F311113

General Info

Members Datasets Scaffolds Average Seq Length
203 174 406 146

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10043661|Ga0075433_100436615
Length 154
Sequence MTNQRFRINTPTVTHETIDGEAVIINLDSGNYYSLVEVGSFIWGLFEKGASASEVQNVVLQAYEGNATDVARGVQELLAQLQQENLIVPVDGIEAFDPDQVLPSNNGHEKPSFNPPVLHKYSDMQELLLLDPIHDVDDAGWPKPNPEPNADPPN

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
75 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
76 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
77 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
86 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
97 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
129 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
130 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
131 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
132 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
133 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
141 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
142 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
143 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
144 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
145 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
146 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
147 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
148 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
149 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
150 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
151 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
152 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
153 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
154 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
155 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
156 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
157 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
158 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
159 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
160 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
161 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
162 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
163 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
164 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.96
Nodule 0
Rhizoplane 2.46
Rhizosphere 92.12
Stem 0
Stem Tuber 0
Unclassified 41.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10043661 3300006852 Bacteria 3892
2 rootL2_10365878 3300003322 Bacteria 1785
3 Ga0065704_10152938 3300005289 Bacteria 1414
4 Ga0065704_10192894 3300005289 Unclassified 1181
5 Ga0065712_10009486 3300005290 Unclassified 2248
6 Ga0065715_10018182 3300005293 Bacteria 1918
7 Ga0065715_10030502 3300005293 Unclassified 1644
8 Ga0065707_10369559 3300005295 Unclassified 892
9 Ga0070670_100240421 3300005331 Bacteria 1576
10 Ga0070670_101226824 3300005331 Unclassified 686
11 Ga0070677_10075180 3300005333 Bacteria 1431
12 Ga0070689_100322240 3300005340 Unclassified 1291
13 Ga0070687_100362017 3300005343 Bacteria 939
14 Ga0070675_101092932 3300005354 Unclassified 733
15 Ga0070673_100109479 3300005364 Unclassified 2289
16 Ga0070667_100819783 3300005367 Bacteria 864
17 Ga0070701_10929943 3300005438 Unclassified 602
18 Ga0070694_100240699 3300005444 Unclassified 1365
19 Ga0068867_100851254 3300005459 Bacteria 817
20 Ga0070706_100000050 3300005467 Bacteria 140240
21 Ga0070698_100212646 3300005471 Unclassified 1868
22 Ga0070699_100368730 3300005518 Bacteria 1295
23 Ga0070699_100868988 3300005518 Bacteria 826
24 Ga0070697_100362078 3300005536 Bacteria 1254
25 Ga0070695_101144984 3300005545 Unclassified 638
26 Ga0070696_100224082 3300005546 Bacteria 1412
27 Ga0068857_101240041 3300005577 Unclassified 723
28 Ga0068854_100585089 3300005578 Bacteria 951
29 Ga0068859_100155266 3300005617 Bacteria 2366
30 Ga0068859_100540660 3300005617 Unclassified 1260
31 Ga0068859_100636708 3300005617 Unclassified 1159
32 Ga0068864_100153567 3300005618 Unclassified 2088
33 Ga0068870_10388942 3300005840 Bacteria 905
34 Ga0068870_10632867 3300005840 Bacteria 731
35 Ga0068858_100298432 3300005842 Unclassified 1537
36 Ga0068860_100011205 3300005843 Bacteria 8836
37 Ga0068862_100619733 3300005844 Bacteria 1041
38 Ga0081455_10236161 3300005937 Bacteria 1346
39 Ga0075363_100539629 3300006048 Unclassified 695
40 Ga0075363_100745088 3300006048 Unclassified 593
41 Ga0075364_10036098 3300006051 Unclassified 3195
42 Ga0075433_10750648 3300006852 Unclassified 853
43 Ga0075434_100754215 3300006871 Viruses 990
44 Ga0075436_100796717 3300006914 Bacteria 703
45 Ga0097620_100155263 3300006931 Bacteria 2366
46 Ga0097620_100540741 3300006931 Unclassified 1260
47 Ga0097620_100636700 3300006931 Unclassified 1159
48 Ga0111539_10912853 3300009094 Bacteria 1021
49 Ga0105247_10058714 3300009101 Unclassified 2381
50 Ga0105247_10208312 3300009101 Bacteria 1317
51 Ga0114129_10035889 3300009147 Bacteria 7001
52 Ga0105243_10222654 3300009148 Unclassified 1669
53 Ga0105243_10648634 3300009148 Bacteria 1023
54 Ga0105241_10050626 3300009174 Bacteria 3166
55 Ga0105241_10592970 3300009174 Bacteria 1000
56 Ga0105241_10717209 3300009174 Unclassified 914
57 Ga0105248_10075318 3300009177 Unclassified 3793
58 Ga0105248_10214294 3300009177 Unclassified 2169
59 Ga0105248_11626180 3300009177 Unclassified 732
60 Ga0105238_10342550 3300009551 Unclassified 1483
61 Ga0105249_10401746 3300009553 Bacteria 1401
62 Ga0105239_12938499 3300010375 Unclassified 556
63 Ga0105246_10616679 3300011119 Unclassified 940
64 Ga0105246_11173030 3300011119 Unclassified 705
65 Ga0105246_11550730 3300011119 Unclassified 624
66 Ga0157374_10750982 3300013296 Unclassified 990
67 Ga0157375_10108775 3300013308 Bacteria 2868
68 Ga0163163_10137795 3300014325 Bacteria 2482
69 Ga0157376_10392183 3300014969 Unclassified 1340
70 Ga0213876_10003915 3300021384 Bacteria 8413
71 Ga0207643_10218349 3300025908 Unclassified 1166
72 Ga0207684_10000216 3300025910 Bacteria 89242
73 Ga0207654_10079070 3300025911 Bacteria 1974
74 Ga0207694_10709260 3300025924 Unclassified 848
75 Ga0207650_10444294 3300025925 Bacteria 1078
76 Ga0207650_11138247 3300025925 Unclassified 664
77 Ga0207690_11730791 3300025932 Unclassified 522
78 Ga0207709_10127694 3300025935 Bacteria 1727
79 Ga0207709_10136531 3300025935 Bacteria 1680
80 Ga0207670_10329577 3300025936 Unclassified 1203
81 Ga0207711_10864198 3300025941 Bacteria 841
82 Ga0207651_10109911 3300025960 Unclassified 2067
83 Ga0207712_10402070 3300025961 Bacteria 1151
84 Ga0207640_10407209 3300025981 Bacteria 1109
85 Ga0207703_10137650 3300026035 Unclassified 2116
86 Ga0207703_10593079 3300026035 Unclassified 1047
87 Ga0207708_11217726 3300026075 Unclassified 658
88 Ga0207648_10123573 3300026089 Unclassified 2276
89 Ga0207674_10523308 3300026116 Bacteria 1146
90 Ga0268265_10532574 3300028380 Unclassified 1112
91 Ga0268264_10026269 3300028381 Bacteria 4757
92 Ga0314311_1254122 3300030733 Bacteria 1142
93 Ga0265320_10020073 3300031240 Bacteria 3633
94 Ga0265340_10117898 3300031247 Unclassified 1223
95 Ga0265313_10115288 3300031595 Bacteria 1177
96 Ga0373940_0043711 3300035088 Unclassified 1239
97 Ga0373951_0008587 3300035091 Unclassified 2303
98 Ga0373939_0303922 3300035114 Unclassified 637
99 Ga0373945_0017991 3300035116 Unclassified 2400
100 Ga0373927_0098642 3300035695 Unclassified 1899
101 Ga0373947_0011412 3300035725 Bacteria 5099
102 Ga0395898_0273900 3300037466 Bacteria 1610
103 Ga0395901_0897144 3300038443 Unclassified 869
104 Ga0400489_50542 3300039093 Bacteria 1662
105 Ga0436365_0776617 3300039437 Bacteria 11262
106 Ga0436363_1121922 3300039450 Unclassified 1380
107 Ga0439439_0156400 3300041406 Unclassified 649
108 Ga0439462_0071127 3300042015 Unclassified 945
109 Ga0453684_0833811 3300044712 Bacteria 992
110 Ga0495592_0038315 3300046454 Bacteria 3607
111 Ga0495603_0066778 3300046455 Unclassified 2118
112 Ga0495629_0007175 3300046459 Bacteria 8210
113 Ga0495641_0079270 3300046461 Unclassified 1471
114 Ga0495651_0005057 3300046462 Bacteria 10067
115 Ga0495653_0025214 3300046463 Unclassified 4783
116 Ga0495580_0226922 3300046472 Unclassified 1282
117 Ga0495582_0002764 3300046473 Bacteria 9790
118 Ga0495639_0003122 3300046475 Bacteria 7196
119 Ga0495662_0007424 3300046476 Bacteria 5420
120 Ga0495664_0026210 3300046477 Unclassified 3396
121 Ga0495594_0004852 3300046499 Bacteria 6924
122 Ga0495608_0067842 3300046511 Unclassified 2333
123 Ga0495618_0004241 3300046514 Bacteria 8846
124 Ga0495628_0100588 3300046516 Unclassified 2232
125 Ga0495630_0600672 3300046517 Unclassified 843
126 Ga0495666_0187571 3300046526 Unclassified 953
127 Ga0495652_0088807 3300046529 Unclassified 2532
128 Ga0495665_0022124 3300046531 Unclassified 3418
129 Ga0495640_0205544 3300046533 Unclassified 1246
130 Ga0495586_0038353 3300046535 Unclassified 2573
131 Ga0495667_0004013 3300046559 Bacteria 9889
132 Ga0495634_0010270 3300046642 Bacteria 6860
133 Ga0495635_0001135 3300046663 Bacteria 17759
134 Ga0495588_0096607 3300046674 Unclassified 1550
135 Ga0495599_0059762 3300046678 Unclassified 2384
136 Ga0495647_0002598 3300046681 Bacteria 5732
137 Ga0495658_0005992 3300046683 Bacteria 5966
138 Ga0495624_0027563 3300046690 Unclassified 3719
139 Ga0495600_0018908 3300046809 Unclassified 4396
140 Ga0495604_0101293 3300047317 Unclassified 2116
141 Ga0495674_0005000 3300047319 Bacteria 12756
142 Ga0495680_0022301 3300047322 Bacteria 5280
143 Ga0495684_0004022 3300047471 Bacteria 11470
144 Ga0495593_0222477 3300047673 Unclassified 947
145 Ga0495614_0115018 3300048089 Unclassified 1183
146 Ga0496109_0932183 3300048912 Bacteria 806
147 Ga0496109_1159508 3300048912 Unclassified 710
148 Ga0496112_1124150 3300048915 Bacteria 703
149 Ga0496113_0662193 3300048916 Bacteria 834
150 Ga0496115_0131715 3300048918 Bacteria 2061
151 Ga0501294_006253 3300049517 Bacteria 1138
152 Ga0501296_000498 3300049519 Bacteria 3838
153 Ga0501297_001462 3300049520 Bacteria 2168
154 Ga0501298_000174 3300049521 Bacteria 7992
155 Ga0501299_000918 3300049522 Bacteria 3625
156 Ga0501300_022333 3300049523 Bacteria 924
157 Ga0501034_0416609 3300049571 Bacteria 1265
158 Ga0501038_0006033 3300049574 Bacteria 11217
159 Ga0501067_0302738 3300049583 Bacteria 890
160 Ga0501067_0364077 3300049583 Bacteria 806
161 Ga0501068_0077649 3300049584 Bacteria 2034
162 Ga0501070_0157104 3300049586 Bacteria 1875
163 Ga0501072_0001370 3300049588 Bacteria 18287
164 Ga0501072_0086494 3300049588 Bacteria 2487
165 Ga0501072_1226032 3300049588 Bacteria 582
166 Ga0501201_001958 3300049651 Bacteria 1902
167 Ga0501207_006854 3300049654 Bacteria 1611
168 Ga0501216_094685 3300049660 Bacteria 650
169 Ga0501217_006682 3300049661 Bacteria 2458
170 Ga0501224_008140 3300049664 Bacteria 1528
171 Ga0501227_151890 3300049665 Bacteria 640
172 Ga0501228_004260 3300049666 Bacteria 1218
173 Ga0501233_035046 3300049668 Bacteria 1154
174 Ga0501235_027873 3300049669 Bacteria 1268
175 Ga0501238_052240 3300049671 Bacteria 614
176 Ga0501249_016946 3300049679 Bacteria 1567
177 Ga0501253_006728 3300049683 Bacteria 1572
178 Ga0501256_018029 3300049685 Bacteria 723
179 Ga0501261_005594 3300049690 Bacteria 1584
180 Ga0501221_011106 3300049704 Bacteria 1615
181 Ga0501225_0005061 3300049705 Bacteria 3886
182 Ga0501234_002133 3300049707 Bacteria 3123
183 Ga0501266_011287 3300049763 Bacteria 1143
184 Ga0501268_052223 3300049765 Bacteria 793
185 Ga0501272_003762 3300049769 Bacteria 1557
186 Ga0501273_003172 3300049770 Bacteria 1726
187 Ga0501276_002247 3300049773 Bacteria 1354
188 Ga0501279_011876 3300049775 Bacteria 1182
189 Ga0501283_012434 3300049779 Bacteria 1279
190 Ga0501212_002136 3300049851 Bacteria 2352
191 nmdc:mga03n38_458717_c1 3300050490 Unclassified 710
192 nmdc:mga03n38_463571_c1 3300050490 Bacteria 706
193 nmdc:mga00v17_59256_c1 3300050491 Bacteria 2348
194 nmdc:mga05p37_11235_c1 3300050507 Bacteria 10648
195 nmdc:mga06r32_1500897_c1 3300050510 Unclassified 614
196 nmdc:mga0a205_172500_c1 3300050515 Bacteria 2059
197 nmdc:mga0a205_65163_c2 3300050515 Unclassified 2484
198 Ga0495601_0058286 3300053077 Unclassified 2446
199 Ga0495595_0006993 3300053084 Bacteria 4608
200 Ga0495619_0032519 3300053085 Unclassified 3385
201 Ga0501084_0199347 3300054114 Unclassified 1689
202 Ga0501082_0094036 3300060353 Unclassified 2590
203 Ga0501082_0651339 3300060353 Bacteria 922
204 Ga0075433_10043661
205 rootL2_10365878
206 Ga0065704_10152938
207 Ga0065704_10192894
208 Ga0065712_10009486
209 Ga0065715_10018182
210 Ga0065715_10030502
211 Ga0065707_10369559
212 Ga0070670_100240421
213 Ga0070670_101226824
214 Ga0070677_10075180
215 Ga0070689_100322240
216 Ga0070687_100362017
217 Ga0070675_101092932
218 Ga0070673_100109479
219 Ga0070667_100819783
220 Ga0070701_10929943
221 Ga0070694_100240699
222 Ga0068867_100851254
223 Ga0070706_100000050
224 Ga0070698_100212646
225 Ga0070699_100368730
226 Ga0070699_100868988
227 Ga0070697_100362078
228 Ga0070695_101144984
229 Ga0070696_100224082
230 Ga0068857_101240041
231 Ga0068854_100585089
232 Ga0068859_100155266
233 Ga0068859_100540660
234 Ga0068859_100636708
235 Ga0068864_100153567
236 Ga0068870_10388942
237 Ga0068870_10632867
238 Ga0068858_100298432
239 Ga0068860_100011205
240 Ga0068862_100619733
241 Ga0081455_10236161
242 Ga0075363_100539629
243 Ga0075363_100745088
244 Ga0075364_10036098
245 Ga0075433_10750648
246 Ga0075434_100754215
247 Ga0075436_100796717
248 Ga0097620_100155263
249 Ga0097620_100540741
250 Ga0097620_100636700
251 Ga0111539_10912853
252 Ga0105247_10058714
253 Ga0105247_10208312
254 Ga0114129_10035889
255 Ga0105243_10222654
256 Ga0105243_10648634
257 Ga0105241_10050626
258 Ga0105241_10592970
259 Ga0105241_10717209
260 Ga0105248_10075318
261 Ga0105248_10214294
262 Ga0105248_11626180
263 Ga0105238_10342550
264 Ga0105249_10401746
265 Ga0105239_12938499
266 Ga0105246_10616679
267 Ga0105246_11173030
268 Ga0105246_11550730
269 Ga0157374_10750982
270 Ga0157375_10108775
271 Ga0163163_10137795
272 Ga0157376_10392183
273 Ga0213876_10003915
274 Ga0207643_10218349
275 Ga0207684_10000216
276 Ga0207654_10079070
277 Ga0207694_10709260
278 Ga0207650_10444294
279 Ga0207650_11138247
280 Ga0207690_11730791
281 Ga0207709_10127694
282 Ga0207709_10136531
283 Ga0207670_10329577
284 Ga0207711_10864198
285 Ga0207651_10109911
286 Ga0207712_10402070
287 Ga0207640_10407209
288 Ga0207703_10137650
289 Ga0207703_10593079
290 Ga0207708_11217726
291 Ga0207648_10123573
292 Ga0207674_10523308
293 Ga0268265_10532574
294 Ga0268264_10026269
295 Ga0314311_1254122
296 Ga0265320_10020073
297 Ga0265340_10117898
298 Ga0265313_10115288
299 Ga0373940_0043711
300 Ga0373951_0008587
301 Ga0373939_0303922
302 Ga0373945_0017991
303 Ga0373927_0098642
304 Ga0373947_0011412
305 Ga0395898_0273900
306 Ga0395901_0897144
307 Ga0400489_50542
308 Ga0436365_0776617
309 Ga0436363_1121922
310 Ga0439439_0156400
311 Ga0439462_0071127
312 Ga0453684_0833811
313 Ga0495592_0038315
314 Ga0495603_0066778
315 Ga0495629_0007175
316 Ga0495641_0079270
317 Ga0495651_0005057
318 Ga0495653_0025214
319 Ga0495580_0226922
320 Ga0495582_0002764
321 Ga0495639_0003122
322 Ga0495662_0007424
323 Ga0495664_0026210
324 Ga0495594_0004852
325 Ga0495608_0067842
326 Ga0495618_0004241
327 Ga0495628_0100588
328 Ga0495630_0600672
329 Ga0495666_0187571
330 Ga0495652_0088807
331 Ga0495665_0022124
332 Ga0495640_0205544
333 Ga0495586_0038353
334 Ga0495667_0004013
335 Ga0495634_0010270
336 Ga0495635_0001135
337 Ga0495588_0096607
338 Ga0495599_0059762
339 Ga0495647_0002598
340 Ga0495658_0005992
341 Ga0495624_0027563
342 Ga0495600_0018908
343 Ga0495604_0101293
344 Ga0495674_0005000
345 Ga0495680_0022301
346 Ga0495684_0004022
347 Ga0495593_0222477
348 Ga0495614_0115018
349 Ga0496109_0932183
350 Ga0496109_1159508
351 Ga0496112_1124150
352 Ga0496113_0662193
353 Ga0496115_0131715
354 Ga0501294_006253
355 Ga0501296_000498
356 Ga0501297_001462
357 Ga0501298_000174
358 Ga0501299_000918
359 Ga0501300_022333
360 Ga0501034_0416609
361 Ga0501038_0006033
362 Ga0501067_0302738
363 Ga0501067_0364077
364 Ga0501068_0077649
365 Ga0501070_0157104
366 Ga0501072_0001370
367 Ga0501072_0086494
368 Ga0501072_1226032
369 Ga0501201_001958
370 Ga0501207_006854
371 Ga0501216_094685
372 Ga0501217_006682
373 Ga0501224_008140
374 Ga0501227_151890
375 Ga0501228_004260
376 Ga0501233_035046
377 Ga0501235_027873
378 Ga0501238_052240
379 Ga0501249_016946
380 Ga0501253_006728
381 Ga0501256_018029
382 Ga0501261_005594
383 Ga0501221_011106
384 Ga0501225_0005061
385 Ga0501234_002133
386 Ga0501266_011287
387 Ga0501268_052223
388 Ga0501272_003762
389 Ga0501273_003172
390 Ga0501276_002247
391 Ga0501279_011876
392 Ga0501283_012434
393 Ga0501212_002136
394 nmdc:mga03n38_458717_c1
395 nmdc:mga03n38_463571_c1
396 nmdc:mga00v17_59256_c1
397 nmdc:mga05p37_11235_c1
398 nmdc:mga06r32_1500897_c1
399 nmdc:mga0a205_172500_c1
400 nmdc:mga0a205_65163_c2
401 Ga0495601_0058286
402 Ga0495595_0006993
403 Ga0495619_0032519
404 Ga0501084_0199347
405 Ga0501082_0094036
406 Ga0501082_0651339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05402

PqqD

Coenzyme PQQ synthesis protein D (PqqD)

21

87

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v1u-assembly2.cif.gz_B tbib1 in complex with the tbia(beta) leader peptide 0.9211 3 85
5v1u-assembly2.cif.gz_B tbib1 in complex with the tbia(beta) leader peptide 0.8807 3 85
6jx3-assembly1.cif.gz_B lasso peptide synthetase b1 complexed with the leader peptide 0.8759 4 82
7cun-assembly1.cif.gz_I the structure of human integrator-pp2a complex 0.8697 6 30
7ycx-assembly1.cif.gz_I the structure of intac-pec complex 0.8591 6 30
ID Description Score Start End Superfamily
af_Q21899_1_146_2.60.210.10 Mainly Beta;Sandwich;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A;Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2; Chain A 0.8716 2 27 2.60.210.10
af_K7VAH5_1_253_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8686 6 29 2.130.10.10
af_I1KSH0_109_470_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8397 6 29 2.130.10.10
af_I1MB48_1_267_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8338 6 29 2.130.10.10
af_A4ID27_51_409_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8241 7 29 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A090I1D8-F1-model_v4 PqqD family protein 0.9692 3 81
AF-A0A1C4X7N0-F1-model_v4 Coenzyme PQQ synthesis protein D (PqqD) 0.9624 1 81
AF-A0A2V6ZFU9-F1-model_v4 PqqD family protein 0.9616 3 79
AF-A0A6I7Q685-F1-model_v4 PqqD family protein 0.9615 4 81
AF-A0A5P9GRV3-F1-model_v4 Coenzyme PQQ synthesis protein D (PqqD) 0.961 3 81

Map