F311038

General Info

Members Datasets Scaffolds Average Seq Length
203 160 406 450

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10001475|Ga0081538_100014758
Length 490
Sequence MLGGAEPSAPGDVLSPSDNALRAVAESRSEVVRLATGPRFDSRTRLLLEGPIVGTLLRLATPNVLVMVVQASVGLIETYFIAKLGTDALAGVALVFPVLMLMQMMSAGAMGGGISSAIARALGAGRRADADALVLHALAIAVIFGVVFMLAVLGGGRWLYGALGGRGASLAAALTYSNVVFSGAVLIWIFNSLANVIRGTGNMALPAAVTSAGAAALIPLSPGLIFGWGPLPRLGVAGGAVAVIAYYRSVVRLSCAGARFRWPLFRDILRVGAVAALITFQTNLTIAIATGFVGRFGPAAIAGYGTGSRLEYLLVPLVFGLGGPLVAMVGTNIGAGQRDRALRVAWIGAAIAAGLTEMIGLCAAAVPHAWLSLFDTDPAMLDAGSRYLRVVGPCYGLYGLGMALYFASQGAGRLRWPLLANLTRLALAASGGGLALRWSGDLSHVFLALSVAMAAFGLINAGAVARGAWFGRVGWPRMRMARLQGHRLTS

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
45 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
66 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
67 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
68 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
69 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
71 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
74 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
75 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
76 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
93 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
94 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
95 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
96 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
99 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
100 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
101 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
114 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
146 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
147 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
148 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
149 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
150 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
152 2643221569 Achromobacter sp. Root565 Isolate Unclassified
153 2643221596 Acidovorax sp. Root70 Isolate Unclassified
154 2643221621 Achromobacter sp. Root83 Isolate Unclassified
155 2842733646 Variovorax sp. R-72446 Isolate Unclassified
156 2855730933 Achromobacter sp. HZ28 Isolate Nodule
157 2855767633 Achromobacter sp. HZ34 Isolate Nodule
158 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
159 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
160 2941479691

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 0
Isolates 4.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.66
Nodule 0.99
Rhizoplane 5.91
Rhizosphere 58.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10001475 3300005981 Bacteria 24170
2 JGI25150J39212_1010613 3300002774 Bacteria 1703
3 JGI25159J45721_1000359 3300002987 Bacteria 21140
4 JGI25151J46595_10000265 3300003187 Bacteria 59850
5 JGI25151J46595_10033597 3300003187 Bacteria 1973
6 JGI25160J50197_1000158 3300003354 Bacteria 58363
7 JGI25161J50226_1000040 3300003374 Bacteria 124804
8 Ga0055526_1005512 3300003771 Bacteria 7250
9 Ga0055537_1001275 3300003773 Bacteria 10463
10 Ga0055537_1004621 3300003773 Bacteria 3891
11 Ga0055524_1000216 3300003775 Bacteria 61153
12 Ga0055524_1003805 3300003775 Bacteria 7167
13 Ga0055534_1000193 3300003784 Bacteria 44748
14 Ga0055543_1000167 3300004625 Bacteria 54995
15 Ga0070658_10007847 3300005327 Bacteria 8598
16 Ga0070714_100035021 3300005435 Bacteria 4206
17 Ga0070694_100080886 3300005444 Bacteria 2259
18 Ga0070678_100104964 3300005456 Bacteria 2198
19 Ga0070681_10068377 3300005458 Bacteria 3519
20 Ga0070706_100037805 3300005467 Bacteria 4457
21 Ga0070706_100267754 3300005467 Bacteria 1595
22 Ga0070698_100030786 3300005471 Bacteria 5564
23 Ga0070699_100007458 3300005518 Bacteria 9517
24 Ga0070697_100030436 3300005536 Bacteria 4336
25 Ga0070696_100020348 3300005546 Bacteria 4498
26 Ga0068855_100125702 3300005563 Bacteria 2932
27 Ga0081538_10033365 3300005981 Bacteria 3429
28 Ga0081540_1001217 3300005983 Bacteria 22460
29 Ga0075363_100020908 3300006048 Bacteria 3288
30 Ga0075364_10010436 3300006051 Bacteria 5611
31 Ga0075362_10016834 3300006177 Bacteria 3001
32 Ga0075366_10022954 3300006195 Bacteria 3634
33 Ga0075370_10032715 3300006353 Bacteria 2908
34 Ga0075428_100001293 3300006844 Bacteria 26605
35 Ga0075428_100270043 3300006844 Bacteria 1830
36 Ga0075430_100049538 3300006846 Bacteria 3545
37 Ga0075430_100134720 3300006846 Bacteria 2058
38 Ga0075431_100013352 3300006847 Bacteria 8299
39 Ga0075433_10000489 3300006852 Bacteria 25808
40 Ga0075434_100014964 3300006871 Bacteria 7425
41 Ga0075434_100024462 3300006871 Bacteria 5903
42 Ga0075436_100015945 3300006914 Bacteria 5143
43 Ga0075435_100014645 3300007076 Bacteria 5873
44 Ga0075435_100117543 3300007076 Bacteria 2216
45 Ga0099794_10020432 3300007265 Bacteria 2997
46 Ga0111539_10004453 3300009094 Bacteria 18309
47 Ga0111539_10071168 3300009094 Bacteria 4104
48 Ga0111539_10261417 3300009094 Bacteria 2015
49 Ga0111539_10314604 3300009094 Bacteria 1822
50 Ga0114129_10130513 3300009147 Bacteria 3452
51 Ga0114129_10195188 3300009147 Bacteria 2746
52 Ga0163162_10012488 3300013306 Bacteria 8298
53 Ga0163162_10238921 3300013306 Bacteria 1947
54 Ga0182008_10000701 3300014497 Bacteria 24012
55 Ga0182008_10012281 3300014497 Bacteria 4522
56 Ga0182007_10000692 3300015262 Bacteria 19235
57 Ga0213875_10000236 3300021388 Bacteria 55426
58 Ga0209436_100621 3300025208 Bacteria 15167
59 Ga0207425_1004808 3300025245 Bacteria 3972
60 Ga0209565_1000072 3300025263 Bacteria 164988
61 Ga0209565_1000655 3300025263 Bacteria 22236
62 Ga0209565_1001373 3300025263 Bacteria 10948
63 Ga0209130_1000042 3300025284 Bacteria 257581
64 Ga0209675_1000049 3300025291 Bacteria 215042
65 Ga0209675_1000532 3300025291 Bacteria 27920
66 Ga0209025_1000026 3300025294 Bacteria 519850
67 Ga0209025_1001662 3300025294 Bacteria 27327
68 Ga0209025_1002304 3300025294 Bacteria 20701
69 Ga0209564_1000130 3300025295 Bacteria 194399
70 Ga0209256_1000126 3300025299 Bacteria 165242
71 Ga0209256_1000799 3300025299 Bacteria 40332
72 Ga0207426_1000097 3300025302 Bacteria 265930
73 Ga0207707_10088936 3300025912 Bacteria 2699
74 Ga0207663_10102027 3300025916 Bacteria 1929
75 Ga0207664_10079903 3300025929 Bacteria 2656
76 Ga0207667_10023994 3300025949 Bacteria 6708
77 Ga0207683_10064332 3300026121 Bacteria 3232
78 Ga0207698_10117957 3300026142 Bacteria 2240
79 Ga0207428_10004444 3300027907 Bacteria 13326
80 Ga0207428_10048347 3300027907 Bacteria 3413
81 Ga0265338_10055457 3300028800 Bacteria 3524
82 Ga0265338_10074385 3300028800 Bacteria 2890
83 Ga0265325_10000172 3300031241 Bacteria 45954
84 Ga0265325_10045541 3300031241 Bacteria 2279
85 Ga0265339_10026486 3300031249 Bacteria 3320
86 Ga0265316_10108218 3300031344 Bacteria 2107
87 Ga0307412_10000936 3300031911 Bacteria 16679
88 Ga0307412_10003418 3300031911 Bacteria 8821
89 Ga0307416_100014879 3300032002 Bacteria 5351
90 Ga0307416_100104148 3300032002 Bacteria 2480
91 Ga0307507_10096417 3300033179 Bacteria 2502
92 Ga0373926_0000186 3300035083 Bacteria 14059
93 Ga0373928_0004840 3300035084 Bacteria 2568
94 Ga0373951_0010082 3300035091 Bacteria 2121
95 Ga0373936_0003316 3300035113 Bacteria 6038
96 Ga0373945_0014630 3300035116 Bacteria 2632
97 Ga0373957_0019479 3300035120 Bacteria 2388
98 Ga0373943_0001101 3300035170 Bacteria 12059
99 Ga0373946_0016807 3300035171 Bacteria 2792
100 Ga0373955_0009010 3300035172 Bacteria 4658
101 Ga0373942_0035896 3300035207 Bacteria 1332
102 Ga0373931_0062508 3300035691 Bacteria 2010
103 Ga0373935_0001231 3300035692 Bacteria 14141
104 Ga0373927_0003191 3300035695 Bacteria 11817
105 Ga0373933_0035735 3300035724 Bacteria 2904
106 Ga0373947_0000357 3300035725 Bacteria 25961
107 Ga0373937_0116920 3300036401 Bacteria 2483
108 Ga0373925_0003594 3300037068 Bacteria 11950
109 Ga0395900_0006116 3300037418 Bacteria 12551
110 Ga0395898_0004956 3300037466 Bacteria 14452
111 Ga0436364_0978611 3300037853 Bacteria 44026
112 Ga0395901_0000893 3300038443 Bacteria 32764
113 Ga0451577_0145005 3300042876 Bacteria 2135
114 Ga0466963_0035901 3300044694 Bacteria 3230
115 Ga0466957_0100255 3300044842 Bacteria 1825
116 Ga0451576_0000490 3300045051 Bacteria 87626
117 Ga0451576_0000697 3300045051 Bacteria 68104
118 Ga0495580_0001379 3300046472 Bacteria 21303
119 Ga0495580_0002139 3300046472 Bacteria 17327
120 Ga0495666_0001032 3300046526 Bacteria 13216
121 Ga0495666_0055877 3300046526 Bacteria 1891
122 Ga0495665_0031807 3300046531 Bacteria 2823
123 Ga0495647_0006946 3300046681 Bacteria 3771
124 Ga0495624_0057603 3300046690 Bacteria 2443
125 Ga0495649_0061482 3300046694 Bacteria 2019
126 Ga0495604_0036164 3300047317 Bacteria 3894
127 Ga0495672_0057731 3300047320 Bacteria 2253
128 Ga0495676_0020112 3300047321 Bacteria 5867
129 Ga0495680_0087208 3300047322 Bacteria 2348
130 Ga0495686_0004782 3300047472 Bacteria 10943
131 Ga0496101_0001681 3300048904 Bacteria 13256
132 Ga0496102_0007822 3300048905 Bacteria 9137
133 Ga0496103_0149419 3300048906 Bacteria 1496
134 Ga0496104_0000665 3300048907 Bacteria 29449
135 Ga0496105_0006488 3300048908 Bacteria 8995
136 Ga0496106_0000007 3300048909 Bacteria 248548
137 Ga0496106_0028482 3300048909 Bacteria 4161
138 Ga0496108_0022269 3300048911 Bacteria 5211
139 Ga0496110_0247171 3300048913 Bacteria 1623
140 Ga0496111_0104901 3300048914 Bacteria 2079
141 Ga0496113_0161011 3300048916 Bacteria 1774
142 Ga0496114_0031982 3300048917 Bacteria 4329
143 Ga0496116_0002557 3300048919 Bacteria 18999
144 Ga0496117_0033305 3300048920 Bacteria 3899
145 Ga0496118_0013381 3300048921 Bacteria 7767
146 Ga0496119_0015672 3300048922 Bacteria 5813
147 Ga0496119_0023608 3300048922 Bacteria 4353
148 Ga0496121_0000803 3300048924 Bacteria 57237
149 Ga0496121_0031122 3300048924 Bacteria 4884
150 Ga0496122_0000047 3300048925 Bacteria 274226
151 Ga0496122_0064186 3300048925 Bacteria 2673
152 Ga0496123_0000077 3300048926 Bacteria 192607
153 Ga0496123_0008175 3300048926 Bacteria 9652
154 Ga0496124_0014310 3300048927 Bacteria 7677
155 Ga0496125_0000906 3300048928 Bacteria 46871
156 Ga0496125_0019238 3300048928 Bacteria 6450
157 Ga0496126_0011430 3300048929 Bacteria 9189
158 Ga0501033_0010791 3300049570 Bacteria 7005
159 Ga0501037_0204164 3300049573 Bacteria 1396
160 Ga0501041_0026677 3300049577 Bacteria 3476
161 Ga0501072_0029531 3300049588 Bacteria 4283
162 Ga0501079_0090171 3300049741 Bacteria 2375
163 Ga0501035_0045250 3300049822 Bacteria 3960
164 Ga0501044_0005390 3300049823 Bacteria 14205
165 nmdc:mga03683_17384_c1 3300050489 Bacteria 2722
166 nmdc:mga00v17_34981_c1 3300050491 Bacteria 2987
167 nmdc:mga0yw44_53858_c1 3300050492 Bacteria 2444
168 nmdc:mga0k408_47779_c1 3300050493 Bacteria 2474
169 nmdc:mga04h51_11110_c1 3300050495 Bacteria 2491
170 nmdc:mga07m45_67594_c1 3300050496 Bacteria 2031
171 nmdc:mga05p37_160608_c1 3300050507 Bacteria 2745
172 nmdc:mga09592_4987_c1 3300050508 Bacteria 10759
173 nmdc:mga0qj67_2151_c1 3300050509 Bacteria 14006
174 nmdc:mga08y16_52193_c1 3300050511 Bacteria 4278
175 nmdc:mga08y16_87139_c1 3300050511 Bacteria 3253
176 nmdc:mga08y16_8946_c1 3300050511 Bacteria 10516
177 nmdc:mga0n895_101877_c1 3300050512 Bacteria 2882
178 nmdc:mga0n895_249307_c1 3300050512 Bacteria 1802
179 nmdc:mga0n895_82210_c1 3300050512 Bacteria 3210
180 nmdc:mga0rr50_111192_c1 3300050513 Bacteria 2168
181 nmdc:mga0rr50_2265_c1 3300050513 Bacteria 10792
182 nmdc:mga08x19_49881_c1 3300050514 Bacteria 2685
183 nmdc:mga08x19_83653_c1 3300050514 Bacteria 2098
184 nmdc:mga0a205_218975_c1 3300050515 Bacteria 1790
185 nmdc:mga0a205_3173_c1 3300050515 Bacteria 14603
186 Ga0495619_0011413 3300053085 Bacteria 5594
187 Ga0500578_0028178 3300053086 Bacteria 3609
188 Ga0500644_0039052 3300053088 Bacteria 1562
189 Ga0500641_0036216 3300053096 Bacteria 1973
190 Ga0500593_000668 3300053117 Bacteria 13064
191 Ga0500586_000719 3300053145 Bacteria 6783
192 Ga0500645_001331 3300053730 Bacteria 12791
193 Ga0500645_021319 3300053730 Bacteria 2001
194 Ga0530510_0047277 3300061734 Bacteria 3109
195 2643858507 2643221569 Bacteria 6064337
196 2643993155 2643221596 Bacteria 5006805
197 2644121540 2643221621 Bacteria 6212786
198 2842734622 2842733646 Bacteria 5716726
199 2855732380 2855730933 Bacteria 7047938
200 2855769088 2855767633 Bacteria 7049357
201 2857547473 2857542790 Bacteria 5326616
202 2881415035 2881412998 Bacteria 6492157
203 2941480288
204 Ga0081538_10001475
205 JGI25150J39212_1010613
206 JGI25159J45721_1000359
207 JGI25151J46595_10000265
208 JGI25151J46595_10033597
209 JGI25160J50197_1000158
210 JGI25161J50226_1000040
211 Ga0055526_1005512
212 Ga0055537_1001275
213 Ga0055537_1004621
214 Ga0055524_1000216
215 Ga0055524_1003805
216 Ga0055534_1000193
217 Ga0055543_1000167
218 Ga0070658_10007847
219 Ga0070714_100035021
220 Ga0070694_100080886
221 Ga0070678_100104964
222 Ga0070681_10068377
223 Ga0070706_100037805
224 Ga0070706_100267754
225 Ga0070698_100030786
226 Ga0070699_100007458
227 Ga0070697_100030436
228 Ga0070696_100020348
229 Ga0068855_100125702
230 Ga0081538_10033365
231 Ga0081540_1001217
232 Ga0075363_100020908
233 Ga0075364_10010436
234 Ga0075362_10016834
235 Ga0075366_10022954
236 Ga0075370_10032715
237 Ga0075428_100001293
238 Ga0075428_100270043
239 Ga0075430_100049538
240 Ga0075430_100134720
241 Ga0075431_100013352
242 Ga0075433_10000489
243 Ga0075434_100014964
244 Ga0075434_100024462
245 Ga0075436_100015945
246 Ga0075435_100014645
247 Ga0075435_100117543
248 Ga0099794_10020432
249 Ga0111539_10004453
250 Ga0111539_10071168
251 Ga0111539_10261417
252 Ga0111539_10314604
253 Ga0114129_10130513
254 Ga0114129_10195188
255 Ga0163162_10012488
256 Ga0163162_10238921
257 Ga0182008_10000701
258 Ga0182008_10012281
259 Ga0182007_10000692
260 Ga0213875_10000236
261 Ga0209436_100621
262 Ga0207425_1004808
263 Ga0209565_1000072
264 Ga0209565_1000655
265 Ga0209565_1001373
266 Ga0209130_1000042
267 Ga0209675_1000049
268 Ga0209675_1000532
269 Ga0209025_1000026
270 Ga0209025_1001662
271 Ga0209025_1002304
272 Ga0209564_1000130
273 Ga0209256_1000126
274 Ga0209256_1000799
275 Ga0207426_1000097
276 Ga0207707_10088936
277 Ga0207663_10102027
278 Ga0207664_10079903
279 Ga0207667_10023994
280 Ga0207683_10064332
281 Ga0207698_10117957
282 Ga0207428_10004444
283 Ga0207428_10048347
284 Ga0265338_10055457
285 Ga0265338_10074385
286 Ga0265325_10000172
287 Ga0265325_10045541
288 Ga0265339_10026486
289 Ga0265316_10108218
290 Ga0307412_10000936
291 Ga0307412_10003418
292 Ga0307416_100014879
293 Ga0307416_100104148
294 Ga0307507_10096417
295 Ga0373926_0000186
296 Ga0373928_0004840
297 Ga0373951_0010082
298 Ga0373936_0003316
299 Ga0373945_0014630
300 Ga0373957_0019479
301 Ga0373943_0001101
302 Ga0373946_0016807
303 Ga0373955_0009010
304 Ga0373942_0035896
305 Ga0373931_0062508
306 Ga0373935_0001231
307 Ga0373927_0003191
308 Ga0373933_0035735
309 Ga0373947_0000357
310 Ga0373937_0116920
311 Ga0373925_0003594
312 Ga0395900_0006116
313 Ga0395898_0004956
314 Ga0436364_0978611
315 Ga0395901_0000893
316 Ga0451577_0145005
317 Ga0466963_0035901
318 Ga0466957_0100255
319 Ga0451576_0000490
320 Ga0451576_0000697
321 Ga0495580_0001379
322 Ga0495580_0002139
323 Ga0495666_0001032
324 Ga0495666_0055877
325 Ga0495665_0031807
326 Ga0495647_0006946
327 Ga0495624_0057603
328 Ga0495649_0061482
329 Ga0495604_0036164
330 Ga0495672_0057731
331 Ga0495676_0020112
332 Ga0495680_0087208
333 Ga0495686_0004782
334 Ga0496101_0001681
335 Ga0496102_0007822
336 Ga0496103_0149419
337 Ga0496104_0000665
338 Ga0496105_0006488
339 Ga0496106_0000007
340 Ga0496106_0028482
341 Ga0496108_0022269
342 Ga0496110_0247171
343 Ga0496111_0104901
344 Ga0496113_0161011
345 Ga0496114_0031982
346 Ga0496116_0002557
347 Ga0496117_0033305
348 Ga0496118_0013381
349 Ga0496119_0015672
350 Ga0496119_0023608
351 Ga0496121_0000803
352 Ga0496121_0031122
353 Ga0496122_0000047
354 Ga0496122_0064186
355 Ga0496123_0000077
356 Ga0496123_0008175
357 Ga0496124_0014310
358 Ga0496125_0000906
359 Ga0496125_0019238
360 Ga0496126_0011430
361 Ga0501033_0010791
362 Ga0501037_0204164
363 Ga0501041_0026677
364 Ga0501072_0029531
365 Ga0501079_0090171
366 Ga0501035_0045250
367 Ga0501044_0005390
368 nmdc:mga03683_17384_c1
369 nmdc:mga00v17_34981_c1
370 nmdc:mga0yw44_53858_c1
371 nmdc:mga0k408_47779_c1
372 nmdc:mga04h51_11110_c1
373 nmdc:mga07m45_67594_c1
374 nmdc:mga05p37_160608_c1
375 nmdc:mga09592_4987_c1
376 nmdc:mga0qj67_2151_c1
377 nmdc:mga08y16_52193_c1
378 nmdc:mga08y16_87139_c1
379 nmdc:mga08y16_8946_c1
380 nmdc:mga0n895_101877_c1
381 nmdc:mga0n895_249307_c1
382 nmdc:mga0n895_82210_c1
383 nmdc:mga0rr50_111192_c1
384 nmdc:mga0rr50_2265_c1
385 nmdc:mga08x19_49881_c1
386 nmdc:mga08x19_83653_c1
387 nmdc:mga0a205_218975_c1
388 nmdc:mga0a205_3173_c1
389 Ga0495619_0011413
390 Ga0500578_0028178
391 Ga0500644_0039052
392 Ga0500641_0036216
393 Ga0500593_000668
394 Ga0500586_000719
395 Ga0500645_001331
396 Ga0500645_021319
397 Ga0530510_0047277
398 2643858507
399 2643993155
400 2644121540
401 2842734622
402 2855732380
403 2855769088
404 2857547473
405 2881415035
406 2941480288

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01554

MatE

MatE

275

431

0.95

PF01554

MatE

MatE

62

222

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gwh-assembly1.cif.gz_A outward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. 0.6062 10 395
6hfb-assembly4.cif.gz_D outward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. 0.6051 21 394
4mlb-assembly1.cif.gz_C reverse polarity of binding pocket suggests different function of a mop superfamily transporter from pyrococcus furiosus vc1 (dsm3638) 0.6046 10 395
3w4t-assembly1.cif.gz_A crystal structure of mate p26a mutant 0.6022 10 394
3vvr-assembly1.cif.gz_A crystal structure of mate in complex with mad5 0.601 22 394
ID Description Score Start End Superfamily
af_P37340_244_405_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9428 28 181 1.20.1250.20
af_Q05497_462_618_2.40.370.10 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.9306 30 180 2.40.370.10
af_P76352_100_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9276 29 186 1.20.1250.20
af_Q54DM2_248_409_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9276 29 183 1.20.1250.20
af_A0A1D8PCB5_370_524_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9262 30 180 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A845M1G5-F1-model_v4 Probable multidrug resistance protein NorM 0.9552 37 221 GO:0005886
GO:0015297
GO:0042910
AF-A0A7Y2FXT5-F1-model_v4 MATE family efflux transporter 0.9505 28 234 GO:0005886
GO:0015297
GO:0042910
AF-A0A1C6E7P9-F1-model_v4 Probable multidrug resistance protein NorM 0.9407 37 221 GO:0005886
GO:0015297
GO:0042910
AF-A0A845M1G5-F1-model_v4 Probable multidrug resistance protein NorM 0.9403 37 221 GO:0005886
GO:0015297
GO:0042910
AF-A0A497FTW4-F1-model_v4 MATE family efflux transporter 0.9378 21 197 GO:0005886
GO:0015297
GO:0042910

Map