F310044

General Info

Members Datasets Scaffolds Average Seq Length
202 127 404 118

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10030284|Ga0265331_100302844
Length 136
Sequence LAPLVGLAHEIYILYSGYIDNIEAIGAFAALAQGTRLDTFRLLVAREPHGVAAGELARLMSVPQNTMSAHLSILARAGLVNGERQSRSIVYRADLARLRELTLFLLKDCCGGRPEVCAPLIADLAPCCPSKQHADD

Samples

Sample ID Description Type Environment
1 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
8 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
9 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
10 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
11 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
12 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
13 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
14 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
17 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
18 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
20 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
21 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
22 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
32 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
33 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
34 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
35 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
36 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
37 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
38 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
39 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
40 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
41 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
45 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
46 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
47 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
48 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
49 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
50 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
51 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
52 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
53 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
54 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
55 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
56 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
57 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
58 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
59 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
60 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
61 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
62 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
63 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
64 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
65 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
66 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
67 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
68 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
69 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
70 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
71 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
72 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
73 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
74 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
75 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
76 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
88 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
89 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
90 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
91 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
92 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
95 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
99 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
100 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
101 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
102 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
103 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
104 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
105 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
106 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
107 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
108 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
109 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
111 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
112 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
113 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
114 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
115 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
116 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
117 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
118 2643221599 Rhizobium sp. Root708 Isolate Unclassified
119 2643221607 Rhizobium sp. Root73 Isolate Unclassified
120 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
121 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
122 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
123 2751185800 Brucella pituitosa AA2 Isolate Unclassified
124 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
125 2854911287 Brucella lupini LUP21 Isolate Unclassified
126 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
127 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.58
Metatranscriptomes 0
Isolates 8.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.38
Nodule 1.49
Rhizoplane 9.41
Rhizosphere 57.43
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265331_10030284 3300031250 Bacteria 2694
2 JGI25165J46597_1001127 3300003214 Bacteria 16791
3 Ga0055532_1008596 3300003758 Bacteria 1269
4 Ga0055532_1019430 3300003758 Bacteria 717
5 Ga0065704_10080138 3300005289 Bacteria 4002
6 Ga0070674_100510796 3300005356 Bacteria 1002
7 Ga0070706_100670950 3300005467 Bacteria 962
8 Ga0068858_100657989 3300005842 Bacteria 1018
9 Ga0075364_10876483 3300006051 Unclassified 611
10 Ga0070716_100443555 3300006173 Bacteria 944
11 Ga0075366_10251362 3300006195 Bacteria 1078
12 Ga0075370_10063276 3300006353 Bacteria 2109
13 Ga0105237_10052059 3300009545 Bacteria 4111
14 Ga0105238_10758944 3300009551 Bacteria 984
15 Ga0123342_1027598 3300009766 Bacteria 3158
16 Ga0157369_10161120 3300013105 Bacteria 2368
17 Ga0163163_10236591 3300014325 Bacteria 1876
18 Ga0163161_10018419 3300017792 Bacteria 4894
19 Ga0209147_100558 3300025229 Bacteria 20955
20 Ga0209147_100607 3300025229 Bacteria 19587
21 Ga0209437_100023 3300025233 Bacteria 614195
22 Ga0209233_1000219 3300025261 Bacteria 104797
23 Ga0209256_1040648 3300025299 Bacteria 1186
24 Ga0207710_10011812 3300025900 Bacteria 3673
25 Ga0207699_10301258 3300025906 Bacteria 1119
26 Ga0207684_10440769 3300025910 Bacteria 1119
27 Ga0207671_10024052 3300025914 Bacteria 4585
28 Ga0207712_10000054 3300025961 Bacteria 148878
29 Ga0207703_10183830 3300026035 Bacteria 1846
30 Ga0207641_10008688 3300026088 Bacteria 8388
31 Ga0268265_10000182 3300028380 Bacteria 74651
32 Ga0268264_10003017 3300028381 Bacteria 14599
33 Ga0265326_10165187 3300028558 Bacteria 633
34 Ga0265330_10017974 3300031235 Bacteria 3250
35 Ga0265330_10124758 3300031235 Bacteria 1096
36 Ga0265330_10451346 3300031235 Bacteria 546
37 Ga0265328_10000161 3300031239 Bacteria 30818
38 Ga0265328_10006294 3300031239 Bacteria 5040
39 Ga0265328_10011965 3300031239 Bacteria 3460
40 Ga0265328_10058434 3300031239 Bacteria 1416
41 Ga0265329_10018551 3300031242 Bacteria 2377
42 Ga0265339_10017910 3300031249 Bacteria 4186
43 Ga0265331_10002504 3300031250 Bacteria 12403
44 Ga0265331_10008338 3300031250 Bacteria 5900
45 Ga0265327_10001987 3300031251 Bacteria 23267
46 Ga0265327_10005351 3300031251 Bacteria 10746
47 Ga0265327_10009666 3300031251 Bacteria 6916
48 Ga0265327_10025347 3300031251 Bacteria 3460
49 Ga0265327_10139216 3300031251 Bacteria 1135
50 Ga0265327_10266059 3300031251 Bacteria 760
51 Ga0265316_10001452 3300031344 Bacteria 25448
52 Ga0265316_10148605 3300031344 Bacteria 1756
53 Ga0265316_10322736 3300031344 Bacteria 1121
54 Ga0265316_10332051 3300031344 Bacteria 1103
55 Ga0265316_10485005 3300031344 Unclassified 884
56 Ga0307513_10123043 3300031456 Bacteria 2556
57 Ga0307508_10133583 3300031616 Bacteria 2084
58 Ga0265314_10022557 3300031711 Bacteria 4822
59 Ga0265342_10070681 3300031712 Bacteria 2036
60 Ga0265342_10203744 3300031712 Bacteria 1073
61 Ga0265342_10333877 3300031712 Bacteria 792
62 Ga0395900_0259057 3300037418 Bacteria 1738
63 Ga0395905_0005491 3300037471 Bacteria 12933
64 Ga0451833_1356731 3300041491 Bacteria 831
65 Ga0451845_0403096 3300041501 Bacteria 513
66 Ga0466968_0097131 3300044735 Bacteria 1312
67 Ga0495606_0114731 3300046507 Bacteria 1620
68 Ga0495610_0000209 3300046512 Bacteria 64342
69 Ga0495633_0157602 3300046558 Bacteria 1047
70 Ga0495625_0019590 3300046660 Bacteria 5243
71 Ga0495625_0584201 3300046660 Unclassified 673
72 Ga0495661_0359120 3300046665 Bacteria 716
73 Ga0495670_0586351 3300046691 Bacteria 607
74 Ga0495649_0501241 3300046694 Bacteria 604
75 Ga0495681_0309767 3300047470 Bacteria 609
76 Ga0495686_0176428 3300047472 Bacteria 1240
77 Ga0496100_1432863 3300048903 Bacteria 545
78 Ga0496101_0215268 3300048904 Unclassified 1489
79 Ga0496102_0268683 3300048905 Bacteria 1608
80 Ga0496104_0000335 3300048907 Bacteria 42046
81 Ga0496104_0174014 3300048907 Bacteria 2063
82 Ga0496104_0222566 3300048907 Bacteria 1799
83 Ga0496104_0262617 3300048907 Bacteria 1639
84 Ga0496105_0000063 3300048908 Bacteria 84836
85 Ga0496105_0000936 3300048908 Bacteria 19902
86 Ga0496105_0211816 3300048908 Bacteria 1579
87 Ga0496105_1086602 3300048908 Bacteria 594
88 Ga0496110_0007064 3300048913 Bacteria 8934
89 Ga0496112_0019269 3300048915 Bacteria 6436
90 Ga0496112_0840288 3300048915 Bacteria 842
91 Ga0496113_0029361 3300048916 Bacteria 3969
92 Ga0496114_1050451 3300048917 Bacteria 698
93 Ga0496115_0063251 3300048918 Bacteria 2985
94 Ga0496115_0117578 3300048918 Bacteria 2187
95 Ga0496115_0743730 3300048918 Bacteria 767
96 Ga0496116_0014077 3300048919 Bacteria 6408
97 Ga0496116_0114254 3300048919 Bacteria 1577
98 Ga0496117_0012723 3300048920 Bacteria 7388
99 Ga0496117_0027352 3300048920 Bacteria 4446
100 Ga0496118_0005711 3300048921 Bacteria 14007
101 Ga0496118_0007812 3300048921 Bacteria 11222
102 Ga0496119_0000716 3300048922 Bacteria 44603
103 Ga0496119_0002914 3300048922 Bacteria 18267
104 Ga0496119_0144828 3300048922 Bacteria 1279
105 Ga0496119_0219337 3300048922 Bacteria 974
106 Ga0496119_0544203 3300048922 Bacteria 535
107 Ga0496121_0117964 3300048924 Bacteria 2010
108 Ga0496122_0266752 3300048925 Bacteria 946
109 Ga0496123_0009272 3300048926 Bacteria 8885
110 Ga0496124_0000072 3300048927 Bacteria 219914
111 Ga0496124_0012901 3300048927 Bacteria 8203
112 Ga0496124_0148735 3300048927 Bacteria 1840
113 Ga0496124_0239611 3300048927 Bacteria 1350
114 Ga0496125_0012254 3300048928 Bacteria 8525
115 Ga0496125_0153231 3300048928 Bacteria 1579
116 Ga0496125_0203920 3300048928 Bacteria 1291
117 Ga0496125_0376949 3300048928 Bacteria 838
118 Ga0496126_0094332 3300048929 Bacteria 2626
119 Ga0496126_0129690 3300048929 Bacteria 2180
120 Ga0496126_0541898 3300048929 Unclassified 925
121 Ga0496126_1039691 3300048929 Bacteria 612
122 Ga0501031_0058205 3300049568 Bacteria 2518
123 Ga0501032_0000051 3300049569 Bacteria 101366
124 Ga0501032_0001660 3300049569 Bacteria 17671
125 Ga0501033_0000251 3300049570 Bacteria 51944
126 Ga0501033_0000921 3300049570 Bacteria 26896
127 Ga0501033_0001605 3300049570 Bacteria 19872
128 Ga0501033_0014839 3300049570 Bacteria 5914
129 Ga0501034_0000094 3300049571 Bacteria 163124
130 Ga0501034_0000832 3300049571 Bacteria 45898
131 Ga0501034_0829130 3300049571 Bacteria 816
132 Ga0501036_0000241 3300049572 Bacteria 36896
133 Ga0501036_0000503 3300049572 Bacteria 28006
134 Ga0501036_0202109 3300049572 Bacteria 1671
135 Ga0501037_0000028 3300049573 Bacteria 139838
136 Ga0501037_0000057 3300049573 Bacteria 107920
137 Ga0501037_0071447 3300049573 Bacteria 2524
138 Ga0501038_0002261 3300049574 Bacteria 17909
139 Ga0501038_0013669 3300049574 Bacteria 7399
140 Ga0501038_0068611 3300049574 Bacteria 3013
141 Ga0501039_0000143 3300049575 Bacteria 48809
142 Ga0501039_0000226 3300049575 Bacteria 41251
143 Ga0501039_0214469 3300049575 Bacteria 1514
144 Ga0501043_0000028 3300049579 Bacteria 144125
145 Ga0501043_0000040 3300049579 Bacteria 117024
146 Ga0501043_0002263 3300049579 Bacteria 16366
147 Ga0501046_0000223 3300049580 Bacteria 59026
148 Ga0501046_0034458 3300049580 Bacteria 4085
149 Ga0501047_0002192 3300049581 Bacteria 18696
150 Ga0501047_0230441 3300049581 Bacteria 1706
151 Ga0501047_0414505 3300049581 Bacteria 1179
152 Ga0501047_1171977 3300049581 Bacteria 582
153 Ga0501068_0052348 3300049584 Bacteria 2470
154 Ga0501069_0000014 3300049585 Bacteria 146321
155 Ga0501070_0000658 3300049586 Bacteria 31844
156 Ga0501070_0769872 3300049586 Bacteria 757
157 Ga0501071_0036056 3300049587 Bacteria 3526
158 Ga0501074_0000004 3300049590 Bacteria 114255
159 Ga0501079_0138466 3300049741 Bacteria 1896
160 Ga0501080_0000728 3300049742 Bacteria 26548
161 Ga0501083_0000025 3300049744 Bacteria 121349
162 Ga0501282_002900 3300049778 Bacteria 1857
163 Ga0501035_0000154 3300049822 Bacteria 84548
164 Ga0501035_0000891 3300049822 Bacteria 31604
165 Ga0501035_0004935 3300049822 Bacteria 12655
166 Ga0501035_0500440 3300049822 Bacteria 1000
167 Ga0501044_0000052 3300049823 Bacteria 143626
168 Ga0501044_0006091 3300049823 Bacteria 13308
169 Ga0501044_0136149 3300049823 Bacteria 2447
170 Ga0501044_0844022 3300049823 Bacteria 793
171 nmdc:mga0k408_79218_c1 3300050493 Bacteria 1922
172 nmdc:mga0k408_88000_c1 3300050493 Bacteria 1824
173 Ga0500643_044611 3300053087 Bacteria 1287
174 Ga0500555_051234 3300053103 Bacteria 1129
175 Ga0500607_000064 3300053121 Bacteria 74482
176 Ga0500608_096576 3300053122 Bacteria 1374
177 Ga0500618_027100 3300053125 Bacteria 1364
178 Ga0500655_057467 3300053133 Bacteria 780
179 Ga0500559_0000785 3300053136 Bacteria 20781
180 Ga0500564_025111 3300053138 Bacteria 2737
181 Ga0500590_002542 3300053148 Bacteria 8144
182 Ga0500637_0001449 3300053178 Bacteria 10091
183 Ga0500645_004687 3300053730 Bacteria 5196
184 Ga0500645_036230 3300053730 Bacteria 1468
185 Ga0501082_0092273 3300060353 Bacteria 2616
186 2510842735 2510461069 Bacteria 5505000
187 2513599445 2513237088 Bacteria 6927906
188 2535520766 2534681796 Bacteria 7146037
189 2585228613 2582581299 Bacteria 6518058
190 2585269964 2582581306 Bacteria 6450535
191 2585389669 2582581865 Bacteria 6644329
192 2585395597 2582581866 Bacteria 6859583
193 2644004960 2643221599 Bacteria 6292121
194 2644050141 2643221607 Bacteria 6314006
195 2644204800 2643221636 Bacteria 6583769
196 2644483062 2643221686 Bacteria 6310811
197 2644502462 2643221689 Bacteria 6042950
198 2753361023 2751185800 Bacteria 5467370
199 2847947590 2847939898 Bacteria 8606328
200 2854915454 2854911287 Bacteria 5582813
201 2919451476 2919450847 Bacteria 5631160
202 8005548538 8005542996 Bacteria 7077758
203 Ga0265331_10030284
204 JGI25165J46597_1001127
205 Ga0055532_1008596
206 Ga0055532_1019430
207 Ga0065704_10080138
208 Ga0070674_100510796
209 Ga0070706_100670950
210 Ga0068858_100657989
211 Ga0075364_10876483
212 Ga0070716_100443555
213 Ga0075366_10251362
214 Ga0075370_10063276
215 Ga0105237_10052059
216 Ga0105238_10758944
217 Ga0123342_1027598
218 Ga0157369_10161120
219 Ga0163163_10236591
220 Ga0163161_10018419
221 Ga0209147_100558
222 Ga0209147_100607
223 Ga0209437_100023
224 Ga0209233_1000219
225 Ga0209256_1040648
226 Ga0207710_10011812
227 Ga0207699_10301258
228 Ga0207684_10440769
229 Ga0207671_10024052
230 Ga0207712_10000054
231 Ga0207703_10183830
232 Ga0207641_10008688
233 Ga0268265_10000182
234 Ga0268264_10003017
235 Ga0265326_10165187
236 Ga0265330_10017974
237 Ga0265330_10124758
238 Ga0265330_10451346
239 Ga0265328_10000161
240 Ga0265328_10006294
241 Ga0265328_10011965
242 Ga0265328_10058434
243 Ga0265329_10018551
244 Ga0265339_10017910
245 Ga0265331_10002504
246 Ga0265331_10008338
247 Ga0265327_10001987
248 Ga0265327_10005351
249 Ga0265327_10009666
250 Ga0265327_10025347
251 Ga0265327_10139216
252 Ga0265327_10266059
253 Ga0265316_10001452
254 Ga0265316_10148605
255 Ga0265316_10322736
256 Ga0265316_10332051
257 Ga0265316_10485005
258 Ga0307513_10123043
259 Ga0307508_10133583
260 Ga0265314_10022557
261 Ga0265342_10070681
262 Ga0265342_10203744
263 Ga0265342_10333877
264 Ga0395900_0259057
265 Ga0395905_0005491
266 Ga0451833_1356731
267 Ga0451845_0403096
268 Ga0466968_0097131
269 Ga0495606_0114731
270 Ga0495610_0000209
271 Ga0495633_0157602
272 Ga0495625_0019590
273 Ga0495625_0584201
274 Ga0495661_0359120
275 Ga0495670_0586351
276 Ga0495649_0501241
277 Ga0495681_0309767
278 Ga0495686_0176428
279 Ga0496100_1432863
280 Ga0496101_0215268
281 Ga0496102_0268683
282 Ga0496104_0000335
283 Ga0496104_0174014
284 Ga0496104_0222566
285 Ga0496104_0262617
286 Ga0496105_0000063
287 Ga0496105_0000936
288 Ga0496105_0211816
289 Ga0496105_1086602
290 Ga0496110_0007064
291 Ga0496112_0019269
292 Ga0496112_0840288
293 Ga0496113_0029361
294 Ga0496114_1050451
295 Ga0496115_0063251
296 Ga0496115_0117578
297 Ga0496115_0743730
298 Ga0496116_0014077
299 Ga0496116_0114254
300 Ga0496117_0012723
301 Ga0496117_0027352
302 Ga0496118_0005711
303 Ga0496118_0007812
304 Ga0496119_0000716
305 Ga0496119_0002914
306 Ga0496119_0144828
307 Ga0496119_0219337
308 Ga0496119_0544203
309 Ga0496121_0117964
310 Ga0496122_0266752
311 Ga0496123_0009272
312 Ga0496124_0000072
313 Ga0496124_0012901
314 Ga0496124_0148735
315 Ga0496124_0239611
316 Ga0496125_0012254
317 Ga0496125_0153231
318 Ga0496125_0203920
319 Ga0496125_0376949
320 Ga0496126_0094332
321 Ga0496126_0129690
322 Ga0496126_0541898
323 Ga0496126_1039691
324 Ga0501031_0058205
325 Ga0501032_0000051
326 Ga0501032_0001660
327 Ga0501033_0000251
328 Ga0501033_0000921
329 Ga0501033_0001605
330 Ga0501033_0014839
331 Ga0501034_0000094
332 Ga0501034_0000832
333 Ga0501034_0829130
334 Ga0501036_0000241
335 Ga0501036_0000503
336 Ga0501036_0202109
337 Ga0501037_0000028
338 Ga0501037_0000057
339 Ga0501037_0071447
340 Ga0501038_0002261
341 Ga0501038_0013669
342 Ga0501038_0068611
343 Ga0501039_0000143
344 Ga0501039_0000226
345 Ga0501039_0214469
346 Ga0501043_0000028
347 Ga0501043_0000040
348 Ga0501043_0002263
349 Ga0501046_0000223
350 Ga0501046_0034458
351 Ga0501047_0002192
352 Ga0501047_0230441
353 Ga0501047_0414505
354 Ga0501047_1171977
355 Ga0501068_0052348
356 Ga0501069_0000014
357 Ga0501070_0000658
358 Ga0501070_0769872
359 Ga0501071_0036056
360 Ga0501074_0000004
361 Ga0501079_0138466
362 Ga0501080_0000728
363 Ga0501083_0000025
364 Ga0501282_002900
365 Ga0501035_0000154
366 Ga0501035_0000891
367 Ga0501035_0004935
368 Ga0501035_0500440
369 Ga0501044_0000052
370 Ga0501044_0006091
371 Ga0501044_0136149
372 Ga0501044_0844022
373 nmdc:mga0k408_79218_c1
374 nmdc:mga0k408_88000_c1
375 Ga0500643_044611
376 Ga0500555_051234
377 Ga0500607_000064
378 Ga0500608_096576
379 Ga0500618_027100
380 Ga0500655_057467
381 Ga0500559_0000785
382 Ga0500564_025111
383 Ga0500590_002542
384 Ga0500637_0001449
385 Ga0500645_004687
386 Ga0500645_036230
387 Ga0501082_0092273
388 2510842735
389 2513599445
390 2535520766
391 2585228613
392 2585269964
393 2585389669
394 2585395597
395 2644004960
396 2644050141
397 2644204800
398 2644483062
399 2644502462
400 2753361023
401 2847947590
402 2854915454
403 2919451476
404 8005548538

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

31

83

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9609 1 87
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9521 1 95
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9393 34 75
5zup-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.925 35 75
8iuh-assembly1.cif.gz_P rna polymerase iii pre-initiation complex open complex 1 0.9205 18 75
ID Description Score Start End Superfamily
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.963 13 78 1.10.10.10
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9504 15 74 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9493 16 75 1.10.10.10
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9477 15 75 1.10.10.10
af_B4FTK6_47_112_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9463 15 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7V6PBP3-F1-model_v4 Helix-turn-helix transcriptional regulator 1.005 1 87 GO:0003700
AF-A0A0T6ZY28-F1-model_v4 HTH arsR-type domain-containing protein 0.9922 1 80 GO:0003700
AF-A0A1F3YRF7-F1-model_v4 Transcriptional regulator 0.992 1 87 GO:0003700
AF-A0A6J5FVZ8-F1-model_v4 HTH arsR-type domain-containing protein 0.9908 1 94 GO:0003700
AF-A0A501XED1-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9898 1 95 GO:0003700

Map