F310236

General Info

Members Datasets Scaffolds Average Seq Length
202 148 404 150

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0311585|Ga0466971_0311585_68_601
Length 177
Sequence MTQSTNQSADQSAGGSTNEPAGTAAEPAVVGHTLKVHHLRPAPGARTPKTRVGRGEASKGKSAGRGTKGSKARYQVSPAFEGGQMPLHMRLPKLRGFKNPFRVEYQVVNLDRLGELFPDGGEVSVADLVAKGAVRDGQLVKVLGTGQLDVALRVSAHAFSGSARQKIEAAGGTATTL

Samples

Sample ID Description Type Environment
1 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
61 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
62 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
63 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
73 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
74 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
75 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
76 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
77 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
83 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
108 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
140 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
141 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 2643221679 Angustibacter sp. Root456 Isolate Unclassified
146 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
147 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
148 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.7
Metatranscriptomes 18.32
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.44
Nodule 0.5
Rhizoplane 5.94
Rhizosphere 78.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466971_0311585 3300044719 Bacteria 757
2 Ga0058861_12019063 3300004800 Bacteria 1834
3 Ga0068869_100189694 3300005334 Bacteria 1616
4 Ga0068868_100067088 3300005338 Bacteria 2855
5 Ga0070692_10164827 3300005345 Bacteria 1273
6 Ga0070673_100534145 3300005364 Bacteria 1064
7 Ga0070688_100840050 3300005365 Bacteria 721
8 Ga0070659_100096821 3300005366 Bacteria 2371
9 Ga0070659_100402720 3300005366 Bacteria 1155
10 Ga0070681_10162186 3300005458 Bacteria 2159
11 Ga0070706_101266419 3300005467 Bacteria 677
12 Ga0070684_100227434 3300005535 Bacteria 1703
13 Ga0070664_100359985 3300005564 Bacteria 1325
14 Ga0068856_100363045 3300005614 Bacteria 1467
15 Ga0068852_100413328 3300005616 Bacteria 1329
16 Ga0068852_100902495 3300005616 Bacteria 901
17 Ga0081455_10022863 3300005937 Bacteria 5830
18 Ga0081455_10562386 3300005937 Bacteria 751
19 Ga0070717_10021535 3300006028 Bacteria 5080
20 Ga0070717_10570204 3300006028 Bacteria 1026
21 Ga0075365_10027702 3300006038 Bacteria 3608
22 Ga0075365_10311960 3300006038 Bacteria 1107
23 Ga0075364_10228986 3300006051 Bacteria 1262
24 Ga0075428_100002072 3300006844 Bacteria 21635
25 Ga0075430_100028829 3300006846 Bacteria 4715
26 Ga0075431_100004313 3300006847 Bacteria 13937
27 Ga0075431_100026412 3300006847 Bacteria 5957
28 Ga0075429_100010921 3300006880 Bacteria 7856
29 Ga0099794_10022747 3300007265 Bacteria 2860
30 Ga0105240_10023139 3300009093 Bacteria 8226
31 Ga0111539_10033733 3300009094 Bacteria 6213
32 Ga0114129_10006606 3300009147 Bacteria 16463
33 Ga0105242_10456550 3300009176 Bacteria 1206
34 Ga0105242_10635883 3300009176 Bacteria 1036
35 Ga0105248_10000035 3300009177 Bacteria 187578
36 Ga0105239_10640030 3300010375 Bacteria 1214
37 Ga0105239_10650986 3300010375 Bacteria 1203
38 Ga0157370_10006658 3300013104 Bacteria 12691
39 Ga0157369_10036671 3300013105 Bacteria 5371
40 Ga0157369_10309950 3300013105 Bacteria 1641
41 Ga0157369_10323479 3300013105 Bacteria 1603
42 Ga0157374_10192738 3300013296 Bacteria 1994
43 Ga0157372_10054628 3300013307 Bacteria 4456
44 Ga0157372_10082058 3300013307 Bacteria 3649
45 Ga0157372_11180840 3300013307 Bacteria 885
46 Ga0197907_10413959 3300020069 Bacteria 568
47 Ga0197907_10468185 3300020069 Bacteria 513
48 Ga0197907_10590527 3300020069 Bacteria 2123
49 Ga0206356_10922957 3300020070 Bacteria 612
50 Ga0206356_11010885 3300020070 Bacteria 651
51 Ga0206352_10222585 3300020078 Bacteria 596
52 Ga0206352_10506595 3300020078 Bacteria 513
53 Ga0206350_10477199 3300020080 Bacteria 1462
54 Ga0206350_11360983 3300020080 Bacteria 835
55 Ga0206354_10511494 3300020081 Bacteria 586
56 Ga0206354_11216171 3300020081 Bacteria 1605
57 Ga0206353_10111055 3300020082 Bacteria 1008
58 Ga0213874_10034946 3300021377 Bacteria 1474
59 Ga0213876_10000890 3300021384 Bacteria 19986
60 Ga0224712_10001454 3300022467 Bacteria 5460
61 Ga0224712_10285261 3300022467 Bacteria 769
62 Ga0207688_10212915 3300025901 Bacteria 1162
63 Ga0207699_10912640 3300025906 Bacteria 648
64 Ga0207707_10532491 3300025912 Bacteria 999
65 Ga0207707_10727964 3300025912 Bacteria 831
66 Ga0207695_10082479 3300025913 Bacteria 3250
67 Ga0207671_10138013 3300025914 Bacteria 1876
68 Ga0207662_10500066 3300025918 Bacteria 837
69 Ga0207694_10968545 3300025924 Bacteria 720
70 Ga0207659_10371394 3300025926 Bacteria 1191
71 Ga0207690_10007372 3300025932 Bacteria 6529
72 Ga0207690_10275826 3300025932 Bacteria 1308
73 Ga0207690_10341520 3300025932 Bacteria 1182
74 Ga0207686_10320339 3300025934 Bacteria 1158
75 Ga0207711_10000134 3300025941 Bacteria 77843
76 Ga0207689_10461005 3300025942 Bacteria 1063
77 Ga0207651_10313366 3300025960 Bacteria 1309
78 Ga0207677_10002332 3300026023 Bacteria 9960
79 Ga0207703_11853098 3300026035 Bacteria 579
80 Ga0207648_10499561 3300026089 Bacteria 1113
81 Ga0207428_10010526 3300027907 Bacteria 8256
82 Ga0307515_10602575 3300028794 Bacteria 709
83 Ga0316576_10000044 3300031727 Bacteria 38025
84 Ga0316578_10037265 3300031728 Bacteria 2801
85 Ga0307516_10645923 3300031730 Bacteria 713
86 Ga0307412_10427304 3300031911 Bacteria 1085
87 Ga0307416_100730310 3300032002 Bacteria 1082
88 Ga0307411_11193181 3300032005 Bacteria 690
89 Ga0307415_100084807 3300032126 Bacteria 2274
90 Ga0316593_10047896 3300032168 Bacteria 1438
91 Ga0316596_1063929 3300033541 Bacteria 983
92 Ga0436365_0726823 3300039437 Bacteria 811
93 Ga0436365_1257400 3300039437 Bacteria 59519
94 Ga0436363_1032143 3300039450 Bacteria 1385
95 Ga0436363_1482101 3300039450 Bacteria 2005
96 Ga0436362_0940410 3300039453 Bacteria 1317
97 Ga0451793_1060287 3300041452 Bacteria 522
98 Ga0451795_0542094 3300041456 Bacteria 1946
99 Ga0451845_0636587 3300041501 Bacteria 630
100 Ga0451843_0254741 3300041509 Bacteria 1282
101 Ga0451843_0648443 3300041509 Bacteria 1417
102 Ga0439446_0059408 3300042156 Bacteria 1154
103 Ga0466969_0004847 3300044656 Bacteria 7164
104 Ga0466965_0027398 3300044683 Bacteria 2767
105 Ga0466965_0071026 3300044683 Bacteria 1751
106 Ga0466965_0085008 3300044683 Bacteria 1603
107 Ga0466965_0512077 3300044683 Bacteria 674
108 Ga0466961_0143428 3300044693 Bacteria 1494
109 Ga0466963_0050968 3300044694 Bacteria 2742
110 Ga0466963_0134959 3300044694 Bacteria 1707
111 Ga0466963_0244238 3300044694 Bacteria 1259
112 Ga0466963_0376858 3300044694 Bacteria 1000
113 Ga0466964_0456614 3300044706 Bacteria 678
114 Ga0466968_0057898 3300044735 Bacteria 1667
115 Ga0466970_0003384 3300044765 Bacteria 7764
116 Ga0466957_0077585 3300044842 Bacteria 2064
117 Ga0466957_0216995 3300044842 Bacteria 1262
118 Ga0466960_0102593 3300044901 Bacteria 1475
119 Ga0466960_0267496 3300044901 Bacteria 954
120 Ga0466959_0127296 3300045049 Bacteria 1807
121 Ga0466959_0224482 3300045049 Bacteria 1302
122 Ga0466958_0283048 3300045836 Bacteria 1063
123 Ga0466958_0860774 3300045836 Bacteria 591
124 Ga0466967_0028211 3300045976 Bacteria 4683
125 Ga0466967_0186847 3300045976 Bacteria 1957
126 Ga0466967_0197475 3300045976 Bacteria 1904
127 Ga0466967_0286402 3300045976 Bacteria 1582
128 Ga0466967_0503487 3300045976 Bacteria 1189
129 Ga0466967_0622199 3300045976 Bacteria 1066
130 Ga0466967_1146794 3300045976 Bacteria 774
131 Ga0495641_0213562 3300046461 Bacteria 865
132 Ga0495608_0257581 3300046511 Bacteria 1087
133 Ga0495632_0082332 3300046519 Bacteria 1534
134 Ga0495640_0768100 3300046533 Bacteria 576
135 Ga0495667_0054949 3300046559 Bacteria 2619
136 Ga0495658_0050639 3300046683 Bacteria 2350
137 Ga0495613_0691947 3300046689 Bacteria 672
138 Ga0495674_0163771 3300047319 Bacteria 1860
139 Ga0496101_1566927 3300048904 Bacteria 512
140 Ga0496104_0100450 3300048907 Bacteria 2769
141 Ga0496104_0199325 3300048907 Bacteria 1914
142 Ga0496105_1045061 3300048908 Bacteria 609
143 Ga0496109_0878697 3300048912 Bacteria 834
144 Ga0496109_0992750 3300048912 Bacteria 777
145 Ga0496110_0043234 3300048913 Bacteria 3934
146 Ga0496110_0434313 3300048913 Bacteria 1197
147 Ga0496111_0118650 3300048914 Bacteria 1953
148 Ga0496115_0135463 3300048918 Bacteria 2031
149 Ga0496117_0024630 3300048920 Bacteria 4752
150 Ga0496118_0081219 3300048921 Bacteria 2277
151 Ga0496121_0043117 3300048924 Bacteria 3912
152 Ga0496124_0120217 3300048927 Bacteria 2100
153 Ga0496126_0000246 3300048929 Bacteria 116854
154 Ga0501306_015499 3300049127 Bacteria 1015
155 Ga0501306_035698 3300049127 Bacteria 755
156 Ga0501309_016984 3300049129 Bacteria 997
157 Ga0501309_037229 3300049129 Bacteria 735
158 Ga0501307_065098 3300049162 Bacteria 572
159 Ga0501311_013799 3300049527 Bacteria 1024
160 Ga0501312_017861 3300049528 Bacteria 1028
161 Ga0501312_041464 3300049528 Bacteria 754
162 Ga0501315_042205 3300049531 Bacteria 694
163 Ga0501316_010121 3300049532 Bacteria 1069
164 Ga0501316_010899 3300049532 Bacteria 1041
165 Ga0501317_004747 3300049533 Bacteria 1428
166 Ga0501318_021456 3300049534 Bacteria 821
167 Ga0501320_007849 3300049536 Bacteria 1037
168 Ga0501321_011018 3300049537 Bacteria 1002
169 Ga0501323_012145 3300049539 Bacteria 1049
170 Ga0501323_046246 3300049539 Bacteria 650
171 Ga0501325_019112 3300049541 Bacteria 707
172 Ga0501326_05725 3300049542 Bacteria 682
173 Ga0501338_10549 3300049554 Bacteria 623
174 Ga0501031_0247455 3300049568 Bacteria 1159
175 Ga0501034_1354547 3300049571 Bacteria 587
176 Ga0501040_0180749 3300049576 Bacteria 1495
177 Ga0501041_0246917 3300049577 Bacteria 1122
178 Ga0501072_0211513 3300049588 Bacteria 1545
179 Ga0501080_0349109 3300049742 Bacteria 1336
180 nmdc:mga00v17_127092_c1 3300050491 Bacteria 1627
181 nmdc:mga0yw44_1197_c1 3300050492 Bacteria 10147
182 nmdc:mga0yw44_203538_c1 3300050492 Bacteria 1308
183 nmdc:mga0yw44_286000_c1 3300050492 Bacteria 1103
184 nmdc:mga07m45_161195_c1 3300050496 Bacteria 1302
185 nmdc:mga07m45_337717_c1 3300050496 Bacteria 875
186 nmdc:mga05p37_10660_c1 3300050507 Bacteria 10905
187 nmdc:mga09592_154_c1 3300050508 Bacteria 47375
188 nmdc:mga0qj67_20176_c1 3300050509 Bacteria 5101
189 nmdc:mga06r32_130_c1 3300050510 Bacteria 55123
190 nmdc:mga06r32_5565_c1 3300050510 Bacteria 11347
191 nmdc:mga08y16_3501_c1 3300050511 Bacteria 16300
192 Ga0495595_0346139 3300053084 Bacteria 750
193 Ga0500628_006212 3300053129 Bacteria 2014
194 Ga0500604_0034913 3300053151 Bacteria 1494
195 Ga0500616_0000144 3300053153 Bacteria 121889
196 Ga0500616_0000947 3300053153 Bacteria 31587
197 Ga0501084_0438557 3300054114 Bacteria 1104
198 Ga0466962_0114751 3300061719 Bacteria 1298
199 2644445551 2643221679 Bacteria 3839507
200 2689992366 2687453743 Bacteria 8361025
201 2837269032 2837268691 Bacteria 7850704
202 8054477911 8054472261 Bacteria 7464355
203 Ga0466971_0311585
204 Ga0058861_12019063
205 Ga0068869_100189694
206 Ga0068868_100067088
207 Ga0070692_10164827
208 Ga0070673_100534145
209 Ga0070688_100840050
210 Ga0070659_100096821
211 Ga0070659_100402720
212 Ga0070681_10162186
213 Ga0070706_101266419
214 Ga0070684_100227434
215 Ga0070664_100359985
216 Ga0068856_100363045
217 Ga0068852_100413328
218 Ga0068852_100902495
219 Ga0081455_10022863
220 Ga0081455_10562386
221 Ga0070717_10021535
222 Ga0070717_10570204
223 Ga0075365_10027702
224 Ga0075365_10311960
225 Ga0075364_10228986
226 Ga0075428_100002072
227 Ga0075430_100028829
228 Ga0075431_100004313
229 Ga0075431_100026412
230 Ga0075429_100010921
231 Ga0099794_10022747
232 Ga0105240_10023139
233 Ga0111539_10033733
234 Ga0114129_10006606
235 Ga0105242_10456550
236 Ga0105242_10635883
237 Ga0105248_10000035
238 Ga0105239_10640030
239 Ga0105239_10650986
240 Ga0157370_10006658
241 Ga0157369_10036671
242 Ga0157369_10309950
243 Ga0157369_10323479
244 Ga0157374_10192738
245 Ga0157372_10054628
246 Ga0157372_10082058
247 Ga0157372_11180840
248 Ga0197907_10413959
249 Ga0197907_10468185
250 Ga0197907_10590527
251 Ga0206356_10922957
252 Ga0206356_11010885
253 Ga0206352_10222585
254 Ga0206352_10506595
255 Ga0206350_10477199
256 Ga0206350_11360983
257 Ga0206354_10511494
258 Ga0206354_11216171
259 Ga0206353_10111055
260 Ga0213874_10034946
261 Ga0213876_10000890
262 Ga0224712_10001454
263 Ga0224712_10285261
264 Ga0207688_10212915
265 Ga0207699_10912640
266 Ga0207707_10532491
267 Ga0207707_10727964
268 Ga0207695_10082479
269 Ga0207671_10138013
270 Ga0207662_10500066
271 Ga0207694_10968545
272 Ga0207659_10371394
273 Ga0207690_10007372
274 Ga0207690_10275826
275 Ga0207690_10341520
276 Ga0207686_10320339
277 Ga0207711_10000134
278 Ga0207689_10461005
279 Ga0207651_10313366
280 Ga0207677_10002332
281 Ga0207703_11853098
282 Ga0207648_10499561
283 Ga0207428_10010526
284 Ga0307515_10602575
285 Ga0316576_10000044
286 Ga0316578_10037265
287 Ga0307516_10645923
288 Ga0307412_10427304
289 Ga0307416_100730310
290 Ga0307411_11193181
291 Ga0307415_100084807
292 Ga0316593_10047896
293 Ga0316596_1063929
294 Ga0436365_0726823
295 Ga0436365_1257400
296 Ga0436363_1032143
297 Ga0436363_1482101
298 Ga0436362_0940410
299 Ga0451793_1060287
300 Ga0451795_0542094
301 Ga0451845_0636587
302 Ga0451843_0254741
303 Ga0451843_0648443
304 Ga0439446_0059408
305 Ga0466969_0004847
306 Ga0466965_0027398
307 Ga0466965_0071026
308 Ga0466965_0085008
309 Ga0466965_0512077
310 Ga0466961_0143428
311 Ga0466963_0050968
312 Ga0466963_0134959
313 Ga0466963_0244238
314 Ga0466963_0376858
315 Ga0466964_0456614
316 Ga0466968_0057898
317 Ga0466970_0003384
318 Ga0466957_0077585
319 Ga0466957_0216995
320 Ga0466960_0102593
321 Ga0466960_0267496
322 Ga0466959_0127296
323 Ga0466959_0224482
324 Ga0466958_0283048
325 Ga0466958_0860774
326 Ga0466967_0028211
327 Ga0466967_0186847
328 Ga0466967_0197475
329 Ga0466967_0286402
330 Ga0466967_0503487
331 Ga0466967_0622199
332 Ga0466967_1146794
333 Ga0495641_0213562
334 Ga0495608_0257581
335 Ga0495632_0082332
336 Ga0495640_0768100
337 Ga0495667_0054949
338 Ga0495658_0050639
339 Ga0495613_0691947
340 Ga0495674_0163771
341 Ga0496101_1566927
342 Ga0496104_0100450
343 Ga0496104_0199325
344 Ga0496105_1045061
345 Ga0496109_0878697
346 Ga0496109_0992750
347 Ga0496110_0043234
348 Ga0496110_0434313
349 Ga0496111_0118650
350 Ga0496115_0135463
351 Ga0496117_0024630
352 Ga0496118_0081219
353 Ga0496121_0043117
354 Ga0496124_0120217
355 Ga0496126_0000246
356 Ga0501306_015499
357 Ga0501306_035698
358 Ga0501309_016984
359 Ga0501309_037229
360 Ga0501307_065098
361 Ga0501311_013799
362 Ga0501312_017861
363 Ga0501312_041464
364 Ga0501315_042205
365 Ga0501316_010121
366 Ga0501316_010899
367 Ga0501317_004747
368 Ga0501318_021456
369 Ga0501320_007849
370 Ga0501321_011018
371 Ga0501323_012145
372 Ga0501323_046246
373 Ga0501325_019112
374 Ga0501326_05725
375 Ga0501338_10549
376 Ga0501031_0247455
377 Ga0501034_1354547
378 Ga0501040_0180749
379 Ga0501041_0246917
380 Ga0501072_0211513
381 Ga0501080_0349109
382 nmdc:mga00v17_127092_c1
383 nmdc:mga0yw44_1197_c1
384 nmdc:mga0yw44_203538_c1
385 nmdc:mga0yw44_286000_c1
386 nmdc:mga07m45_161195_c1
387 nmdc:mga07m45_337717_c1
388 nmdc:mga05p37_10660_c1
389 nmdc:mga09592_154_c1
390 nmdc:mga0qj67_20176_c1
391 nmdc:mga06r32_130_c1
392 nmdc:mga06r32_5565_c1
393 nmdc:mga08y16_3501_c1
394 Ga0495595_0346139
395 Ga0500628_006212
396 Ga0500604_0034913
397 Ga0500616_0000144
398 Ga0500616_0000947
399 Ga0501084_0438557
400 Ga0466962_0114751
401 2644445551
402 2689992366
403 2837269032
404 8054477911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

59

175

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1p90-assembly1.cif.gz_A the three-dimensional structure of the core domain of nafy from azotobacter vinelandii determined at 1.8 resolution 0.893 123 145
1w2b-assembly1.cif.gz_N trigger factor ribosome binding domain in complex with 50s 0.8373 74 143
6th6-assembly1.cif.gz_BR cryo-em structure of t. kodakarensis 70s ribosome 0.8013 68 146
6zu5-assembly1.cif.gz_LQ0 structure of the paranosema locustae ribosome in complex with lso2 0.7808 76 146
7qep-assembly1.cif.gz_M8 cryo-em structure of the ribosome from encephalitozoon cuniculi 0.7645 74 146
ID Description Score Start End Superfamily
5v7qL01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9582 74 145 3.100.10.10
5v7qL01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9456 74 145 3.100.10.10
4qjsP01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9214 74 146 3.100.10.10
af_P0A0F8_66_146_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9214 66 146 3.100.10.10
af_P0A0F8_66_146_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9106 66 146 3.100.10.10
ID Description Score Start End GO Terms
AF-A0A6B3F858-F1-model_v4 50S ribosomal protein L15 0.9946 68 146 GO:0003735
GO:0006412
GO:0022625
AF-A0A7K0NA90-F1-model_v4 50S ribosomal protein L15 0.98 91 146 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7K0Z8M8-F1-model_v4 50S ribosomal protein L15 0.9797 67 146 GO:0003735
GO:0006412
GO:0022625
AF-A0A7K0MKD2-F1-model_v4 50S ribosomal protein L15 0.9757 67 146 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3M1DXY8-F1-model_v4 50S ribosomal protein L15 0.9734 91 146 GO:0003735
GO:0006412
GO:0022625

Map