F309999

General Info

Members Datasets Scaffolds Average Seq Length
202 156 404 489

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10061178|Ga0207428_100611783
Length 518
Sequence VTNHVQNETACKDADCGLFALARSAEVKAQAKIASPPLDPSDDEWIDDAPLYEARRKIYPQRVSGTYRRIKWAVLFITLGIYYFTPFLRWDRGPNAPGQAVLIDLPNSRFYFFFIEIWPQEVYYLTGLLIIAAMTLFLMNALAGRIWCGYLCPQTVWTDLFQTIERWCEGDRREHLVRDRGGWTAERVARAGAKHFLWLMVAWWTGGAWVLYFADAPTLVRDLATLHAPFVAYLWIGILTFTTYVLAGHMREQVCLYMCPWPRIQAALTDEHALNVTYRYDRGEPRGSVKKSTALRAQGLPSGDCVDCLQCVHVCPTGVDIRQGADLGXXXXGLCIDACDAVMTKIGRPTRLIAYDTDLSIKDRQEGRSTIHRFVRMRTALYVAIIAAVGGVMTFALATRNAQGISVIHDRNPIFVRLSDGALRNAYTVRISNKRSERREFTLSISGLSGSLLDIVQTRPDGRFVVEVGPDQTREVRVLVTDYADMPPASTPITFHLYDVLTGERASAGDYFRAPAGG

Samples

Sample ID Description Type Environment
1 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
41 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
55 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
56 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
57 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
62 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
66 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
67 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
68 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
69 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
70 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
71 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
81 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
82 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
109 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
110 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
111 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
149 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
152 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.91
Nodule 0.5
Rhizoplane 5.94
Rhizosphere 83.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207428_10061178 3300027907 Bacteria 2982
2 ARcpr5oldR_c000042 3300000041 Bacteria 23802
3 JGI25153J46596_10004299 3300003215 Bacteria 7700
4 JGI25404J52841_10002251 3300003659 Bacteria 3626
5 Ga0065165_1000879 3300005262 Bacteria 38853
6 Ga0065712_10006371 3300005290 Bacteria 3918
7 Ga0065707_10003309 3300005295 Bacteria 4061
8 Ga0070658_10015472 3300005327 Bacteria 6104
9 Ga0070690_100018873 3300005330 Bacteria 4175
10 Ga0070670_100106759 3300005331 Bacteria 2413
11 Ga0068869_100102245 3300005334 Bacteria 2169
12 Ga0070680_100027280 3300005336 Bacteria 4573
13 Ga0070689_100015963 3300005340 Bacteria 5489
14 Ga0070689_100046545 3300005340 Bacteria 3343
15 Ga0070689_100097661 3300005340 Bacteria 2323
16 Ga0070674_100005984 3300005356 Bacteria 7071
17 Ga0070673_100043538 3300005364 Bacteria 3470
18 Ga0070667_100052389 3300005367 Bacteria 3444
19 Ga0070713_100069111 3300005436 Bacteria 2978
20 Ga0070679_100047017 3300005530 Bacteria 4302
21 Ga0070672_100070409 3300005543 Bacteria 2779
22 Ga0081540_1001075 3300005983 Bacteria 24254
23 Ga0075368_10030311 3300006042 Bacteria 2094
24 Ga0075363_100025452 3300006048 Bacteria 3019
25 Ga0075367_10013763 3300006178 Bacteria 4361
26 Ga0075366_10001773 3300006195 Bacteria 10889
27 Ga0075366_10003257 3300006195 Bacteria 8534
28 Ga0075428_100001655 3300006844 Bacteria 23712
29 Ga0075431_100000499 3300006847 Bacteria 32706
30 Ga0075431_100129996 3300006847 Bacteria 2598
31 Ga0075434_100086512 3300006871 Bacteria 3134
32 Ga0075429_100000711 3300006880 Bacteria 26042
33 Ga0111539_10001595 3300009094 Bacteria 30229
34 Ga0111539_10109711 3300009094 Bacteria 3238
35 Ga0114129_10000066 3300009147 Bacteria 93802
36 Ga0105248_10122392 3300009177 Bacteria 2935
37 Ga0105237_10070350 3300009545 Bacteria 3495
38 Ga0105249_10062556 3300009553 Bacteria 3417
39 Ga0105239_10074511 3300010375 Bacteria 3732
40 Ga0105246_10060898 3300011119 Bacteria 2624
41 Ga0157372_10196693 3300013307 Bacteria 2335
42 Ga0157376_10038294 3300014969 Bacteria 3900
43 Ga0209130_1000127 3300025284 Bacteria 123652
44 Ga0209025_1013395 3300025294 Bacteria 5158
45 Ga0209758_1000079 3300025297 Bacteria 262874
46 Ga0209758_1024853 3300025297 Bacteria 2652
47 Ga0209256_1000234 3300025299 Bacteria 99080
48 Ga0207692_10064480 3300025898 Bacteria 1908
49 Ga0207707_10027913 3300025912 Bacteria 4935
50 Ga0207694_10007061 3300025924 Bacteria 8526
51 Ga0207700_10087959 3300025928 Bacteria 2444
52 Ga0207706_10146215 3300025933 Bacteria 2079
53 Ga0207691_10007024 3300025940 Bacteria 10862
54 Ga0207679_10036415 3300025945 Bacteria 3490
55 Ga0207651_10004094 3300025960 Bacteria 7275
56 Ga0207683_10001414 3300026121 Bacteria 21696
57 Ga0207698_10027458 3300026142 Bacteria 4041
58 Ga0207428_10039693 3300027907 Bacteria 3822
59 Ga0265318_10009150 3300028577 Bacteria 4372
60 Ga0265338_10131169 3300028800 Bacteria 1978
61 Ga0265330_10009675 3300031235 Bacteria 4570
62 Ga0265320_10014076 3300031240 Bacteria 4573
63 Ga0265329_10018586 3300031242 Bacteria 2374
64 Ga0265340_10021319 3300031247 Bacteria 3324
65 Ga0265339_10039548 3300031249 Bacteria 2625
66 Ga0265313_10012764 3300031595 Bacteria 5100
67 Ga0265314_10003954 3300031711 Bacteria 14051
68 Ga0265342_10008949 3300031712 Bacteria 7112
69 Ga0316578_10007287 3300031728 Bacteria 5535
70 Ga0307406_10060344 3300031901 Bacteria 2445
71 Ga0373923_0022529 3300035111 Bacteria 2471
72 Ga0373953_0027274 3300035117 Bacteria 2194
73 Ga0373954_0005379 3300035118 Bacteria 5534
74 Ga0373956_0023650 3300035119 Bacteria 2638
75 Ga0373957_0027637 3300035120 Bacteria 2062
76 Ga0373943_0013209 3300035170 Bacteria 3726
77 Ga0373943_0057423 3300035170 Bacteria 1934
78 Ga0373946_0007231 3300035171 Bacteria 4052
79 Ga0373924_0003220 3300035410 Bacteria 5586
80 Ga0373931_0024163 3300035691 Bacteria 3075
81 Ga0373927_0061325 3300035695 Bacteria 2433
82 Ga0373933_0002604 3300035724 Bacteria 10107
83 Ga0373933_0002948 3300035724 Bacteria 9489
84 Ga0373933_0120355 3300035724 Bacteria 1644
85 Ga0373947_0007511 3300035725 Bacteria 6306
86 Ga0373947_0078124 3300035725 Bacteria 2042
87 Ga0373937_0027551 3300036401 Bacteria 5139
88 Ga0373937_0045735 3300036401 Bacteria 4000
89 Ga0373937_0055796 3300036401 Bacteria 3627
90 Ga0373937_0094557 3300036401 Bacteria 2771
91 Ga0373925_0047373 3300037068 Bacteria 3199
92 Ga0373925_0048776 3300037068 Bacteria 3156
93 Ga0373925_0068017 3300037068 Bacteria 2687
94 Ga0395905_0025913 3300037471 Bacteria 5527
95 Ga0436365_1849927 3300039437 Bacteria 23122
96 Ga0436360_0845404 3300039438 Bacteria 3925
97 Ga0439448_0005627 3300042005 Bacteria 3574
98 Ga0439460_0031179 3300042461 Bacteria 1520
99 Ga0466957_0082753 3300044842 Bacteria 2001
100 Ga0466958_0074874 3300045836 Bacteria 2076
101 Ga0495592_0068361 3300046454 Bacteria 2594
102 Ga0495603_0051597 3300046455 Bacteria 2444
103 Ga0495629_0004927 3300046459 Bacteria 10021
104 Ga0495638_0008735 3300046460 Bacteria 7159
105 Ga0495651_0002915 3300046462 Bacteria 13241
106 Ga0495651_0024213 3300046462 Bacteria 4724
107 Ga0495651_0032482 3300046462 Bacteria 4071
108 Ga0495651_0064639 3300046462 Bacteria 2796
109 Ga0495653_0001455 3300046463 Bacteria 18466
110 Ga0495580_0037065 3300046472 Bacteria 3501
111 Ga0495639_0022679 3300046475 Bacteria 2755
112 Ga0495662_0019823 3300046476 Bacteria 3253
113 Ga0495664_0029655 3300046477 Bacteria 3201
114 Ga0495584_0023307 3300046491 Bacteria 3139
115 Ga0495608_0000784 3300046511 Bacteria 22293
116 Ga0495618_0001072 3300046514 Bacteria 18673
117 Ga0495628_0020682 3300046516 Bacteria 5425
118 Ga0495630_0043970 3300046517 Bacteria 3338
119 Ga0495666_0034351 3300046526 Bacteria 2475
120 Ga0495652_0007117 3300046529 Bacteria 10321
121 Ga0495652_0110779 3300046529 Bacteria 2208
122 Ga0495652_0146822 3300046529 Bacteria 1848
123 Ga0495640_0007180 3300046533 Bacteria 8774
124 Ga0495587_0003852 3300046536 Bacteria 9958
125 Ga0495587_0119374 3300046536 Bacteria 1511
126 Ga0495621_0003361 3300046539 Bacteria 4413
127 Ga0495667_0003373 3300046559 Bacteria 10686
128 Ga0495667_0039019 3300046559 Bacteria 3161
129 Ga0495634_0018040 3300046642 Bacteria 5029
130 Ga0495634_0039138 3300046642 Bacteria 3230
131 Ga0495635_0002896 3300046663 Bacteria 11783
132 Ga0495588_0043064 3300046674 Bacteria 2309
133 Ga0495657_0013358 3300046675 Bacteria 6063
134 Ga0495599_0005770 3300046678 Bacteria 7428
135 Ga0495623_0005134 3300046679 Bacteria 8594
136 Ga0495646_0006409 3300046680 Bacteria 7463
137 Ga0495613_0019136 3300046689 Bacteria 5104
138 Ga0495613_0038689 3300046689 Bacteria 3535
139 Ga0495613_0148116 3300046689 Bacteria 1675
140 Ga0495613_0195023 3300046689 Bacteria 1430
141 Ga0495624_0061762 3300046690 Bacteria 2346
142 Ga0495600_0010087 3300046809 Bacteria 5856
143 Ga0495604_0003257 3300047317 Bacteria 12971
144 Ga0495604_0051442 3300047317 Bacteria 3193
145 Ga0495674_0007146 3300047319 Bacteria 10682
146 Ga0495674_0048564 3300047319 Bacteria 3755
147 Ga0495674_0245346 3300047319 Bacteria 1475
148 Ga0495676_0076195 3300047321 Bacteria 2562
149 Ga0495680_0002249 3300047322 Bacteria 19912
150 Ga0495680_0016682 3300047322 Bacteria 6302
151 Ga0495675_0001493 3300047444 Bacteria 14166
152 Ga0495684_0004796 3300047471 Bacteria 10560
153 Ga0495602_0003864 3300048088 Bacteria 15585
154 Ga0496101_0050135 3300048904 Bacteria 3004
155 Ga0496104_0000410 3300048907 Bacteria 37646
156 Ga0496104_0020535 3300048907 Bacteria 6055
157 Ga0496104_0085924 3300048907 Bacteria 3003
158 Ga0496105_0000495 3300048908 Bacteria 25974
159 Ga0496107_0077001 3300048910 Bacteria 2429
160 Ga0496109_0006125 3300048912 Bacteria 10106
161 Ga0496110_0106185 3300048913 Bacteria 2519
162 Ga0496111_0003432 3300048914 Bacteria 9803
163 Ga0496112_0024037 3300048915 Bacteria 5831
164 Ga0496112_0207728 3300048915 Bacteria 1916
165 Ga0496113_0010015 3300048916 Bacteria 6250
166 Ga0496125_0001748 3300048928 Bacteria 30160
167 Ga0501039_0049899 3300049575 Bacteria 3237
168 Ga0501072_0001145 3300049588 Bacteria 19701
169 Ga0501077_0007676 3300049593 Bacteria 6658
170 Ga0501081_0010736 3300049743 Bacteria 5980
171 Ga0501044_0099279 3300049823 Bacteria 2930
172 nmdc:mga0k408_19775_c1 3300050493 Bacteria 3767
173 nmdc:mga04h51_16208_c1 3300050495 Bacteria 2160
174 nmdc:mga05p37_879_c1 3300050507 Bacteria 33833
175 nmdc:mga09592_697_c1 3300050508 Bacteria 25685
176 nmdc:mga06r32_394_c1 3300050510 Bacteria 36886
177 nmdc:mga06r32_92076_c1 3300050510 Bacteria 2963
178 nmdc:mga08y16_91701_c1 3300050511 Bacteria 3166
179 nmdc:mga08y16_9178_c1 3300050511 Bacteria 10382
180 nmdc:mga0n895_27655_c1 3300050512 Bacteria 5390
181 nmdc:mga0a205_30591_c1 3300050515 Bacteria 5156
182 nmdc:mga0sz30_7013_c1 3300050516 Bacteria 4211
183 Ga0495601_0003424 3300053077 Bacteria 9093
184 Ga0495601_0004210 3300053077 Bacteria 8299
185 Ga0495601_0011774 3300053077 Bacteria 5244
186 Ga0495601_0013720 3300053077 Bacteria 4875
187 Ga0495612_0005437 3300053078 Bacteria 5265
188 Ga0495612_0014487 3300053078 Bacteria 3171
189 Ga0495612_0046592 3300053078 Bacteria 1776
190 Ga0495595_0000423 3300053084 Bacteria 16023
191 Ga0495595_0034339 3300053084 Bacteria 2293
192 Ga0495619_0002385 3300053085 Bacteria 12343
193 Ga0495619_0033157 3300053085 Bacteria 3353
194 Ga0495619_0089458 3300053085 Bacteria 2083
195 Ga0495619_0117374 3300053085 Bacteria 1822
196 Ga0500646_0006624 3300053090 Bacteria 2948
197 Ga0500595_001112 3300053119 Bacteria 14932
198 Ga0500616_0037668 3300053153 Bacteria 2617
199 Ga0501084_0015140 3300054114 Bacteria 6395
200 Ga0501084_0057028 3300054114 Bacteria 3269
201 Ga0501082_0010453 3300060353 Bacteria 7986
202 2513590261 2513237087 Bacteria 5817514
203 Ga0207428_10061178
204 ARcpr5oldR_c000042
205 JGI25153J46596_10004299
206 JGI25404J52841_10002251
207 Ga0065165_1000879
208 Ga0065712_10006371
209 Ga0065707_10003309
210 Ga0070658_10015472
211 Ga0070690_100018873
212 Ga0070670_100106759
213 Ga0068869_100102245
214 Ga0070680_100027280
215 Ga0070689_100015963
216 Ga0070689_100046545
217 Ga0070689_100097661
218 Ga0070674_100005984
219 Ga0070673_100043538
220 Ga0070667_100052389
221 Ga0070713_100069111
222 Ga0070679_100047017
223 Ga0070672_100070409
224 Ga0081540_1001075
225 Ga0075368_10030311
226 Ga0075363_100025452
227 Ga0075367_10013763
228 Ga0075366_10001773
229 Ga0075366_10003257
230 Ga0075428_100001655
231 Ga0075431_100000499
232 Ga0075431_100129996
233 Ga0075434_100086512
234 Ga0075429_100000711
235 Ga0111539_10001595
236 Ga0111539_10109711
237 Ga0114129_10000066
238 Ga0105248_10122392
239 Ga0105237_10070350
240 Ga0105249_10062556
241 Ga0105239_10074511
242 Ga0105246_10060898
243 Ga0157372_10196693
244 Ga0157376_10038294
245 Ga0209130_1000127
246 Ga0209025_1013395
247 Ga0209758_1000079
248 Ga0209758_1024853
249 Ga0209256_1000234
250 Ga0207692_10064480
251 Ga0207707_10027913
252 Ga0207694_10007061
253 Ga0207700_10087959
254 Ga0207706_10146215
255 Ga0207691_10007024
256 Ga0207679_10036415
257 Ga0207651_10004094
258 Ga0207683_10001414
259 Ga0207698_10027458
260 Ga0207428_10039693
261 Ga0265318_10009150
262 Ga0265338_10131169
263 Ga0265330_10009675
264 Ga0265320_10014076
265 Ga0265329_10018586
266 Ga0265340_10021319
267 Ga0265339_10039548
268 Ga0265313_10012764
269 Ga0265314_10003954
270 Ga0265342_10008949
271 Ga0316578_10007287
272 Ga0307406_10060344
273 Ga0373923_0022529
274 Ga0373953_0027274
275 Ga0373954_0005379
276 Ga0373956_0023650
277 Ga0373957_0027637
278 Ga0373943_0013209
279 Ga0373943_0057423
280 Ga0373946_0007231
281 Ga0373924_0003220
282 Ga0373931_0024163
283 Ga0373927_0061325
284 Ga0373933_0002604
285 Ga0373933_0002948
286 Ga0373933_0120355
287 Ga0373947_0007511
288 Ga0373947_0078124
289 Ga0373937_0027551
290 Ga0373937_0045735
291 Ga0373937_0055796
292 Ga0373937_0094557
293 Ga0373925_0047373
294 Ga0373925_0048776
295 Ga0373925_0068017
296 Ga0395905_0025913
297 Ga0436365_1849927
298 Ga0436360_0845404
299 Ga0439448_0005627
300 Ga0439460_0031179
301 Ga0466957_0082753
302 Ga0466958_0074874
303 Ga0495592_0068361
304 Ga0495603_0051597
305 Ga0495629_0004927
306 Ga0495638_0008735
307 Ga0495651_0002915
308 Ga0495651_0024213
309 Ga0495651_0032482
310 Ga0495651_0064639
311 Ga0495653_0001455
312 Ga0495580_0037065
313 Ga0495639_0022679
314 Ga0495662_0019823
315 Ga0495664_0029655
316 Ga0495584_0023307
317 Ga0495608_0000784
318 Ga0495618_0001072
319 Ga0495628_0020682
320 Ga0495630_0043970
321 Ga0495666_0034351
322 Ga0495652_0007117
323 Ga0495652_0110779
324 Ga0495652_0146822
325 Ga0495640_0007180
326 Ga0495587_0003852
327 Ga0495587_0119374
328 Ga0495621_0003361
329 Ga0495667_0003373
330 Ga0495667_0039019
331 Ga0495634_0018040
332 Ga0495634_0039138
333 Ga0495635_0002896
334 Ga0495588_0043064
335 Ga0495657_0013358
336 Ga0495599_0005770
337 Ga0495623_0005134
338 Ga0495646_0006409
339 Ga0495613_0019136
340 Ga0495613_0038689
341 Ga0495613_0148116
342 Ga0495613_0195023
343 Ga0495624_0061762
344 Ga0495600_0010087
345 Ga0495604_0003257
346 Ga0495604_0051442
347 Ga0495674_0007146
348 Ga0495674_0048564
349 Ga0495674_0245346
350 Ga0495676_0076195
351 Ga0495680_0002249
352 Ga0495680_0016682
353 Ga0495675_0001493
354 Ga0495684_0004796
355 Ga0495602_0003864
356 Ga0496101_0050135
357 Ga0496104_0000410
358 Ga0496104_0020535
359 Ga0496104_0085924
360 Ga0496105_0000495
361 Ga0496107_0077001
362 Ga0496109_0006125
363 Ga0496110_0106185
364 Ga0496111_0003432
365 Ga0496112_0024037
366 Ga0496112_0207728
367 Ga0496113_0010015
368 Ga0496125_0001748
369 Ga0501039_0049899
370 Ga0501072_0001145
371 Ga0501077_0007676
372 Ga0501081_0010736
373 Ga0501044_0099279
374 nmdc:mga0k408_19775_c1
375 nmdc:mga04h51_16208_c1
376 nmdc:mga05p37_879_c1
377 nmdc:mga09592_697_c1
378 nmdc:mga06r32_394_c1
379 nmdc:mga06r32_92076_c1
380 nmdc:mga08y16_91701_c1
381 nmdc:mga08y16_9178_c1
382 nmdc:mga0n895_27655_c1
383 nmdc:mga0a205_30591_c1
384 nmdc:mga0sz30_7013_c1
385 Ga0495601_0003424
386 Ga0495601_0004210
387 Ga0495601_0011774
388 Ga0495601_0013720
389 Ga0495612_0005437
390 Ga0495612_0014487
391 Ga0495612_0046592
392 Ga0495595_0000423
393 Ga0495595_0034339
394 Ga0495619_0002385
395 Ga0495619_0033157
396 Ga0495619_0089458
397 Ga0495619_0117374
398 Ga0500646_0006624
399 Ga0500595_001112
400 Ga0500616_0037668
401 Ga0501084_0015140
402 Ga0501084_0057028
403 Ga0501082_0010453
404 2513590261

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13746

Fer4_18

4Fe-4S dicluster domain

250

358

0.91

PF11614

FixG_C

IG-like fold at C-terminal of FixG, putative oxidoreductase

393

515

0.89

PF12801

Fer4_5

4Fe-4S binding domain

125

169

0.87

Map