F310792

General Info

Members Datasets Scaffolds Average Seq Length
203 140 406 142

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_101085981|Ga0070690_1010859811
Length 160
Sequence MAWCCRCSYRWAPMHDERATLDWRTLSVGAELPAMVVAVTPTRIVAGAIASRDFMPVHHDRDYANQQGAPDIFMNILSDTAYCSRFLTDWAGPDAMITRLAIRLGVPVFPGHTLTFTGSVTALRPDGDVGVVDVELCAVNDLGEHVSGTATLTLPLGAQP

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
82 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
98 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
99 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
100 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
136 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
137 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.79
Nodule 0
Rhizoplane 7.88
Rhizosphere 76.85
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_101085981 3300005330 Bacteria 634
2 Ga0070676_10305022 3300005328 Bacteria 1081
3 Ga0070683_100490970 3300005329 Bacteria 1173
4 Ga0070690_100269781 3300005330 Bacteria 1210
5 Ga0070682_100212471 3300005337 Bacteria 1372
6 Ga0068868_100298827 3300005338 Bacteria 1367
7 Ga0070689_101768741 3300005340 Bacteria 563
8 Ga0070687_101054617 3300005343 Bacteria 592
9 Ga0070710_10871860 3300005437 Bacteria 648
10 Ga0070663_100592076 3300005455 Bacteria 932
11 Ga0070678_100776481 3300005456 Bacteria 868
12 Ga0068867_100844311 3300005459 Bacteria 820
13 Ga0070686_100458875 3300005544 Bacteria 981
14 Ga0070665_102433955 3300005548 Bacteria 526
15 Ga0068857_102036648 3300005577 Bacteria 563
16 Ga0068859_101007421 3300005617 Bacteria 915
17 Ga0068861_100392115 3300005719 Bacteria 1230
18 Ga0068861_100611327 3300005719 Bacteria 1002
19 Ga0068851_10981432 3300005834 Bacteria 532
20 Ga0068858_102114823 3300005842 Bacteria 557
21 Ga0075365_10040827 3300006038 Bacteria 3027
22 Ga0075365_10191162 3300006038 Bacteria 1433
23 Ga0075365_10307095 3300006038 Bacteria 1117
24 Ga0075363_100029055 3300006048 Unclassified 2851
25 Ga0075363_100085179 3300006048 Bacteria 1734
26 Ga0075364_10014141 3300006051 Bacteria 4925
27 Ga0075364_10032611 3300006051 Bacteria 3349
28 Ga0075364_10159270 3300006051 Bacteria 1523
29 Ga0075362_10048295 3300006177 Bacteria 1899
30 Ga0075367_10417044 3300006178 Bacteria 850
31 Ga0075367_10687573 3300006178 Bacteria 651
32 Ga0097621_101741256 3300006237 Bacteria 594
33 Ga0075370_10050857 3300006353 Bacteria 2351
34 Ga0075428_101258175 3300006844 Bacteria 779
35 Ga0075429_100427464 3300006880 Bacteria 1160
36 Ga0075436_101012756 3300006914 Bacteria 624
37 Ga0097620_101007426 3300006931 Bacteria 915
38 Ga0111539_10198924 3300009094 Bacteria 2337
39 Ga0111539_10289643 3300009094 Bacteria 1906
40 Ga0111539_10301023 3300009094 Bacteria 1866
41 Ga0105245_10566608 3300009098 Bacteria 1159
42 Ga0105245_10739788 3300009098 Bacteria 1019
43 Ga0105243_10379074 3300009148 Bacteria 1308
44 Ga0105243_10520327 3300009148 Bacteria 1131
45 Ga0105243_10563199 3300009148 Bacteria 1091
46 Ga0105242_10022535 3300009176 Bacteria 4955
47 Ga0105237_10483677 3300009545 Bacteria 1244
48 Ga0105249_11713255 3300009553 Bacteria 701
49 Ga0105246_10395375 3300011119 Bacteria 1146
50 Ga0105246_10944768 3300011119 Bacteria 777
51 Ga0157369_12437669 3300013105 Bacteria 530
52 Ga0157374_10935205 3300013296 Bacteria 885
53 Ga0157378_11008447 3300013297 Bacteria 867
54 Ga0157378_11885424 3300013297 Bacteria 647
55 Ga0163162_10530463 3300013306 Bacteria 1306
56 Ga0157375_12184575 3300013308 Bacteria 659
57 Ga0157375_13688352 3300013308 Unclassified 509
58 Ga0157380_10395505 3300014326 Bacteria 1309
59 Ga0157380_10588180 3300014326 Bacteria 1099
60 Ga0157380_11397553 3300014326 Bacteria 750
61 Ga0157380_11753477 3300014326 Bacteria 679
62 Ga0157380_11803372 3300014326 Bacteria 671
63 Ga0157377_10802734 3300014745 Bacteria 694
64 Ga0157379_10337206 3300014968 Bacteria 1378
65 Ga0157379_12451702 3300014968 Bacteria 521
66 Ga0157376_10943291 3300014969 Bacteria 883
67 Ga0157376_11087622 3300014969 Bacteria 825
68 Ga0157376_12546883 3300014969 Bacteria 551
69 Ga0213876_10004919 3300021384 Bacteria 7403
70 Ga0207645_10186684 3300025907 Bacteria 1361
71 Ga0207643_10484754 3300025908 Bacteria 789
72 Ga0207707_10120326 3300025912 Bacteria 2295
73 Ga0207695_10963716 3300025913 Bacteria 733
74 Ga0207681_10878156 3300025923 Bacteria 751
75 Ga0207687_10131650 3300025927 Bacteria 1886
76 Ga0207687_10162770 3300025927 Bacteria 1714
77 Ga0207644_11666003 3300025931 Bacteria 535
78 Ga0207686_10012508 3300025934 Bacteria 4666
79 Ga0207686_10164071 3300025934 Bacteria 1560
80 Ga0207709_10247355 3300025935 Bacteria 1300
81 Ga0207709_10721364 3300025935 Bacteria 799
82 Ga0207709_10870461 3300025935 Bacteria 731
83 Ga0207670_11232510 3300025936 Bacteria 634
84 Ga0207704_10803772 3300025938 Bacteria 785
85 Ga0207679_10428081 3300025945 Bacteria 1169
86 Ga0207667_10511934 3300025949 Bacteria 1216
87 Ga0207712_11145176 3300025961 Bacteria 693
88 Ga0207658_11354542 3300025986 Bacteria 651
89 Ga0207677_11088176 3300026023 Bacteria 728
90 Ga0207703_11042900 3300026035 Bacteria 785
91 Ga0207678_10540207 3300026067 Bacteria 1019
92 Ga0207702_11812923 3300026078 Bacteria 602
93 Ga0207641_10251222 3300026088 Bacteria 1652
94 Ga0207648_10606401 3300026089 Bacteria 1009
95 Ga0207676_10787978 3300026095 Bacteria 927
96 Ga0207675_100378715 3300026118 Bacteria 1391
97 Ga0207675_100400583 3300026118 Bacteria 1352
98 Ga0207683_10382548 3300026121 Bacteria 1294
99 Ga0207683_10582179 3300026121 Bacteria 1035
100 Ga0207698_10827745 3300026142 Bacteria 929
101 Ga0209813_10357834 3300027866 Bacteria 579
102 Ga0268266_10900318 3300028379 Bacteria 856
103 Ga0268265_10179315 3300028380 Bacteria 1819
104 Ga0268265_11896650 3300028380 Bacteria 603
105 Ga0265338_10071063 3300028800 Bacteria 2981
106 Ga0265338_10260268 3300028800 Bacteria 1276
107 Ga0265327_10000171 3300031251 Bacteria 139992
108 Ga0316576_10430398 3300031727 Bacteria 976
109 Ga0307407_10394770 3300031903 Bacteria 991
110 Ga0307409_100027511 3300031995 Bacteria 4031
111 Ga0307409_100145201 3300031995 Bacteria 2051
112 Ga0307414_10506800 3300032004 Bacteria 1069
113 Ga0373929_0207658 3300035085 Bacteria 552
114 Ga0316574_0152438 3300035398 Bacteria 1489
115 Ga0373935_0167049 3300035692 Bacteria 1503
116 Ga0373933_0113111 3300035724 Bacteria 1695
117 Ga0373947_0140433 3300035725 Bacteria 1549
118 Ga0373925_0182515 3300037068 Bacteria 1662
119 Ga0436365_0733232 3300039437 Bacteria 9147
120 Ga0451851_1304656 3300041507 Unclassified 621
121 Ga0466963_0664134 3300044694 Bacteria 736
122 Ga0466959_0294954 3300045049 Bacteria 1111
123 Ga0466967_0222040 3300045976 Bacteria 1796
124 Ga0466967_0452680 3300045976 Bacteria 1255
125 Ga0495629_0060895 3300046459 Bacteria 2638
126 Ga0495653_0245700 3300046463 Bacteria 1190
127 Ga0495582_0268068 3300046473 Bacteria 980
128 Ga0495628_0317949 3300046516 Bacteria 1149
129 Ga0495630_0008785 3300046517 Bacteria 7256
130 Ga0495640_0595812 3300046533 Bacteria 668
131 Ga0495624_0315657 3300046690 Bacteria 942
132 Ga0495672_0052991 3300047320 Bacteria 2379
133 Ga0495680_0499955 3300047322 Bacteria 825
134 Ga0496100_1409580 3300048903 Bacteria 550
135 Ga0496101_0543221 3300048904 Bacteria 919
136 Ga0496102_1468397 3300048905 Bacteria 601
137 Ga0496104_0468090 3300048907 Bacteria 1172
138 Ga0496105_0132407 3300048908 Bacteria 2055
139 Ga0496108_0020617 3300048911 Bacteria 5417
140 Ga0496108_0168218 3300048911 Bacteria 1896
141 Ga0496108_0329175 3300048911 Bacteria 1332
142 Ga0496109_0039492 3300048912 Bacteria 4272
143 Ga0496110_0180401 3300048913 Bacteria 1917
144 Ga0496110_0329835 3300048913 Bacteria 1390
145 Ga0496110_0421256 3300048913 Bacteria 1217
146 Ga0496110_0421646 3300048913 Bacteria 1217
147 Ga0496112_0204836 3300048915 Bacteria 1931
148 Ga0496115_0144961 3300048918 Bacteria 1960
149 Ga0496115_1141944 3300048918 Bacteria 588
150 Ga0501033_0000473 3300049570 Bacteria 38045
151 Ga0501034_0132338 3300049571 Bacteria 2477
152 Ga0501034_0322071 3300049571 Bacteria 1479
153 Ga0501034_1027636 3300049571 Bacteria 707
154 Ga0501036_0382769 3300049572 Bacteria 1174
155 Ga0501040_0094953 3300049576 Bacteria 2075
156 Ga0501047_0039432 3300049581 Bacteria 4568
157 Ga0501047_1043693 3300049581 Bacteria 631
158 Ga0501048_0450165 3300049582 Bacteria 922
159 Ga0501048_0848355 3300049582 Bacteria 657
160 Ga0501068_0035781 3300049584 Bacteria 2965
161 Ga0501069_0495652 3300049585 Bacteria 728
162 Ga0501070_0125776 3300049586 Bacteria 2119
163 Ga0501071_1279137 3300049587 Bacteria 567
164 Ga0501071_1314135 3300049587 Bacteria 559
165 Ga0501073_0213602 3300049589 Bacteria 1333
166 Ga0501073_0441277 3300049589 Bacteria 900
167 Ga0501079_0363476 3300049741 Bacteria 1134
168 Ga0501080_0029007 3300049742 Bacteria 5151
169 Ga0501080_0272519 3300049742 Bacteria 1540
170 Ga0501083_0383126 3300049744 Bacteria 915
171 Ga0501083_0533353 3300049744 Bacteria 764
172 Ga0501044_0003321 3300049823 Bacteria 18122
173 Ga0501044_0501303 3300049823 Bacteria 1115
174 nmdc:mga03n38_1038_c1 3300050490 Bacteria 7644
175 nmdc:mga03n38_86921_c1 3300050490 Bacteria 1481
176 nmdc:mga00v17_144475_c1 3300050491 Bacteria 1527
177 nmdc:mga00v17_7117_c1 3300050491 Bacteria 5960
178 nmdc:mga00v17_736170_c1 3300050491 Bacteria 631
179 nmdc:mga0yw44_28050_c1 3300050492 Bacteria 3235
180 nmdc:mga0yw44_42604_c1 3300050492 Bacteria 2707
181 nmdc:mga0yw44_489829_c1 3300050492 Bacteria 834
182 nmdc:mga0yw44_53994_c1 3300050492 Bacteria 2441
183 nmdc:mga0yw44_583094_c1 3300050492 Bacteria 759
184 nmdc:mga0yw44_91605_c1 3300050492 Bacteria 1922
185 nmdc:mga06z11_285295_c1 3300050494 Bacteria 979
186 nmdc:mga07m45_288223_c1 3300050496 Bacteria 955
187 nmdc:mga09592_950823_c1 3300050508 Bacteria 720
188 nmdc:mga08y16_179187_c1 3300050511 Bacteria 2200
189 nmdc:mga08y16_474021_c1 3300050511 Bacteria 1274
190 nmdc:mga08y16_877004_c1 3300050511 Bacteria 885
191 nmdc:mga0n895_745748_c1 3300050512 Bacteria 972
192 Ga0495601_0082362 3300053077 Bacteria 2066
193 Ga0495601_0815901 3300053077 Bacteria 592
194 Ga0495612_0147624 3300053078 Bacteria 1022
195 Ga0500566_0000298 3300053094 Bacteria 26612
196 Ga0500650_0447386 3300053098 Bacteria 554
197 Ga0501084_0000065 3300054114 Bacteria 81183
198 Ga0501084_0335558 3300054114 Bacteria 1277
199 Ga0501084_0432387 3300054114 Bacteria 1113
200 Ga0501084_1021116 3300054114 Bacteria 695
201 Ga0501082_0022883 3300060353 Bacteria 5384
202 Ga0530510_0426144 3300061734 Bacteria 1002
203 Ga0530510_0924831 3300061734 Bacteria 667
204 Ga0070690_101085981
205 Ga0070676_10305022
206 Ga0070683_100490970
207 Ga0070690_100269781
208 Ga0070682_100212471
209 Ga0068868_100298827
210 Ga0070689_101768741
211 Ga0070687_101054617
212 Ga0070710_10871860
213 Ga0070663_100592076
214 Ga0070678_100776481
215 Ga0068867_100844311
216 Ga0070686_100458875
217 Ga0070665_102433955
218 Ga0068857_102036648
219 Ga0068859_101007421
220 Ga0068861_100392115
221 Ga0068861_100611327
222 Ga0068851_10981432
223 Ga0068858_102114823
224 Ga0075365_10040827
225 Ga0075365_10191162
226 Ga0075365_10307095
227 Ga0075363_100029055
228 Ga0075363_100085179
229 Ga0075364_10014141
230 Ga0075364_10032611
231 Ga0075364_10159270
232 Ga0075362_10048295
233 Ga0075367_10417044
234 Ga0075367_10687573
235 Ga0097621_101741256
236 Ga0075370_10050857
237 Ga0075428_101258175
238 Ga0075429_100427464
239 Ga0075436_101012756
240 Ga0097620_101007426
241 Ga0111539_10198924
242 Ga0111539_10289643
243 Ga0111539_10301023
244 Ga0105245_10566608
245 Ga0105245_10739788
246 Ga0105243_10379074
247 Ga0105243_10520327
248 Ga0105243_10563199
249 Ga0105242_10022535
250 Ga0105237_10483677
251 Ga0105249_11713255
252 Ga0105246_10395375
253 Ga0105246_10944768
254 Ga0157369_12437669
255 Ga0157374_10935205
256 Ga0157378_11008447
257 Ga0157378_11885424
258 Ga0163162_10530463
259 Ga0157375_12184575
260 Ga0157375_13688352
261 Ga0157380_10395505
262 Ga0157380_10588180
263 Ga0157380_11397553
264 Ga0157380_11753477
265 Ga0157380_11803372
266 Ga0157377_10802734
267 Ga0157379_10337206
268 Ga0157379_12451702
269 Ga0157376_10943291
270 Ga0157376_11087622
271 Ga0157376_12546883
272 Ga0213876_10004919
273 Ga0207645_10186684
274 Ga0207643_10484754
275 Ga0207707_10120326
276 Ga0207695_10963716
277 Ga0207681_10878156
278 Ga0207687_10131650
279 Ga0207687_10162770
280 Ga0207644_11666003
281 Ga0207686_10012508
282 Ga0207686_10164071
283 Ga0207709_10247355
284 Ga0207709_10721364
285 Ga0207709_10870461
286 Ga0207670_11232510
287 Ga0207704_10803772
288 Ga0207679_10428081
289 Ga0207667_10511934
290 Ga0207712_11145176
291 Ga0207658_11354542
292 Ga0207677_11088176
293 Ga0207703_11042900
294 Ga0207678_10540207
295 Ga0207702_11812923
296 Ga0207641_10251222
297 Ga0207648_10606401
298 Ga0207676_10787978
299 Ga0207675_100378715
300 Ga0207675_100400583
301 Ga0207683_10382548
302 Ga0207683_10582179
303 Ga0207698_10827745
304 Ga0209813_10357834
305 Ga0268266_10900318
306 Ga0268265_10179315
307 Ga0268265_11896650
308 Ga0265338_10071063
309 Ga0265338_10260268
310 Ga0265327_10000171
311 Ga0316576_10430398
312 Ga0307407_10394770
313 Ga0307409_100027511
314 Ga0307409_100145201
315 Ga0307414_10506800
316 Ga0373929_0207658
317 Ga0316574_0152438
318 Ga0373935_0167049
319 Ga0373933_0113111
320 Ga0373947_0140433
321 Ga0373925_0182515
322 Ga0436365_0733232
323 Ga0451851_1304656
324 Ga0466963_0664134
325 Ga0466959_0294954
326 Ga0466967_0222040
327 Ga0466967_0452680
328 Ga0495629_0060895
329 Ga0495653_0245700
330 Ga0495582_0268068
331 Ga0495628_0317949
332 Ga0495630_0008785
333 Ga0495640_0595812
334 Ga0495624_0315657
335 Ga0495672_0052991
336 Ga0495680_0499955
337 Ga0496100_1409580
338 Ga0496101_0543221
339 Ga0496102_1468397
340 Ga0496104_0468090
341 Ga0496105_0132407
342 Ga0496108_0020617
343 Ga0496108_0168218
344 Ga0496108_0329175
345 Ga0496109_0039492
346 Ga0496110_0180401
347 Ga0496110_0329835
348 Ga0496110_0421256
349 Ga0496110_0421646
350 Ga0496112_0204836
351 Ga0496115_0144961
352 Ga0496115_1141944
353 Ga0501033_0000473
354 Ga0501034_0132338
355 Ga0501034_0322071
356 Ga0501034_1027636
357 Ga0501036_0382769
358 Ga0501040_0094953
359 Ga0501047_0039432
360 Ga0501047_1043693
361 Ga0501048_0450165
362 Ga0501048_0848355
363 Ga0501068_0035781
364 Ga0501069_0495652
365 Ga0501070_0125776
366 Ga0501071_1279137
367 Ga0501071_1314135
368 Ga0501073_0213602
369 Ga0501073_0441277
370 Ga0501079_0363476
371 Ga0501080_0029007
372 Ga0501080_0272519
373 Ga0501083_0383126
374 Ga0501083_0533353
375 Ga0501044_0003321
376 Ga0501044_0501303
377 nmdc:mga03n38_1038_c1
378 nmdc:mga03n38_86921_c1
379 nmdc:mga00v17_144475_c1
380 nmdc:mga00v17_7117_c1
381 nmdc:mga00v17_736170_c1
382 nmdc:mga0yw44_28050_c1
383 nmdc:mga0yw44_42604_c1
384 nmdc:mga0yw44_489829_c1
385 nmdc:mga0yw44_53994_c1
386 nmdc:mga0yw44_583094_c1
387 nmdc:mga0yw44_91605_c1
388 nmdc:mga06z11_285295_c1
389 nmdc:mga07m45_288223_c1
390 nmdc:mga09592_950823_c1
391 nmdc:mga08y16_179187_c1
392 nmdc:mga08y16_474021_c1
393 nmdc:mga08y16_877004_c1
394 nmdc:mga0n895_745748_c1
395 Ga0495601_0082362
396 Ga0495601_0815901
397 Ga0495612_0147624
398 Ga0500566_0000298
399 Ga0500650_0447386
400 Ga0501084_0000065
401 Ga0501084_0335558
402 Ga0501084_0432387
403 Ga0501084_1021116
404 Ga0501082_0022883
405 Ga0530510_0426144
406 Ga0530510_0924831

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

23

140

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4w78-assembly1.cif.gz_F crystal structure of the chsh1-chsh2 complex from mycobacterium tuberculosis 0.9075 2 129
4w78-assembly1.cif.gz_F crystal structure of the chsh1-chsh2 complex from mycobacterium tuberculosis 0.8808 2 129
8ayi-assembly1.cif.gz_A scalindua brodae amxfabz h48n mutant 0.855 46 129
2cy9-assembly1.cif.gz_A crystal structure of thioesterase superfamily member2 from mus musculus 0.8511 70 129
3k67-assembly1.cif.gz_A crystal structure of protein af1124 from archaeoglobus fulgidus 0.8474 1 129
ID Description Score Start End Superfamily
4w78F00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9075 2 129 3.10.129.10
4w78F00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8808 2 129 3.10.129.10
af_Q9FJI2_19_158_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8547 1 131 3.10.129.10
af_G5EC69_181_473_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8528 91 126 3.90.190.10
af_Q9FJI2_19_158_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8488 1 131 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A285C428-F1-model_v4 MaoC dehydratase-like protein 0.9333 1 131
AF-A0A6G4VL54-F1-model_v4 Acyl dehydratase 0.9329 1 130
AF-A0A3B7QR52-F1-model_v4 deleted 0.9328 1 131
AF-A0A4R3F9Q9-F1-model_v4 deleted 0.9327 1 131
AF-A0A6B2WGU8-F1-model_v4 deleted 0.9308 1 131

Map