F310225

General Info

Members Datasets Scaffolds Average Seq Length
202 151 404 166

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0065689|Ga0466964_0065689_148_642
Length 154
Sequence MPEADRPLTVLIEIPKGSRNKYEWDAELQAIKLDRFLFSSVVYPTDYGFIPQTCGEDGDPLDAMVCVTDPTFPGCVIPAKVVGLFRMTDVPCNDPNWDGIDELDDLPQPLRNEIEHFFSIYKQPEGKTVDVDGWYPRAEAERTIAEARDRAAAR

Samples

Sample ID Description Type Environment
1 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
76 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
77 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
87 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
98 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
101 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
102 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
106 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
113 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
114 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
115 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
146 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
147 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
148 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 0
Rhizoplane 8.91
Rhizosphere 87.13
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466964_0065689 3300044706 Bacteria 1521
2 JGI25407J50210_10123495 3300003373 Bacteria 637
3 JGI25404J52841_10050880 3300003659 Bacteria 871
4 Ga0070658_10072550 3300005327 Bacteria 2821
5 Ga0070658_10256368 3300005327 Bacteria 1484
6 Ga0070683_100928547 3300005329 Bacteria 835
7 Ga0068869_100882590 3300005334 Bacteria 773
8 Ga0070666_10437987 3300005335 Bacteria 943
9 Ga0070660_100098383 3300005339 Bacteria 2315
10 Ga0070660_100517209 3300005339 Bacteria 994
11 Ga0070661_100336877 3300005344 Bacteria 1181
12 Ga0070668_100029418 3300005347 Bacteria 4172
13 Ga0070669_100684431 3300005353 Bacteria 865
14 Ga0070700_100689720 3300005441 Bacteria 811
15 Ga0070662_100322133 3300005457 Bacteria 1260
16 Ga0070679_100090177 3300005530 Bacteria 3054
17 Ga0070679_100548347 3300005530 Bacteria 1100
18 Ga0070672_101447345 3300005543 Bacteria 615
19 Ga0070696_100231352 3300005546 Bacteria 1391
20 Ga0070704_100238789 3300005549 Bacteria 1486
21 Ga0068866_10007510 3300005718 Bacteria 4567
22 Ga0068861_100062800 3300005719 Bacteria 2854
23 Ga0068863_100004074 3300005841 Bacteria 14435
24 Ga0068863_100130761 3300005841 Bacteria 2397
25 Ga0081455_10078343 3300005937 Bacteria 2716
26 Ga0081538_10010251 3300005981 Bacteria 7697
27 Ga0081538_10066922 3300005981 Bacteria 2010
28 Ga0081538_10153635 3300005981 Bacteria 1037
29 Ga0081540_1000847 3300005983 Bacteria 27862
30 Ga0075365_10160213 3300006038 Bacteria 1568
31 Ga0075364_10276771 3300006051 Bacteria 1142
32 Ga0075432_10004856 3300006058 Bacteria 4576
33 Ga0070712_100260285 3300006175 Bacteria 1390
34 Ga0075428_100025013 3300006844 Bacteria 6606
35 Ga0075428_101104170 3300006844 Bacteria 838
36 Ga0075430_100000178 3300006846 Bacteria 42237
37 Ga0075430_100017374 3300006846 Bacteria 6127
38 Ga0075430_100521235 3300006846 Bacteria 981
39 Ga0075431_100119206 3300006847 Bacteria 2723
40 Ga0075433_10029347 3300006852 Bacteria 4685
41 Ga0075433_10719384 3300006852 Bacteria 874
42 Ga0075429_100019722 3300006880 Bacteria 5845
43 Ga0068865_100493681 3300006881 Bacteria 1019
44 Ga0111539_10013075 3300009094 Bacteria 10384
45 Ga0111539_10541478 3300009094 Bacteria 1356
46 Ga0111539_11107563 3300009094 Bacteria 920
47 Ga0111539_11109513 3300009094 Bacteria 919
48 Ga0111539_11653739 3300009094 Bacteria 742
49 Ga0105245_11148840 3300009098 Bacteria 824
50 Ga0114129_10179449 3300009147 Bacteria 2883
51 Ga0114129_11661134 3300009147 Bacteria 780
52 Ga0105242_10000010 3300009176 Bacteria 151649
53 Ga0105242_10811204 3300009176 Bacteria 927
54 Ga0105249_10079921 3300009553 Bacteria 3037
55 Ga0105249_11288697 3300009553 Bacteria 802
56 Ga0105239_10068801 3300010375 Bacteria 3891
57 Ga0105246_10146568 3300011119 Bacteria 1782
58 Ga0105246_10167281 3300011119 Bacteria 1681
59 Ga0157374_11539750 3300013296 Bacteria 688
60 Ga0163162_10089020 3300013306 Bacteria 3167
61 Ga0157372_10554555 3300013307 Bacteria 1340
62 Ga0157372_11282141 3300013307 Bacteria 846
63 Ga0163163_11011734 3300014325 Bacteria 894
64 Ga0163161_10117304 3300017792 Bacteria 1996
65 Ga0163161_10471211 3300017792 Bacteria 1018
66 Ga0213875_10036967 3300021388 Bacteria 2302
67 Ga0207642_10004351 3300025899 Bacteria 4567
68 Ga0207705_10196938 3300025909 Bacteria 1525
69 Ga0207707_10698602 3300025912 Bacteria 852
70 Ga0207693_10281530 3300025915 Bacteria 1303
71 Ga0207657_10006754 3300025919 Bacteria 11855
72 Ga0207652_10036726 3300025921 Bacteria 4143
73 Ga0207706_10005706 3300025933 Bacteria 11597
74 Ga0207706_10399793 3300025933 Bacteria 1191
75 Ga0207686_10000394 3300025934 Bacteria 30367
76 Ga0207709_10089497 3300025935 Bacteria 2007
77 Ga0207709_10658955 3300025935 Bacteria 834
78 Ga0207704_11233292 3300025938 Bacteria 638
79 Ga0207689_10593810 3300025942 Bacteria 931
80 Ga0207712_10005404 3300025961 Bacteria 8064
81 Ga0207668_10021909 3300025972 Bacteria 4081
82 Ga0207678_10299772 3300026067 Bacteria 1381
83 Ga0207708_10634643 3300026075 Bacteria 908
84 Ga0207641_10020226 3300026088 Bacteria 5465
85 Ga0207675_100000816 3300026118 Bacteria 30994
86 Ga0209983_1086133 3300027665 Bacteria 706
87 Ga0207428_10099363 3300027907 Bacteria 2250
88 Ga0207428_10417704 3300027907 Bacteria 981
89 Ga0268265_10137764 3300028380 Bacteria 2039
90 Ga0307413_10470729 3300031824 Bacteria 1002
91 Ga0307410_10221792 3300031852 Bacteria 1455
92 Ga0307410_10648080 3300031852 Bacteria 886
93 Ga0307406_10450925 3300031901 Bacteria 1032
94 Ga0307406_10511247 3300031901 Bacteria 976
95 Ga0307407_10456648 3300031903 Bacteria 928
96 Ga0307409_100183896 3300031995 Bacteria 1853
97 Ga0307409_100298723 3300031995 Bacteria 1497
98 Ga0307414_11026727 3300032004 Bacteria 760
99 Ga0307411_10449973 3300032005 Bacteria 1077
100 Ga0307415_100263360 3300032126 Bacteria 1408
101 Ga0307415_100829862 3300032126 Bacteria 846
102 Ga0373952_0011931 3300035092 Bacteria 1702
103 Ga0373960_0056814 3300035121 Bacteria 1176
104 Ga0373962_0016083 3300035242 Bacteria 1925
105 Ga0373931_0005780 3300035691 Bacteria 5749
106 Ga0395899_0694016 3300037312 Bacteria 639
107 Ga0395900_0112553 3300037418 Bacteria 2795
108 Ga0395900_0745850 3300037418 Bacteria 910
109 Ga0395900_1339768 3300037418 Bacteria 629
110 Ga0395898_0184957 3300037466 Bacteria 1991
111 Ga0395898_0460507 3300037466 Bacteria 1211
112 Ga0395898_0884324 3300037466 Bacteria 832
113 Ga0395905_1099546 3300037471 Bacteria 698
114 Ga0436364_0711990 3300037853 Bacteria 8698
115 Ga0395901_0032163 3300038443 Bacteria 5414
116 Ga0436362_1268930 3300039453 Bacteria 724
117 Ga0451791_0560645 3300041451 Bacteria 1480
118 Ga0451791_1673806 3300041451 Bacteria 603
119 Ga0451802_0525373 3300041460 Bacteria 2337
120 Ga0451853_3321015 3300041512 Bacteria 699
121 Ga0466969_0209810 3300044656 Bacteria 887
122 Ga0466966_0036832 3300044684 Bacteria 3158
123 Ga0466966_0074967 3300044684 Unclassified 2114
124 Ga0466966_0347917 3300044684 Bacteria 891
125 Ga0466961_0004703 3300044693 Bacteria 8585
126 Ga0466964_0289373 3300044706 Bacteria 822
127 Ga0466960_0091326 3300044901 Bacteria 1553
128 Ga0466960_0430918 3300044901 Bacteria 764
129 Ga0466959_0005191 3300045049 Bacteria 8882
130 Ga0466958_0020140 3300045836 Bacteria 3889
131 Ga0466958_0063604 3300045836 Bacteria 2250
132 Ga0466958_0408287 3300045836 Bacteria 877
133 Ga0466967_0214017 3300045976 Bacteria 1829
134 Ga0466967_0708612 3300045976 Bacteria 997
135 Ga0495629_0232771 3300046459 Bacteria 1270
136 Ga0495641_0000048 3300046461 Bacteria 74033
137 Ga0495639_0032136 3300046475 Bacteria 2340
138 Ga0495662_0106236 3300046476 Bacteria 1374
139 Ga0495584_0171931 3300046491 Bacteria 1101
140 Ga0495584_0478741 3300046491 Bacteria 634
141 Ga0495596_0042218 3300046500 Bacteria 1797
142 Ga0495616_0077887 3300046513 Bacteria 1591
143 Ga0495631_0092469 3300046518 Unclassified 1302
144 Ga0495643_0430478 3300046522 Unclassified 577
145 Ga0495644_0117770 3300046523 Bacteria 1010
146 Ga0495656_0001919 3300046615 Bacteria 6861
147 Ga0495668_0229753 3300046616 Bacteria 1016
148 Ga0495658_0033646 3300046683 Bacteria 2809
149 Ga0495670_0052457 3300046691 Bacteria 2042
150 Ga0495670_0253826 3300046691 Bacteria 938
151 Ga0495660_0404703 3300046810 Unclassified 597
152 Ga0495676_0006004 3300047321 Bacteria 11158
153 Ga0495683_0068992 3300047323 Bacteria 1738
154 Ga0495683_0265221 3300047323 Unclassified 749
155 Ga0495673_0059317 3300047469 Bacteria 1645
156 Ga0495681_0207774 3300047470 Unclassified 791
157 Ga0495615_0018839 3300048090 Bacteria 1525
158 Ga0496100_0005252 3300048903 Bacteria 6958
159 Ga0496101_0078001 3300048904 Bacteria 2442
160 Ga0496102_0016530 3300048905 Bacteria 6449
161 Ga0496104_0199512 3300048907 Bacteria 1913
162 Ga0496104_1157564 3300048907 Bacteria 677
163 Ga0496106_0009203 3300048909 Bacteria 7294
164 Ga0496106_0399365 3300048909 Bacteria 1105
165 Ga0496107_0003322 3300048910 Bacteria 10750
166 Ga0496109_0423650 3300048912 Bacteria 1257
167 Ga0496110_0295687 3300048913 Bacteria 1475
168 Ga0496112_0059958 3300048915 Bacteria 3750
169 Ga0496112_0424680 3300048915 Bacteria 1268
170 Ga0496113_0242184 3300048916 Bacteria 1439
171 Ga0496113_1178637 3300048916 Bacteria 599
172 Ga0496115_0102504 3300048918 Bacteria 2347
173 Ga0501036_0276056 3300049572 Bacteria 1407
174 Ga0501038_0280543 3300049574 Bacteria 1312
175 Ga0501042_0477032 3300049578 Bacteria 905
176 Ga0501042_0810977 3300049578 Bacteria 681
177 Ga0501043_0377328 3300049579 Bacteria 1074
178 Ga0501048_0091647 3300049582 Bacteria 2144
179 Ga0501067_0322622 3300049583 Bacteria 860
180 Ga0501070_0360608 3300049586 Bacteria 1179
181 Ga0501071_0854528 3300049587 Bacteria 702
182 Ga0501076_0271020 3300049592 Bacteria 1390
183 Ga0501035_0194857 3300049822 Bacteria 1741
184 nmdc:mga06z11_730061_c1 3300050494 Bacteria 603
185 nmdc:mga05p37_10358_c1 3300050507 Bacteria 11066
186 nmdc:mga09592_18578_c1 3300050508 Bacteria 5703
187 nmdc:mga09592_856330_c1 3300050508 Bacteria 766
188 nmdc:mga0qj67_118451_c1 3300050509 Bacteria 2141
189 nmdc:mga0qj67_1975_c1 3300050509 Bacteria 14605
190 nmdc:mga0qj67_546585_c1 3300050509 Bacteria 929
191 nmdc:mga06r32_165590_c1 3300050510 Bacteria 2193
192 nmdc:mga08y16_117840_c1 3300050511 Bacteria 2764
193 nmdc:mga0n895_373344_c1 3300050512 Bacteria 1443
194 nmdc:mga0a205_559549_c1 3300050515 Bacteria 998
195 nmdc:mga0a205_78284_c1 3300050515 Bacteria 3194
196 Ga0495655_0000012 3300053083 Bacteria 92485
197 Ga0495595_0067084 3300053084 Bacteria 1691
198 Ga0500641_0001250 3300053096 Bacteria 9041
199 Ga0500628_000014 3300053129 Bacteria 102838
200 Ga0501084_1354429 3300054114 Bacteria 596
201 Ga0501082_0263245 3300060353 Bacteria 1500
202 Ga0530510_0213193 3300061734 Bacteria 1435
203 Ga0466964_0065689
204 JGI25407J50210_10123495
205 JGI25404J52841_10050880
206 Ga0070658_10072550
207 Ga0070658_10256368
208 Ga0070683_100928547
209 Ga0068869_100882590
210 Ga0070666_10437987
211 Ga0070660_100098383
212 Ga0070660_100517209
213 Ga0070661_100336877
214 Ga0070668_100029418
215 Ga0070669_100684431
216 Ga0070700_100689720
217 Ga0070662_100322133
218 Ga0070679_100090177
219 Ga0070679_100548347
220 Ga0070672_101447345
221 Ga0070696_100231352
222 Ga0070704_100238789
223 Ga0068866_10007510
224 Ga0068861_100062800
225 Ga0068863_100004074
226 Ga0068863_100130761
227 Ga0081455_10078343
228 Ga0081538_10010251
229 Ga0081538_10066922
230 Ga0081538_10153635
231 Ga0081540_1000847
232 Ga0075365_10160213
233 Ga0075364_10276771
234 Ga0075432_10004856
235 Ga0070712_100260285
236 Ga0075428_100025013
237 Ga0075428_101104170
238 Ga0075430_100000178
239 Ga0075430_100017374
240 Ga0075430_100521235
241 Ga0075431_100119206
242 Ga0075433_10029347
243 Ga0075433_10719384
244 Ga0075429_100019722
245 Ga0068865_100493681
246 Ga0111539_10013075
247 Ga0111539_10541478
248 Ga0111539_11107563
249 Ga0111539_11109513
250 Ga0111539_11653739
251 Ga0105245_11148840
252 Ga0114129_10179449
253 Ga0114129_11661134
254 Ga0105242_10000010
255 Ga0105242_10811204
256 Ga0105249_10079921
257 Ga0105249_11288697
258 Ga0105239_10068801
259 Ga0105246_10146568
260 Ga0105246_10167281
261 Ga0157374_11539750
262 Ga0163162_10089020
263 Ga0157372_10554555
264 Ga0157372_11282141
265 Ga0163163_11011734
266 Ga0163161_10117304
267 Ga0163161_10471211
268 Ga0213875_10036967
269 Ga0207642_10004351
270 Ga0207705_10196938
271 Ga0207707_10698602
272 Ga0207693_10281530
273 Ga0207657_10006754
274 Ga0207652_10036726
275 Ga0207706_10005706
276 Ga0207706_10399793
277 Ga0207686_10000394
278 Ga0207709_10089497
279 Ga0207709_10658955
280 Ga0207704_11233292
281 Ga0207689_10593810
282 Ga0207712_10005404
283 Ga0207668_10021909
284 Ga0207678_10299772
285 Ga0207708_10634643
286 Ga0207641_10020226
287 Ga0207675_100000816
288 Ga0209983_1086133
289 Ga0207428_10099363
290 Ga0207428_10417704
291 Ga0268265_10137764
292 Ga0307413_10470729
293 Ga0307410_10221792
294 Ga0307410_10648080
295 Ga0307406_10450925
296 Ga0307406_10511247
297 Ga0307407_10456648
298 Ga0307409_100183896
299 Ga0307409_100298723
300 Ga0307414_11026727
301 Ga0307411_10449973
302 Ga0307415_100263360
303 Ga0307415_100829862
304 Ga0373952_0011931
305 Ga0373960_0056814
306 Ga0373962_0016083
307 Ga0373931_0005780
308 Ga0395899_0694016
309 Ga0395900_0112553
310 Ga0395900_0745850
311 Ga0395900_1339768
312 Ga0395898_0184957
313 Ga0395898_0460507
314 Ga0395898_0884324
315 Ga0395905_1099546
316 Ga0436364_0711990
317 Ga0395901_0032163
318 Ga0436362_1268930
319 Ga0451791_0560645
320 Ga0451791_1673806
321 Ga0451802_0525373
322 Ga0451853_3321015
323 Ga0466969_0209810
324 Ga0466966_0036832
325 Ga0466966_0074967
326 Ga0466966_0347917
327 Ga0466961_0004703
328 Ga0466964_0289373
329 Ga0466960_0091326
330 Ga0466960_0430918
331 Ga0466959_0005191
332 Ga0466958_0020140
333 Ga0466958_0063604
334 Ga0466958_0408287
335 Ga0466967_0214017
336 Ga0466967_0708612
337 Ga0495629_0232771
338 Ga0495641_0000048
339 Ga0495639_0032136
340 Ga0495662_0106236
341 Ga0495584_0171931
342 Ga0495584_0478741
343 Ga0495596_0042218
344 Ga0495616_0077887
345 Ga0495631_0092469
346 Ga0495643_0430478
347 Ga0495644_0117770
348 Ga0495656_0001919
349 Ga0495668_0229753
350 Ga0495658_0033646
351 Ga0495670_0052457
352 Ga0495670_0253826
353 Ga0495660_0404703
354 Ga0495676_0006004
355 Ga0495683_0068992
356 Ga0495683_0265221
357 Ga0495673_0059317
358 Ga0495681_0207774
359 Ga0495615_0018839
360 Ga0496100_0005252
361 Ga0496101_0078001
362 Ga0496102_0016530
363 Ga0496104_0199512
364 Ga0496104_1157564
365 Ga0496106_0009203
366 Ga0496106_0399365
367 Ga0496107_0003322
368 Ga0496109_0423650
369 Ga0496110_0295687
370 Ga0496112_0059958
371 Ga0496112_0424680
372 Ga0496113_0242184
373 Ga0496113_1178637
374 Ga0496115_0102504
375 Ga0501036_0276056
376 Ga0501038_0280543
377 Ga0501042_0477032
378 Ga0501042_0810977
379 Ga0501043_0377328
380 Ga0501048_0091647
381 Ga0501067_0322622
382 Ga0501070_0360608
383 Ga0501071_0854528
384 Ga0501076_0271020
385 Ga0501035_0194857
386 nmdc:mga06z11_730061_c1
387 nmdc:mga05p37_10358_c1
388 nmdc:mga09592_18578_c1
389 nmdc:mga09592_856330_c1
390 nmdc:mga0qj67_118451_c1
391 nmdc:mga0qj67_1975_c1
392 nmdc:mga0qj67_546585_c1
393 nmdc:mga06r32_165590_c1
394 nmdc:mga08y16_117840_c1
395 nmdc:mga0n895_373344_c1
396 nmdc:mga0a205_559549_c1
397 nmdc:mga0a205_78284_c1
398 Ga0495655_0000012
399 Ga0495595_0067084
400 Ga0500641_0001250
401 Ga0500628_000014
402 Ga0501084_1354429
403 Ga0501082_0263245
404 Ga0530510_0213193

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00719

Pyrophosphatase

Inorganic pyrophosphatase

10

152

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ude-assembly1.cif.gz_C-2 crystal structure of the inorganic pyrophosphatase from the hyperthermophilic archaeon pyrococcus horikoshii ot3 0.9676 6 154
1qez-assembly1.cif.gz_F sulfolobus acidocaldarius inorganic pyrophosphatase: an archael pyrophosphatase. 0.9594 5 157
2bqy-assembly1.cif.gz_A inorganic pyrophosphatase from the pathogenic bacterium helicobacter pylori-kinetic and structural properties 0.9556 4 159
5ls0-assembly2.cif.gz_B crystal structure of inorganic pyrophosphatase ppa1 from arabidopsis thaliana 0.9541 2 160
3emj-assembly1.cif.gz_F 2.2 a crystal structure of inorganic pyrophosphatase from rickettsia prowazekii (p21 form) 0.9534 3 157
ID Description Score Start End Superfamily
af_A0A1D6HHJ7_152_313_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9617 4 161 3.90.80.10
3emjE00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9556 5 155 3.90.80.10
2prdA00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.951 2 159 3.90.80.10
af_A0A0R0EZ04_29_196_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9397 1 154 3.90.80.10
3q5vB00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9392 1 160 3.90.80.10
ID Description Score Start End GO Terms
AF-A0A7K0PL53-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9842 8 163 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A2H6AJM1-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.981 4 162 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A0W0GJL5-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9799 4 161 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A7Y5XUZ0-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9794 2 161 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A538L0R8-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9787 4 159 GO:0000287
GO:0004427
GO:0005737
GO:0006796

Map