F310241

General Info

Members Datasets Scaffolds Average Seq Length
202 152 404 135

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0081619|Ga0466957_0081619_1223_1672
Length 136
Sequence MQTDGREQRRSLMQITRNTLQTGRGPSDWFTGVVYLDPVAEQIGPSRFAANSVHFTPGARTAEGVGLCQRRGGPIEVIRPGDRVFFEPGEDHWHGAAPNRFMTHIAMQQADDAGNVVSWGRHVTDEEYGAAPPISS

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
69 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
70 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
77 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
78 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
79 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
80 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
81 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
89 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
90 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
96 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
97 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
150 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
151 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 6.93
Rhizosphere 82.18
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0081619 3300044842 Unclassified 2014
2 JGI25406J46586_10021078 3300003203 Bacteria 2622
3 Ga0070658_10336199 3300005327 Bacteria 1291
4 Ga0070658_10892327 3300005327 Bacteria 773
5 Ga0070683_100934161 3300005329 Unclassified 832
6 Ga0070666_10182585 3300005335 Bacteria 1472
7 Ga0070666_10199380 3300005335 Bacteria 1408
8 Ga0070666_11433726 3300005335 Bacteria 516
9 Ga0070668_100065466 3300005347 Bacteria 2819
10 Ga0070667_100095898 3300005367 Bacteria 2558
11 Ga0070667_101165784 3300005367 Bacteria 721
12 Ga0070714_100006223 3300005435 Bacteria 9187
13 Ga0070714_100150377 3300005435 Bacteria 2098
14 Ga0070711_100532831 3300005439 Bacteria 972
15 Ga0070711_100610785 3300005439 Bacteria 911
16 Ga0070706_100001613 3300005467 Bacteria 23512
17 Ga0070698_100008633 3300005471 Bacteria 10979
18 Ga0070684_100249999 3300005535 Bacteria 1620
19 Ga0068853_101630761 3300005539 Bacteria 625
20 Ga0070665_100025971 3300005548 Bacteria 5899
21 Ga0070665_100107107 3300005548 Bacteria 2797
22 Ga0070665_101602846 3300005548 Bacteria 659
23 Ga0068855_100993583 3300005563 Bacteria 882
24 Ga0068856_100147182 3300005614 Bacteria 2363
25 Ga0068856_100415875 3300005614 Bacteria 1365
26 Ga0068858_100375340 3300005842 Bacteria 1364
27 Ga0081538_10007000 3300005981 Bacteria 9809
28 Ga0081539_10001749 3300005985 Bacteria 34642
29 Ga0081539_10021282 3300005985 Bacteria 4339
30 Ga0070712_101538058 3300006175 Bacteria 582
31 Ga0075428_100150625 3300006844 Bacteria 2527
32 Ga0105240_10195285 3300009093 Bacteria 2377
33 Ga0111539_10098582 3300009094 Bacteria 3432
34 Ga0105245_10124232 3300009098 Bacteria 2414
35 Ga0105245_11186936 3300009098 Bacteria 811
36 Ga0114129_10688055 3300009147 Bacteria 1316
37 Ga0105243_11938447 3300009148 Bacteria 622
38 Ga0105241_11758939 3300009174 Bacteria 604
39 Ga0105242_10106583 3300009176 Bacteria 2382
40 Ga0105248_10024883 3300009177 Bacteria 6654
41 Ga0105248_10520751 3300009177 Bacteria 1341
42 Ga0105237_10327082 3300009545 Bacteria 1537
43 Ga0105238_10100864 3300009551 Bacteria 2869
44 Ga0105239_10043147 3300010375 Bacteria 4942
45 Ga0105239_12849336 3300010375 Bacteria 564
46 Ga0157372_11573146 3300013307 Bacteria 757
47 Ga0157372_12591679 3300013307 Bacteria 582
48 Ga0157375_11108398 3300013308 Bacteria 927
49 Ga0163163_10858761 3300014325 Bacteria 971
50 Ga0163163_11873703 3300014325 Bacteria 660
51 Ga0207680_10042814 3300025903 Bacteria 2652
52 Ga0207680_10340495 3300025903 Bacteria 1052
53 Ga0207684_10000899 3300025910 Bacteria 33859
54 Ga0207671_11074796 3300025914 Bacteria 633
55 Ga0207693_10677434 3300025915 Bacteria 800
56 Ga0207663_10059610 3300025916 Bacteria 2415
57 Ga0207663_10324205 3300025916 Bacteria 1158
58 Ga0207687_10314724 3300025927 Bacteria 1265
59 Ga0207664_10000020 3300025929 Bacteria 218362
60 Ga0207664_10418925 3300025929 Bacteria 1193
61 Ga0207669_11064054 3300025937 Bacteria 682
62 Ga0207711_10324615 3300025941 Bacteria 1423
63 Ga0207661_10306241 3300025944 Bacteria 1425
64 Ga0207679_10552987 3300025945 Bacteria 1033
65 Ga0207667_10642002 3300025949 Bacteria 1068
66 Ga0207668_10021774 3300025972 Bacteria 4092
67 Ga0207658_10418045 3300025986 Bacteria 1182
68 Ga0207703_10575392 3300026035 Bacteria 1064
69 Ga0207702_10123220 3300026078 Bacteria 2323
70 Ga0207428_10069844 3300027907 Bacteria 2762
71 Ga0268266_10001534 3300028379 Bacteria 27014
72 Ga0268266_10028475 3300028379 Bacteria 4747
73 Ga0268266_10530975 3300028379 Bacteria 1126
74 Ga0268265_10930133 3300028380 Bacteria 855
75 Ga0265318_10057331 3300028577 Bacteria 1456
76 Ga0265339_10042161 3300031249 Unclassified 2528
77 Ga0265327_10066526 3300031251 Bacteria 1819
78 Ga0265327_10206572 3300031251 Bacteria 888
79 Ga0307405_10394719 3300031731 Bacteria 1081
80 Ga0307405_10623517 3300031731 Bacteria 883
81 Ga0307405_10700386 3300031731 Bacteria 839
82 Ga0307413_10834754 3300031824 Bacteria 777
83 Ga0307413_11103906 3300031824 Bacteria 685
84 Ga0307413_12005027 3300031824 Bacteria 522
85 Ga0307410_11967650 3300031852 Bacteria 521
86 Ga0307406_10510422 3300031901 Bacteria 976
87 Ga0307407_10917581 3300031903 Bacteria 673
88 Ga0307409_100509370 3300031995 Bacteria 1174
89 Ga0307409_100521015 3300031995 Bacteria 1161
90 Ga0307416_100129073 3300032002 Bacteria 2271
91 Ga0307416_100527304 3300032002 Bacteria 1250
92 Ga0307416_100543723 3300032002 Bacteria 1234
93 Ga0307416_100635382 3300032002 Bacteria 1151
94 Ga0307416_101485440 3300032002 Bacteria 783
95 Ga0307414_10512656 3300032004 Bacteria 1063
96 Ga0307411_10908077 3300032005 Bacteria 783
97 Ga0307415_100664650 3300032126 Bacteria 936
98 Ga0307415_100820704 3300032126 Bacteria 851
99 Ga0307415_102520102 3300032126 Bacteria 507
100 Ga0373954_0307114 3300035118 Bacteria 783
101 Ga0373955_0027696 3300035172 Bacteria 2933
102 Ga0373924_0255310 3300035410 Bacteria 776
103 Ga0373933_0025730 3300035724 Viruses 3377
104 Ga0373937_0177501 3300036401 Bacteria 1999
105 Ga0395900_0232204 3300037418 Bacteria 1855
106 Ga0395900_0426542 3300037418 Bacteria 1286
107 Ga0395905_0405105 3300037471 Bacteria 1259
108 Ga0395901_1201028 3300038443 Bacteria 724
109 Ga0451787_838093 3300041441 Bacteria 782
110 Ga0451793_1916561 3300041452 Bacteria 948
111 Ga0451795_0747458 3300041456 Bacteria 568
112 Ga0451839_0286086 3300041496 Bacteria 678
113 Ga0451839_1475798 3300041496 Bacteria 722
114 Ga0439448_0076298 3300042005 Bacteria 1121
115 Ga0439456_092161 3300042013 Bacteria 682
116 Ga0466959_0546631 3300045049 Unclassified 781
117 Ga0451576_1120341 3300045051 Bacteria 823
118 Ga0466958_0002852 3300045836 Bacteria 8799
119 Ga0466967_0227086 3300045976 Bacteria 1776
120 Ga0466967_0554595 3300045976 Bacteria 1131
121 Ga0495653_0600823 3300046463 Bacteria 676
122 Ga0495580_0184837 3300046472 Viruses 1439
123 Ga0495605_0259877 3300046474 Bacteria 741
124 Ga0495584_0174506 3300046491 Bacteria 1092
125 Ga0495596_0401833 3300046500 Unclassified 534
126 Ga0495608_0147135 3300046511 Viruses 1502
127 Ga0495608_0237993 3300046511 Bacteria 1138
128 Ga0495628_0023646 3300046516 Bacteria 5042
129 Ga0495630_0009510 3300046517 Bacteria 6992
130 Ga0495652_0188698 3300046529 Bacteria 1575
131 Ga0495652_0670646 3300046529 Bacteria 700
132 Ga0495597_0188400 3300046542 Bacteria 831
133 Ga0495633_0212806 3300046558 Bacteria 886
134 Ga0495656_0072775 3300046615 Bacteria 1531
135 Ga0495668_0241104 3300046616 Unclassified 990
136 Ga0495634_0061278 3300046642 Bacteria 2501
137 Ga0495635_0113397 3300046663 Bacteria 1851
138 Ga0495635_0380136 3300046663 Bacteria 940
139 Ga0495659_0068919 3300046664 Bacteria 1322
140 Ga0495657_0273234 3300046675 Viruses 1013
141 Ga0495613_0080038 3300046689 Viruses 2376
142 Ga0495600_0375324 3300046809 Bacteria 888
143 Ga0495604_0276337 3300047317 Viruses 1136
144 Ga0495674_0671709 3300047319 Bacteria 815
145 Ga0495675_0088889 3300047444 Viruses 1940
146 Ga0495684_0011350 3300047471 Bacteria 6878
147 Ga0496100_0330033 3300048903 Bacteria 1148
148 Ga0496101_0164863 3300048904 Bacteria 1701
149 Ga0496101_0206302 3300048904 Bacteria 1521
150 Ga0496103_0359939 3300048906 Bacteria 935
151 Ga0496104_0009882 3300048907 Bacteria 8517
152 Ga0496105_0014338 3300048908 Bacteria 6308
153 Ga0496106_0178753 3300048909 Bacteria 1684
154 Ga0496108_0405083 3300048911 Bacteria 1191
155 Ga0496109_0892873 3300048912 Bacteria 827
156 Ga0496110_0340382 3300048913 Bacteria 1366
157 Ga0496115_0606342 3300048918 Bacteria 870
158 Ga0496117_0271732 3300048920 Bacteria 913
159 Ga0496118_0137744 3300048921 Bacteria 1554
160 Ga0496119_0002117 3300048922 Bacteria 22364
161 Ga0496119_0064860 3300048922 Bacteria 2166
162 Ga0496119_0193955 3300048922 Bacteria 1056
163 Ga0496120_0007494 3300048923 Bacteria 8103
164 Ga0496120_0453685 3300048923 Bacteria 558
165 Ga0496121_0004633 3300048924 Bacteria 18289
166 Ga0496121_0064125 3300048924 Bacteria 2997
167 Ga0496121_0177596 3300048924 Bacteria 1540
168 Ga0496121_0768627 3300048924 Bacteria 570
169 Ga0496124_0028806 3300048927 Bacteria 4961
170 Ga0496124_0575575 3300048927 Bacteria 738
171 Ga0496125_0010372 3300048928 Bacteria 9425
172 Ga0496125_0063675 3300048928 Bacteria 2938
173 Ga0496126_0058053 3300048929 Bacteria 3490
174 Ga0496126_0368383 3300048929 Bacteria 1172
175 Ga0501031_0164402 3300049568 Bacteria 1451
176 Ga0501037_0865031 3300049573 Bacteria 594
177 Ga0501040_0028501 3300049576 Bacteria 3765
178 Ga0501041_0243937 3300049577 Bacteria 1129
179 Ga0501042_0039550 3300049578 Bacteria 3352
180 Ga0501043_0281654 3300049579 Bacteria 1274
181 Ga0501046_0563247 3300049580 Bacteria 811
182 Ga0501048_0831910 3300049582 Bacteria 663
183 Ga0501070_0008810 3300049586 Bacteria 8531
184 Ga0501074_1348168 3300049590 Bacteria 500
185 Ga0501075_0038645 3300049591 Bacteria 3569
186 Ga0501076_0454655 3300049592 Bacteria 1054
187 Ga0501077_0322888 3300049593 Bacteria 984
188 Ga0501079_0100020 3300049741 Bacteria 2248
189 Ga0501271_052150 3300049768 Bacteria 558
190 Ga0501035_1559145 3300049822 Bacteria 502
191 Ga0501045_0152416 3300049824 Bacteria 1720
192 nmdc:mga05p37_1438181_c1 3300050507 Bacteria 691
193 nmdc:mga05p37_1511230_c1 3300050507 Bacteria 668
194 nmdc:mga06r32_1255193_c1 3300050510 Bacteria 686
195 nmdc:mga08y16_16073_c1 3300050511 Bacteria 7870
196 Ga0495655_0000006 3300053083 Bacteria 201200
197 Ga0495619_0008622 3300053085 Bacteria 6450
198 Ga0495619_0204039 3300053085 Bacteria 1369
199 Ga0500628_000001 3300053129 Bacteria 564074
200 Ga0500616_0005015 3300053153 Bacteria 9174
201 Ga0500627_0376152 3300053158 Bacteria 609
202 Ga0530510_0011446 3300061734 Bacteria 6225
203 Ga0466957_0081619
204 JGI25406J46586_10021078
205 Ga0070658_10336199
206 Ga0070658_10892327
207 Ga0070683_100934161
208 Ga0070666_10182585
209 Ga0070666_10199380
210 Ga0070666_11433726
211 Ga0070668_100065466
212 Ga0070667_100095898
213 Ga0070667_101165784
214 Ga0070714_100006223
215 Ga0070714_100150377
216 Ga0070711_100532831
217 Ga0070711_100610785
218 Ga0070706_100001613
219 Ga0070698_100008633
220 Ga0070684_100249999
221 Ga0068853_101630761
222 Ga0070665_100025971
223 Ga0070665_100107107
224 Ga0070665_101602846
225 Ga0068855_100993583
226 Ga0068856_100147182
227 Ga0068856_100415875
228 Ga0068858_100375340
229 Ga0081538_10007000
230 Ga0081539_10001749
231 Ga0081539_10021282
232 Ga0070712_101538058
233 Ga0075428_100150625
234 Ga0105240_10195285
235 Ga0111539_10098582
236 Ga0105245_10124232
237 Ga0105245_11186936
238 Ga0114129_10688055
239 Ga0105243_11938447
240 Ga0105241_11758939
241 Ga0105242_10106583
242 Ga0105248_10024883
243 Ga0105248_10520751
244 Ga0105237_10327082
245 Ga0105238_10100864
246 Ga0105239_10043147
247 Ga0105239_12849336
248 Ga0157372_11573146
249 Ga0157372_12591679
250 Ga0157375_11108398
251 Ga0163163_10858761
252 Ga0163163_11873703
253 Ga0207680_10042814
254 Ga0207680_10340495
255 Ga0207684_10000899
256 Ga0207671_11074796
257 Ga0207693_10677434
258 Ga0207663_10059610
259 Ga0207663_10324205
260 Ga0207687_10314724
261 Ga0207664_10000020
262 Ga0207664_10418925
263 Ga0207669_11064054
264 Ga0207711_10324615
265 Ga0207661_10306241
266 Ga0207679_10552987
267 Ga0207667_10642002
268 Ga0207668_10021774
269 Ga0207658_10418045
270 Ga0207703_10575392
271 Ga0207702_10123220
272 Ga0207428_10069844
273 Ga0268266_10001534
274 Ga0268266_10028475
275 Ga0268266_10530975
276 Ga0268265_10930133
277 Ga0265318_10057331
278 Ga0265339_10042161
279 Ga0265327_10066526
280 Ga0265327_10206572
281 Ga0307405_10394719
282 Ga0307405_10623517
283 Ga0307405_10700386
284 Ga0307413_10834754
285 Ga0307413_11103906
286 Ga0307413_12005027
287 Ga0307410_11967650
288 Ga0307406_10510422
289 Ga0307407_10917581
290 Ga0307409_100509370
291 Ga0307409_100521015
292 Ga0307416_100129073
293 Ga0307416_100527304
294 Ga0307416_100543723
295 Ga0307416_100635382
296 Ga0307416_101485440
297 Ga0307414_10512656
298 Ga0307411_10908077
299 Ga0307415_100664650
300 Ga0307415_100820704
301 Ga0307415_102520102
302 Ga0373954_0307114
303 Ga0373955_0027696
304 Ga0373924_0255310
305 Ga0373933_0025730
306 Ga0373937_0177501
307 Ga0395900_0232204
308 Ga0395900_0426542
309 Ga0395905_0405105
310 Ga0395901_1201028
311 Ga0451787_838093
312 Ga0451793_1916561
313 Ga0451795_0747458
314 Ga0451839_0286086
315 Ga0451839_1475798
316 Ga0439448_0076298
317 Ga0439456_092161
318 Ga0466959_0546631
319 Ga0451576_1120341
320 Ga0466958_0002852
321 Ga0466967_0227086
322 Ga0466967_0554595
323 Ga0495653_0600823
324 Ga0495580_0184837
325 Ga0495605_0259877
326 Ga0495584_0174506
327 Ga0495596_0401833
328 Ga0495608_0147135
329 Ga0495608_0237993
330 Ga0495628_0023646
331 Ga0495630_0009510
332 Ga0495652_0188698
333 Ga0495652_0670646
334 Ga0495597_0188400
335 Ga0495633_0212806
336 Ga0495656_0072775
337 Ga0495668_0241104
338 Ga0495634_0061278
339 Ga0495635_0113397
340 Ga0495635_0380136
341 Ga0495659_0068919
342 Ga0495657_0273234
343 Ga0495613_0080038
344 Ga0495600_0375324
345 Ga0495604_0276337
346 Ga0495674_0671709
347 Ga0495675_0088889
348 Ga0495684_0011350
349 Ga0496100_0330033
350 Ga0496101_0164863
351 Ga0496101_0206302
352 Ga0496103_0359939
353 Ga0496104_0009882
354 Ga0496105_0014338
355 Ga0496106_0178753
356 Ga0496108_0405083
357 Ga0496109_0892873
358 Ga0496110_0340382
359 Ga0496115_0606342
360 Ga0496117_0271732
361 Ga0496118_0137744
362 Ga0496119_0002117
363 Ga0496119_0064860
364 Ga0496119_0193955
365 Ga0496120_0007494
366 Ga0496120_0453685
367 Ga0496121_0004633
368 Ga0496121_0064125
369 Ga0496121_0177596
370 Ga0496121_0768627
371 Ga0496124_0028806
372 Ga0496124_0575575
373 Ga0496125_0010372
374 Ga0496125_0063675
375 Ga0496126_0058053
376 Ga0496126_0368383
377 Ga0501031_0164402
378 Ga0501037_0865031
379 Ga0501040_0028501
380 Ga0501041_0243937
381 Ga0501042_0039550
382 Ga0501043_0281654
383 Ga0501046_0563247
384 Ga0501048_0831910
385 Ga0501070_0008810
386 Ga0501074_1348168
387 Ga0501075_0038645
388 Ga0501076_0454655
389 Ga0501077_0322888
390 Ga0501079_0100020
391 Ga0501271_052150
392 Ga0501035_1559145
393 Ga0501045_0152416
394 nmdc:mga05p37_1438181_c1
395 nmdc:mga05p37_1511230_c1
396 nmdc:mga06r32_1255193_c1
397 nmdc:mga08y16_16073_c1
398 Ga0495655_0000006
399 Ga0495619_0008622
400 Ga0495619_0204039
401 Ga0500628_000001
402 Ga0500616_0005015
403 Ga0500627_0376152
404 Ga0530510_0011446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bif-assembly2.cif.gz_H biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria 0.9419 1 126
4uxa-assembly3.cif.gz_R improved variant of (r)-selective manganese-dependent hydroxynitrile lyase from bacteria 0.9364 1 126
4bif-assembly2.cif.gz_H biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria 0.8998 1 126
4uxa-assembly3.cif.gz_R improved variant of (r)-selective manganese-dependent hydroxynitrile lyase from bacteria 0.8946 1 126
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.8797 36 105
ID Description Score Start End Superfamily
4bifA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9448 1 126 2.60.120.10
4bifA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9024 1 126 2.60.120.10
2f4pA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8989 10 132 2.60.120.10
af_Q54K96_70_313_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8832 36 107 2.60.120.650
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8797 36 105 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A6J4PSV0-F1-model_v4 Cupin type-2 domain-containing protein 0.9951 38 131
AF-A0A4Q6DG11-F1-model_v4 deleted 0.9896 36 130
AF-A0A4Q3QCU4-F1-model_v4 deleted 0.9886 36 128
AF-A0A6I1H1Y8-F1-model_v4 Cupin domain-containing protein 0.9877 36 126
AF-F3KPW6-F1-model_v4 Cupin 2 barrel domain-containing protein 0.9873 38 126

Map