98.03
Stem 0
Stem Tuber 0
Unclassified 9.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10240198 3300009094 Bacteria 2109
2 JGI24751J29686_10019225 3300002459 Bacteria 1413
3 Ga0055530_10012974 3300003791 Bacteria 2873
4 Ga0065712_10130324 3300005290 Unclassified 1557
5 Ga0070658_10059732 3300005327 Bacteria 3105
6 Ga0070690_100035721 3300005330 Bacteria 3120
7 Ga0070670_100015628 3300005331 Bacteria 6517
8 Ga0070670_100037002 3300005331 Bacteria 4199
9 Ga0070670_100049573 3300005331 Bacteria 3610
10 Ga0070666_10003348 3300005335 Bacteria 9721
11 Ga0070666_10052116 3300005335 Bacteria 2757
12 Ga0068868_100003064 3300005338 Bacteria 11636
13 Ga0068868_100204666 3300005338 Bacteria 1647
14 Ga0070687_100024892 3300005343 Bacteria 2865
15 Ga0070661_100011499 3300005344 Bacteria 6164
16 Ga0070668_100231517 3300005347 Bacteria 1528
17 Ga0070675_100014633 3300005354 Bacteria 6188
18 Ga0070675_100170249 3300005354 Bacteria 1878
19 Ga0070671_100078438 3300005355 Bacteria 2760
20 Ga0070688_100063867 3300005365 Unclassified 2335
21 Ga0070667_100001477 3300005367 Bacteria 21096
22 Ga0068867_100767386 3300005459 Bacteria 857
23 Ga0070685_10062243 3300005466 Bacteria 2188
24 Ga0070698_100647202 3300005471 Bacteria 998
25 Ga0068853_100706783 3300005539 Bacteria 962
26 Ga0070672_100005155 3300005543 Bacteria 8631
27 Ga0070686_100334528 3300005544 Unclassified 1133
28 Ga0070664_100000178 3300005564 Bacteria 44922
29 Ga0070664_100859040 3300005564 Bacteria 850
30 Ga0068857_100160461 3300005577 Bacteria 2040
31 Ga0068857_100173925 3300005577 Bacteria 1958
32 Ga0068852_100293080 3300005616 Bacteria 1573
33 Ga0068859_100151936 3300005617 Bacteria 2391
34 Ga0068859_100595325 3300005617 Bacteria 1199
35 Ga0068864_100025097 3300005618 Bacteria 5018
36 Ga0068861_100110531 3300005719 Bacteria 2201
37 Ga0068858_100031093 3300005842 Bacteria 4958
38 Ga0068858_100112826 3300005842 Bacteria 2539
39 Ga0068862_100442912 3300005844 Bacteria 1223
40 Ga0068862_101087634 3300005844 Bacteria 794
41 Ga0075366_10189998 3300006195 Bacteria 1248
42 Ga0097621_100154805 3300006237 Bacteria 1967
43 Ga0068871_100011423 3300006358 Bacteria 6514
44 Ga0068871_100089670 3300006358 Bacteria 2560
45 Ga0068871_100355164 3300006358 Bacteria 1297
46 Ga0075428_100015655 3300006844 Bacteria 8404
47 Ga0075428_100019476 3300006844 Bacteria 7510
48 Ga0075430_100028499 3300006846 Bacteria 4743
49 Ga0075431_100053757 3300006847 Bacteria 4152
50 Ga0075431_100299529 3300006847 Bacteria 1625
51 Ga0075433_10138646 3300006852 Bacteria 2162
52 Ga0075434_100835866 3300006871 Bacteria 936
53 Ga0075429_100102906 3300006880 Bacteria 2494
54 Ga0075429_100519680 3300006880 Bacteria 1043
55 Ga0068865_100853624 3300006881 Bacteria 789
56 Ga0097620_100151928 3300006931 Bacteria 2391
57 Ga0097620_100595353 3300006931 Bacteria 1199
58 Ga0105240_10000109 3300009093 Bacteria 171078
59 Ga0111539_10048823 3300009094 Bacteria 5051
60 Ga0111539_10099223 3300009094 Bacteria 3420
61 Ga0111539_10257659 3300009094 Bacteria 2031
62 Ga0111539_11209250 3300009094 Bacteria 878
63 Ga0105245_10448085 3300009098 Bacteria 1299
64 Ga0114129_10274998 3300009147 Bacteria 2252
65 Ga0105242_10013897 3300009176 Bacteria 6230
66 Ga0105248_10009535 3300009177 Bacteria 10686
67 Ga0105239_10022834 3300010375 Bacteria 6897
68 Ga0105246_10158779 3300011119 Unclassified 1720
69 Ga0163162_10004555 3300013306 Bacteria 13357
70 Ga0163162_10548846 3300013306 Unclassified 1284
71 Ga0163162_10590951 3300013306 Bacteria 1237
72 Ga0163162_10776633 3300013306 Bacteria 1076
73 Ga0163162_11081509 3300013306 Bacteria 908
74 Ga0157375_10004055 3300013308 Bacteria 12706
75 Ga0157375_10072957 3300013308 Bacteria 3450
76 Ga0157375_10105751 3300013308 Unclassified 2905
77 Ga0157375_10647275 3300013308 Bacteria 1213
78 Ga0163163_10000629 3300014325 Bacteria 30399
79 Ga0163163_10090190 3300014325 Bacteria 3078
80 Ga0163163_10483840 3300014325 Bacteria 1299
81 Ga0157380_10300483 3300014326 Bacteria 1478
82 Ga0157376_10096395 3300014969 Unclassified 2574
83 Ga0157376_10132699 3300014969 Bacteria 2225
84 Ga0163161_10025317 3300017792 Unclassified 4199
85 Ga0209050_1000979 3300025298 Bacteria 36465
86 Ga0207680_10002445 3300025903 Bacteria 8661
87 Ga0207695_10000195 3300025913 Bacteria 171154
88 Ga0207662_10286675 3300025918 Bacteria 1091
89 Ga0207649_10033896 3300025920 Bacteria 3054
90 Ga0207650_10002569 3300025925 Bacteria 12572
91 Ga0207650_10005254 3300025925 Bacteria 8830
92 Ga0207650_10020560 3300025925 Bacteria 4657
93 Ga0207659_10054002 3300025926 Bacteria 2868
94 Ga0207659_10156840 3300025926 Bacteria 1783
95 Ga0207687_10278615 3300025927 Bacteria 1339
96 Ga0207644_10162919 3300025931 Bacteria 1735
97 Ga0207644_10447561 3300025931 Unclassified 1061
98 Ga0207691_10012022 3300025940 Bacteria 8303
99 Ga0207691_10254488 3300025940 Bacteria 1515
100 Ga0207711_10137687 3300025941 Bacteria 2194
101 Ga0207711_10581727 3300025941 Bacteria 1045
102 Ga0207679_10023895 3300025945 Bacteria 4185
103 Ga0207667_10549030 3300025949 Bacteria 1169
104 Ga0207658_10035296 3300025986 Bacteria 3580
105 Ga0207677_10011002 3300026023 Bacteria 5140
106 Ga0207703_10017662 3300026035 Bacteria 5569
107 Ga0207703_10035506 3300026035 Bacteria 3962
108 Ga0207641_10016603 3300026088 Bacteria 6027
109 Ga0207641_10112715 3300026088 Unclassified 2414
110 Ga0207676_10003411 3300026095 Bacteria 11237
111 Ga0207676_10118068 3300026095 Bacteria 2232
112 Ga0207674_10209574 3300026116 Bacteria 1898
113 Ga0207683_10314260 3300026121 Bacteria 1434
114 Ga0209966_1014719 3300027695 Bacteria 1463
115 Ga0207428_10228826 3300027907 Bacteria 1392
116 Ga0207428_10289828 3300027907 Bacteria 1213
117 Ga0268265_10586710 3300028380 Bacteria 1063
118 Ga0265338_10006374 3300028800 Bacteria 15060
119 Ga0265338_10073114 3300028800 Bacteria 2924
120 Ga0265327_10008829 3300031251 Bacteria 7421
121 Ga0316579_10082358 3300031691 Bacteria 1533
122 Ga0316576_10068871 3300031727 Bacteria 2609
123 Ga0316577_10182428 3300031733 Bacteria 1186
124 Ga0307414_10519939 3300032004 Bacteria 1056
125 Ga0373934_0172153 3300035086 Bacteria 889
126 Ga0373923_0200603 3300035111 Unclassified 922
127 Ga0373939_0070869 3300035114 Bacteria 1134
128 Ga0373953_0093781 3300035117 Bacteria 1258
129 Ga0373953_0113350 3300035117 Bacteria 1148
130 Ga0373943_0033931 3300035170 Bacteria 2433
131 Ga0373955_0195066 3300035172 Bacteria 1205
132 Ga0373955_0240443 3300035172 Unclassified 1084
133 Ga0373933_0088059 3300035724 Bacteria 1913
134 Ga0373937_0018748 3300036401 Bacteria 6185
135 Ga0373937_0035585 3300036401 Bacteria 4534
136 Ga0316582_0019042 3300036647 Unclassified 4010
137 Ga0439435_0032776 3300042436 Bacteria 1419
138 Ga0451577_0009543 3300042876 Bacteria 9334
139 Ga0451577_0017642 3300042876 Bacteria 6591
140 Ga0451577_0064740 3300042876 Bacteria 3260
141 Ga0451577_0132311 3300042876 Bacteria 2238
142 Ga0451577_0155127 3300042876 Bacteria 2060
143 Ga0451577_0189837 3300042876 Bacteria 1853
144 Ga0451577_0290471 3300042876 Bacteria 1481
145 Ga0451577_0322228 3300042876 Bacteria 1402
146 Ga0453683_0000056 3300044673 Bacteria 192299
147 Ga0453683_0000825 3300044673 Bacteria 30078
148 Ga0453683_0052264 3300044673 Bacteria 2558
149 Ga0453684_0002057 3300044712 Bacteria 51118
150 Ga0453684_0004999 3300044712 Bacteria 26948
151 Ga0453684_0008589 3300044712 Bacteria 18217
152 Ga0453684_0018930 3300044712 Bacteria 10529
153 Ga0453684_0028626 3300044712 Bacteria 7941
154 Ga0453684_0029142 3300044712 Bacteria 7851
155 Ga0453684_0077772 3300044712 Bacteria 4155
156 Ga0453684_0112504 3300044712 Bacteria 3304
157 Ga0453684_0239665 3300044712 Bacteria 2088
158 Ga0453684_0525266 3300044712 Bacteria 1307
159 Ga0453684_0821164 3300044712 Bacteria 1001
160 Ga0453684_0893985 3300044712 Bacteria 951
161 Ga0451576_0000207 3300045051 Bacteria 147627
162 Ga0451576_0093239 3300045051 Bacteria 3131
163 Ga0451576_0435792 3300045051 Bacteria 1375
164 Ga0451576_0709876 3300045051 Bacteria 1056
165 Ga0451576_0874356 3300045051 Bacteria 943
166 Ga0451576_0922031 3300045051 Bacteria 916
167 Ga0495592_0053105 3300046454 Bacteria 3006
168 Ga0495629_0115026 3300046459 Bacteria 1875
169 Ga0495629_0216745 3300046459 Unclassified 1321
170 Ga0495580_0135181 3300046472 Bacteria 1710
171 Ga0495580_0540096 3300046472 Bacteria 775
172 Ga0495639_0018944 3300046475 Bacteria 3001
173 Ga0495662_0112616 3300046476 Bacteria 1334
174 Ga0495662_0117811 3300046476 Bacteria 1303
175 Ga0495664_0153008 3300046477 Bacteria 1399
176 Ga0495608_0033902 3300046511 Unclassified 3448
177 Ga0495618_0230802 3300046514 Bacteria 1165
178 Ga0495643_0000242 3300046522 Bacteria 81759
179 Ga0495586_0032633 3300046535 Bacteria 2792
180 Ga0495586_0076176 3300046535 Unclassified 1838
181 Ga0495598_0171992 3300046537 Bacteria 768
182 Ga0495667_0002367 3300046559 Bacteria 12594
183 Ga0495657_0003301 3300046675 Bacteria 13235
184 Ga0495599_0048751 3300046678 Bacteria 2655
185 Ga0495613_0018455 3300046689 Bacteria 5201
186 Ga0495613_0315618 3300046689 Unclassified 1079
187 Ga0495600_0359735 3300046809 Unclassified 911
188 Ga0495581_0424530 3300047315 Bacteria 775
189 Ga0495604_0032224 3300047317 Bacteria 4156
190 Ga0495636_0003324 3300047318 Bacteria 6237
191 Ga0495674_0046987 3300047319 Unclassified 3830
192 Ga0495675_0140344 3300047444 Unclassified 1498
193 Ga0495684_0072136 3300047471 Bacteria 2624
194 Ga0495684_0254241 3300047471 Bacteria 1277
195 nmdc:mga05p37_302775_c1 3300050507 Bacteria 1899
196 nmdc:mga05p37_408164_c1 3300050507 Bacteria 1584
197 nmdc:mga05p37_695199_c1 3300050507 Bacteria 1131
198 nmdc:mga09592_264169_c1 3300050508 Bacteria 1493
199 nmdc:mga0qj67_24986_c1 3300050509 Bacteria 4610
200 nmdc:mga08y16_107214_c1 3300050511 Bacteria 2908
201 nmdc:mga0n895_542680_c1 3300050512 Bacteria 1169
202 Ga0495619_0049273 3300053085 Bacteria 2778
203 Ga0500616_0002972 3300053153 Bacteria 13434
204 Ga0111539_10240198
205 JGI24751J29686_10019225
206 Ga0055530_10012974
207 Ga0065712_10130324
208 Ga0070658_10059732
209 Ga0070690_100035721
210 Ga0070670_100015628
211 Ga0070670_100037002
212 Ga0070670_100049573
213 Ga0070666_10003348
214 Ga0070666_10052116
215 Ga0068868_100003064
216 Ga0068868_100204666
217 Ga0070687_100024892
218 Ga0070661_100011499
219 Ga0070668_100231517
220 Ga0070675_100014633
221 Ga0070675_100170249
222 Ga0070671_100078438
223 Ga0070688_100063867
224 Ga0070667_100001477
225 Ga0068867_100767386
226 Ga0070685_10062243
227 Ga0070698_100647202
228 Ga0068853_100706783
229 Ga0070672_100005155
230 Ga0070686_100334528
231 Ga0070664_100000178
232 Ga0070664_100859040
233 Ga0068857_100160461
234 Ga0068857_100173925
235 Ga0068852_100293080
236 Ga0068859_100151936
237 Ga0068859_100595325
238 Ga0068864_100025097
239 Ga0068861_100110531
240 Ga0068858_100031093
241 Ga0068858_100112826
242 Ga0068862_100442912
243 Ga0068862_101087634
244 Ga0075366_10189998
245 Ga0097621_100154805
246 Ga0068871_100011423
247 Ga0068871_100089670
248 Ga0068871_100355164
249 Ga0075428_100015655
250 Ga0075428_100019476
251 Ga0075430_100028499
252 Ga0075431_100053757
253 Ga0075431_100299529
254 Ga0075433_10138646
255 Ga0075434_100835866
256 Ga0075429_100102906
257 Ga0075429_100519680
258 Ga0068865_100853624
259 Ga0097620_100151928
260 Ga0097620_100595353
261 Ga0105240_10000109
262 Ga0111539_10048823
263 Ga0111539_10099223
264 Ga0111539_10257659
265 Ga0111539_11209250
266 Ga0105245_10448085
267 Ga0114129_10274998
268 Ga0105242_10013897
269 Ga0105248_10009535
270 Ga0105239_10022834
271 Ga0105246_10158779
272 Ga0163162_10004555
273 Ga0163162_10548846
274 Ga0163162_10590951
275 Ga0163162_10776633
276 Ga0163162_11081509
277 Ga0157375_10004055
278 Ga0157375_10072957
279 Ga0157375_10105751
280 Ga0157375_10647275
281 Ga0163163_10000629
282 Ga0163163_10090190
283 Ga0163163_10483840
284 Ga0157380_10300483
285 Ga0157376_10096395
286 Ga0157376_10132699
287 Ga0163161_10025317
288 Ga0209050_1000979
289 Ga0207680_10002445
290 Ga0207695_10000195
291 Ga0207662_10286675
292 Ga0207649_10033896
293 Ga0207650_10002569
294 Ga0207650_10005254
295 Ga0207650_10020560
296 Ga0207659_10054002
297 Ga0207659_10156840
298 Ga0207687_10278615
299 Ga0207644_10162919
300 Ga0207644_10447561
301 Ga0207691_10012022
302 Ga0207691_10254488
303 Ga0207711_10137687
304 Ga0207711_10581727
305 Ga0207679_10023895
306 Ga0207667_10549030
307 Ga0207658_10035296
308 Ga0207677_10011002
309 Ga0207703_10017662
310 Ga0207703_10035506
311 Ga0207641_10016603
312 Ga0207641_10112715
313 Ga0207676_10003411
314 Ga0207676_10118068
315 Ga0207674_10209574
316 Ga0207683_10314260
317 Ga0209966_1014719
318 Ga0207428_10228826
319 Ga0207428_10289828
320 Ga0268265_10586710
321 Ga0265338_10006374
322 Ga0265338_10073114
323 Ga0265327_10008829
324 Ga0316579_10082358
325 Ga0316576_10068871
326 Ga0316577_10182428
327 Ga0307414_10519939
328 Ga0373934_0172153
329 Ga0373923_0200603
330 Ga0373939_0070869
331 Ga0373953_0093781
332 Ga0373953_0113350
333 Ga0373943_0033931
334 Ga0373955_0195066
335 Ga0373955_0240443
336 Ga0373933_0088059
337 Ga0373937_0018748
338 Ga0373937_0035585
339 Ga0316582_0019042
340 Ga0439435_0032776
341 Ga0451577_0009543
342 Ga0451577_0017642
343 Ga0451577_0064740
344 Ga0451577_0132311
345 Ga0451577_0155127
346 Ga0451577_0189837
347 Ga0451577_0290471
348 Ga0451577_0322228
349 Ga0453683_0000056
350 Ga0453683_0000825
351 Ga0453683_0052264
352 Ga0453684_0002057
353 Ga0453684_0004999
354 Ga0453684_0008589
355 Ga0453684_0018930
356 Ga0453684_0028626
357 Ga0453684_0029142
358 Ga0453684_0077772
359 Ga0453684_0112504
360 Ga0453684_0239665
361 Ga0453684_0525266
362 Ga0453684_0821164
363 Ga0453684_0893985
364 Ga0451576_0000207
365 Ga0451576_0093239
366 Ga0451576_0435792
367 Ga0451576_0709876
368 Ga0451576_0874356
369 Ga0451576_0922031
370 Ga0495592_0053105
371 Ga0495629_0115026
372 Ga0495629_0216745
373 Ga0495580_0135181
374 Ga0495580_0540096
375 Ga0495639_0018944
376 Ga0495662_0112616
377 Ga0495662_0117811
378 Ga0495664_0153008
379 Ga0495608_0033902
380 Ga0495618_0230802
381 Ga0495643_0000242
382 Ga0495586_0032633
383 Ga0495586_0076176
384 Ga0495598_0171992
385 Ga0495667_0002367
386 Ga0495657_0003301
387 Ga0495599_0048751
388 Ga0495613_0018455
389 Ga0495613_0315618
390 Ga0495600_0359735
391 Ga0495581_0424530
392 Ga0495604_0032224
393 Ga0495636_0003324
394 Ga0495674_0046987
395 Ga0495675_0140344
396 Ga0495684_0072136
397 Ga0495684_0254241
398 nmdc:mga05p37_302775_c1
399 nmdc:mga05p37_408164_c1
400 nmdc:mga05p37_695199_c1
401 nmdc:mga09592_264169_c1
402 nmdc:mga0qj67_24986_c1
403 nmdc:mga08y16_107214_c1
404 nmdc:mga0n895_542680_c1
405 Ga0495619_0049273
406 Ga0500616_0002972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

6

116

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

148

224

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9767 1 121
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9701 3 119
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9679 3 119
2pl1-assembly1.cif.gz_A berrylium fluoride activated receiver domain of e.coli phop 0.9677 3 121
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9669 3 119
ID Description Score Start End Superfamily
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.998 3 85 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9914 2 78 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9903 1 78 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9843 1 78 3.40.50.2300
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9834 3 85 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3E2BJ56-F1-model_v4 Phosphate regulon transcriptional regulatory protein PhoB (SphR) 0.9003 1 226 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3E2BJ56-F1-model_v4 Phosphate regulon transcriptional regulatory protein PhoB (SphR) 0.8966 1 226 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A836NSS7-F1-model_v4 deleted 0.8668 1 151
AF-A0A836NSS7-F1-model_v4 deleted 0.8615 1 151
AF-A0A6B1I0J4-F1-model_v4 Response regulator transcription factor 0.8244 1 146 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map