F309924

General Info

Members Datasets Scaffolds Average Seq Length
202 115 404 380

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10175365|Ga0207645_101753651
Length 401
Sequence VTPAARLQAAIEVLDEVIAAARDDGPPADSIVTRYFKQRRYAGSKDRRAVRELVFRAIRRSAERPESGRAAILGLGDDDAELSPLFGEPRGPEPIAENEPTAAPGLVPAWLVPELSPVIRKEEWPALLERAPLDLRVNVARISRDELVKQFEGAVATPHSPWGIRLPPDSRIDDHPAYQQGLVEVQDEGSQLIVLACDPKADEQILDLCAGAGGKSLALAAAAAPGAHILATDSNRARLAKLPARAERAGTNIETRLVNPPKELAELSDWHAKADLVLIDAPCSGTGTLRRHPDIAWLKDEEDVGRLTLTQDRLLVRAADLLKPGGTLVYAVCSLQEDEGVARLEALLARDNRLQRMPVEPAELPGLANAVTPAGDVRTLPSMWAERGGMDGFYIARLQKS

Samples

Sample ID Description Type Environment
1 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 4.95
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207645_10175365 3300025907 Bacteria 1406
2 JGI24737J22298_10001423 3300001990 Bacteria 8516
3 JGI24737J22298_10009629 3300001990 Bacteria 3205
4 Ga0065715_10100456 3300005293 Bacteria 3301
5 Ga0070658_10000409 3300005327 Bacteria 37237
6 Ga0070658_10016441 3300005327 Bacteria 5921
7 Ga0070683_100019736 3300005329 Bacteria 5990
8 Ga0070670_100028036 3300005331 Bacteria 4846
9 Ga0070670_100078291 3300005331 Bacteria 2840
10 Ga0070666_10003929 3300005335 Bacteria 9028
11 Ga0070680_100000835 3300005336 Bacteria 21767
12 Ga0070680_100011332 3300005336 Bacteria 6895
13 Ga0070680_100132574 3300005336 Bacteria 2085
14 Ga0070682_100038680 3300005337 Bacteria 2927
15 Ga0070682_100052708 3300005337 Bacteria 2547
16 Ga0070660_100000055 3300005339 Bacteria 67100
17 Ga0070660_100031504 3300005339 Bacteria 3983
18 Ga0070661_100000340 3300005344 Bacteria 37237
19 Ga0070668_100102295 3300005347 Bacteria 2271
20 Ga0070675_100192186 3300005354 Bacteria 1769
21 Ga0070671_100000661 3300005355 Bacteria 24795
22 Ga0070659_100000139 3300005366 Bacteria 55743
23 Ga0070659_100022671 3300005366 Bacteria 4795
24 Ga0070667_100007107 3300005367 Bacteria 9310
25 Ga0070667_100016648 3300005367 Bacteria 6085
26 Ga0070663_100000504 3300005455 Bacteria 20646
27 Ga0070662_100000024 3300005457 Bacteria 91042
28 Ga0068867_100020259 3300005459 Bacteria 4739
29 Ga0070684_100012523 3300005535 Bacteria 6803
30 Ga0068853_100000342 3300005539 Bacteria 32471
31 Ga0068853_100048444 3300005539 Bacteria 3650
32 Ga0070672_100011152 3300005543 Bacteria 6258
33 Ga0070672_100223992 3300005543 Bacteria 1578
34 Ga0070693_100002285 3300005547 Bacteria 8785
35 Ga0070665_100000705 3300005548 Bacteria 44568
36 Ga0068855_100001003 3300005563 Bacteria 35196
37 Ga0068855_100007701 3300005563 Bacteria 13005
38 Ga0068855_100206207 3300005563 Bacteria 2211
39 Ga0068855_100232301 3300005563 Bacteria 2064
40 Ga0068855_100309005 3300005563 Bacteria 1750
41 Ga0070664_100000082 3300005564 Bacteria 60083
42 Ga0070664_100000207 3300005564 Bacteria 42082
43 Ga0068857_100035831 3300005577 Bacteria 4395
44 Ga0068857_100286159 3300005577 Bacteria 1517
45 Ga0068854_100005522 3300005578 Bacteria 7990
46 Ga0068856_100000085 3300005614 Bacteria 87665
47 Ga0068852_100001258 3300005616 Bacteria 16883
48 Ga0068859_100006121 3300005617 Bacteria 12223
49 Ga0068864_100000805 3300005618 Bacteria 26330
50 Ga0068864_100087745 3300005618 Bacteria 2739
51 Ga0068851_10005869 3300005834 Bacteria 5592
52 Ga0068863_100005757 3300005841 Bacteria 12163
53 Ga0068860_100024420 3300005843 Bacteria 5840
54 Ga0068860_100280153 3300005843 Bacteria 1629
55 Ga0068871_100024537 3300006358 Bacteria 4678
56 Ga0075429_100155560 3300006880 Bacteria 2002
57 Ga0097620_100006121 3300006931 Bacteria 12223
58 Ga0105248_10000059 3300009177 Bacteria 137176
59 Ga0105248_10000135 3300009177 Bacteria 85668
60 Ga0105248_10004321 3300009177 Bacteria 15718
61 Ga0105239_10177877 3300010375 Bacteria 2380
62 Ga0157373_10012761 3300013100 Bacteria 6173
63 Ga0157371_10003776 3300013102 Bacteria 13558
64 Ga0157371_10005987 3300013102 Bacteria 10142
65 Ga0157370_10003624 3300013104 Bacteria 18072
66 Ga0157370_10051519 3300013104 Bacteria 3932
67 Ga0157369_10265711 3300013105 Bacteria 1789
68 Ga0163162_10052573 3300013306 Bacteria 4092
69 Ga0163163_10000763 3300014325 Bacteria 27341
70 Ga0157380_10021444 3300014326 Bacteria 4846
71 Ga0157379_10102405 3300014968 Bacteria 2570
72 Ga0207656_10002438 3300025321 Bacteria 6264
73 Ga0207656_10038440 3300025321 Bacteria 2019
74 Ga0207680_10000473 3300025903 Bacteria 19026
75 Ga0207647_10003089 3300025904 Bacteria 12516
76 Ga0207647_10052898 3300025904 Bacteria 2505
77 Ga0207647_10061150 3300025904 Bacteria 2300
78 Ga0207647_10074464 3300025904 Bacteria 2045
79 Ga0207705_10000062 3300025909 Bacteria 149432
80 Ga0207705_10001216 3300025909 Bacteria 20824
81 Ga0207660_10001300 3300025917 Bacteria 16670
82 Ga0207657_10000015 3300025919 Bacteria 175776
83 Ga0207657_10000128 3300025919 Bacteria 76013
84 Ga0207657_10012877 3300025919 Bacteria 8225
85 Ga0207650_10014617 3300025925 Bacteria 5452
86 Ga0207650_10058822 3300025925 Bacteria 2863
87 Ga0207644_10001099 3300025931 Bacteria 17353
88 Ga0207644_10002030 3300025931 Bacteria 13090
89 Ga0207644_10006392 3300025931 Bacteria 7677
90 Ga0207690_10000032 3300025932 Bacteria 152479
91 Ga0207690_10021998 3300025932 Bacteria 3961
92 Ga0207690_10076297 3300025932 Bacteria 2327
93 Ga0207706_10000032 3300025933 Bacteria 142723
94 Ga0207706_10044137 3300025933 Bacteria 3951
95 Ga0207691_10022853 3300025940 Bacteria 5895
96 Ga0207691_10078553 3300025940 Bacteria 2971
97 Ga0207711_10001202 3300025941 Bacteria 24498
98 Ga0207711_10003576 3300025941 Bacteria 13445
99 Ga0207661_10000460 3300025944 Bacteria 26287
100 Ga0207679_10000983 3300025945 Bacteria 18340
101 Ga0207679_10003444 3300025945 Bacteria 9762
102 Ga0207667_10002422 3300025949 Bacteria 23379
103 Ga0207667_10026375 3300025949 Bacteria 6350
104 Ga0207667_10099936 3300025949 Bacteria 2993
105 Ga0207651_10079171 3300025960 Bacteria 2360
106 Ga0207651_10123553 3300025960 Bacteria 1968
107 Ga0207712_10016841 3300025961 Bacteria 4740
108 Ga0207668_10075115 3300025972 Bacteria 2429
109 Ga0207658_10010924 3300025986 Bacteria 6182
110 Ga0207658_10032322 3300025986 Bacteria 3724
111 Ga0207639_10086773 3300026041 Bacteria 2493
112 Ga0207639_10091010 3300026041 Bacteria 2441
113 Ga0207678_10001029 3300026067 Bacteria 25450
114 Ga0207678_10004050 3300026067 Bacteria 13181
115 Ga0207702_10000072 3300026078 Bacteria 113840
116 Ga0207641_10008912 3300026088 Bacteria 8288
117 Ga0207648_10024927 3300026089 Bacteria 5332
118 Ga0207676_10003893 3300026095 Bacteria 10546
119 Ga0207676_10012299 3300026095 Bacteria 6128
120 Ga0207674_10000607 3300026116 Bacteria 46991
121 Ga0207674_10248770 3300026116 Bacteria 1725
122 Ga0207674_10284422 3300026116 Bacteria 1602
123 Ga0207698_10000955 3300026142 Bacteria 16786
124 Ga0268266_10000133 3300028379 Bacteria 143210
125 Ga0268266_10015377 3300028379 Bacteria 6567
126 Ga0268264_10002210 3300028381 Bacteria 17265
127 Ga0307408_100274765 3300031548 Bacteria 1400
128 Ga0307405_10003393 3300031731 Bacteria 7312
129 Ga0307413_10007386 3300031824 Bacteria 5100
130 Ga0307413_10046766 3300031824 Bacteria 2576
131 Ga0307413_10067478 3300031824 Bacteria 2236
132 Ga0307413_10075142 3300031824 Bacteria 2143
133 Ga0307410_10006046 3300031852 Bacteria 6487
134 Ga0307410_10018782 3300031852 Bacteria 4187
135 Ga0307410_10028477 3300031852 Bacteria 3544
136 Ga0307410_10264627 3300031852 Bacteria 1342
137 Ga0307407_10003814 3300031903 Bacteria 6276
138 Ga0307407_10011566 3300031903 Bacteria 4206
139 Ga0307407_10034269 3300031903 Bacteria 2778
140 Ga0307407_10056170 3300031903 Bacteria 2278
141 Ga0307407_10069971 3300031903 Bacteria 2084
142 Ga0307412_10095897 3300031911 Bacteria 2086
143 Ga0307412_10118319 3300031911 Bacteria 1903
144 Ga0307409_100012306 3300031995 Bacteria 5446
145 Ga0307409_100054389 3300031995 Bacteria 3082
146 Ga0307409_100067282 3300031995 Bacteria 2828
147 Ga0307416_100010139 3300032002 Bacteria 6210
148 Ga0307416_100019280 3300032002 Bacteria 4832
149 Ga0307416_100019479 3300032002 Bacteria 4812
150 Ga0307416_100063057 3300032002 Bacteria 3033
151 Ga0307414_10003346 3300032004 Bacteria 8560
152 Ga0307414_10094226 3300032004 Bacteria 2234
153 Ga0307414_10306483 3300032004 Bacteria 1346
154 Ga0307411_10002944 3300032005 Bacteria 7729
155 Ga0307411_10078441 3300032005 Bacteria 2264
156 Ga0307411_10099977 3300032005 Bacteria 2048
157 Ga0307415_100118365 3300032126 Bacteria 1980
158 Ga0307415_100140327 3300032126 Bacteria 1845
159 Ga0307415_100242459 3300032126 Bacteria 1459
160 Ga0395899_0010530 3300037312 Bacteria 7084
161 Ga0395899_0019656 3300037312 Bacteria 5127
162 Ga0395900_0001365 3300037418 Bacteria 29397
163 Ga0395900_0064184 3300037418 Bacteria 3774
164 Ga0395900_0081836 3300037418 Bacteria 3317
165 Ga0395900_0257833 3300037418 Bacteria 1742
166 Ga0395898_0057722 3300037466 Bacteria 3781
167 Ga0395898_0104583 3300037466 Bacteria 2715
168 Ga0395905_0001726 3300037471 Bacteria 25585
169 Ga0395905_0003299 3300037471 Bacteria 17323
170 Ga0395905_0003572 3300037471 Bacteria 16555
171 Ga0395905_0005518 3300037471 Bacteria 12903
172 Ga0395905_0026348 3300037471 Bacteria 5482
173 Ga0395905_0101715 3300037471 Bacteria 2697
174 Ga0395905_0131721 3300037471 Bacteria 2351
175 Ga0395905_0205773 3300037471 Bacteria 1844
176 Ga0395901_0027437 3300038443 Bacteria 5850
177 Ga0395901_0173550 3300038443 Bacteria 2262
178 Ga0395901_0391602 3300038443 Bacteria 1428
179 Ga0466969_0005339 3300044656 Bacteria 6837
180 Ga0466966_0001379 3300044684 Bacteria 15630
181 Ga0466961_0005051 3300044693 Bacteria 8298
182 Ga0466964_0048568 3300044706 Bacteria 1736
183 Ga0466971_0003007 3300044719 Bacteria 7166
184 Ga0466970_0017256 3300044765 Bacteria 3729
185 Ga0466957_0000606 3300044842 Bacteria 18172
186 Ga0466959_0012186 3300045049 Bacteria 6204
187 Ga0466958_0006195 3300045836 Bacteria 6492
188 Ga0466958_0053802 3300045836 Bacteria 2441
189 Ga0466967_0106290 3300045976 Bacteria 2572
190 Ga0495668_0147191 3300046616 Bacteria 1289
191 Ga0496100_0041172 3300048903 Bacteria 2943
192 Ga0496101_0029674 3300048904 Bacteria 3826
193 Ga0496106_0003062 3300048909 Bacteria 12462
194 Ga0496107_0000486 3300048910 Bacteria 21842
195 Ga0496107_0024312 3300048910 Bacteria 4286
196 Ga0496109_0018375 3300048912 Bacteria 6143
197 Ga0496110_0003012 3300048913 Bacteria 12779
198 Ga0496111_0000826 3300048914 Bacteria 16670
199 Ga0496112_0000424 3300048915 Bacteria 27867
200 Ga0496113_0014232 3300048916 Bacteria 5422
201 Ga0500658_0000106 3300053134 Bacteria 38868
202 Ga0466962_0006391 3300061719 Bacteria 5656
203 Ga0207645_10175365
204 JGI24737J22298_10001423
205 JGI24737J22298_10009629
206 Ga0065715_10100456
207 Ga0070658_10000409
208 Ga0070658_10016441
209 Ga0070683_100019736
210 Ga0070670_100028036
211 Ga0070670_100078291
212 Ga0070666_10003929
213 Ga0070680_100000835
214 Ga0070680_100011332
215 Ga0070680_100132574
216 Ga0070682_100038680
217 Ga0070682_100052708
218 Ga0070660_100000055
219 Ga0070660_100031504
220 Ga0070661_100000340
221 Ga0070668_100102295
222 Ga0070675_100192186
223 Ga0070671_100000661
224 Ga0070659_100000139
225 Ga0070659_100022671
226 Ga0070667_100007107
227 Ga0070667_100016648
228 Ga0070663_100000504
229 Ga0070662_100000024
230 Ga0068867_100020259
231 Ga0070684_100012523
232 Ga0068853_100000342
233 Ga0068853_100048444
234 Ga0070672_100011152
235 Ga0070672_100223992
236 Ga0070693_100002285
237 Ga0070665_100000705
238 Ga0068855_100001003
239 Ga0068855_100007701
240 Ga0068855_100206207
241 Ga0068855_100232301
242 Ga0068855_100309005
243 Ga0070664_100000082
244 Ga0070664_100000207
245 Ga0068857_100035831
246 Ga0068857_100286159
247 Ga0068854_100005522
248 Ga0068856_100000085
249 Ga0068852_100001258
250 Ga0068859_100006121
251 Ga0068864_100000805
252 Ga0068864_100087745
253 Ga0068851_10005869
254 Ga0068863_100005757
255 Ga0068860_100024420
256 Ga0068860_100280153
257 Ga0068871_100024537
258 Ga0075429_100155560
259 Ga0097620_100006121
260 Ga0105248_10000059
261 Ga0105248_10000135
262 Ga0105248_10004321
263 Ga0105239_10177877
264 Ga0157373_10012761
265 Ga0157371_10003776
266 Ga0157371_10005987
267 Ga0157370_10003624
268 Ga0157370_10051519
269 Ga0157369_10265711
270 Ga0163162_10052573
271 Ga0163163_10000763
272 Ga0157380_10021444
273 Ga0157379_10102405
274 Ga0207656_10002438
275 Ga0207656_10038440
276 Ga0207680_10000473
277 Ga0207647_10003089
278 Ga0207647_10052898
279 Ga0207647_10061150
280 Ga0207647_10074464
281 Ga0207705_10000062
282 Ga0207705_10001216
283 Ga0207660_10001300
284 Ga0207657_10000015
285 Ga0207657_10000128
286 Ga0207657_10012877
287 Ga0207650_10014617
288 Ga0207650_10058822
289 Ga0207644_10001099
290 Ga0207644_10002030
291 Ga0207644_10006392
292 Ga0207690_10000032
293 Ga0207690_10021998
294 Ga0207690_10076297
295 Ga0207706_10000032
296 Ga0207706_10044137
297 Ga0207691_10022853
298 Ga0207691_10078553
299 Ga0207711_10001202
300 Ga0207711_10003576
301 Ga0207661_10000460
302 Ga0207679_10000983
303 Ga0207679_10003444
304 Ga0207667_10002422
305 Ga0207667_10026375
306 Ga0207667_10099936
307 Ga0207651_10079171
308 Ga0207651_10123553
309 Ga0207712_10016841
310 Ga0207668_10075115
311 Ga0207658_10010924
312 Ga0207658_10032322
313 Ga0207639_10086773
314 Ga0207639_10091010
315 Ga0207678_10001029
316 Ga0207678_10004050
317 Ga0207702_10000072
318 Ga0207641_10008912
319 Ga0207648_10024927
320 Ga0207676_10003893
321 Ga0207676_10012299
322 Ga0207674_10000607
323 Ga0207674_10248770
324 Ga0207674_10284422
325 Ga0207698_10000955
326 Ga0268266_10000133
327 Ga0268266_10015377
328 Ga0268264_10002210
329 Ga0307408_100274765
330 Ga0307405_10003393
331 Ga0307413_10007386
332 Ga0307413_10046766
333 Ga0307413_10067478
334 Ga0307413_10075142
335 Ga0307410_10006046
336 Ga0307410_10018782
337 Ga0307410_10028477
338 Ga0307410_10264627
339 Ga0307407_10003814
340 Ga0307407_10011566
341 Ga0307407_10034269
342 Ga0307407_10056170
343 Ga0307407_10069971
344 Ga0307412_10095897
345 Ga0307412_10118319
346 Ga0307409_100012306
347 Ga0307409_100054389
348 Ga0307409_100067282
349 Ga0307416_100010139
350 Ga0307416_100019280
351 Ga0307416_100019479
352 Ga0307416_100063057
353 Ga0307414_10003346
354 Ga0307414_10094226
355 Ga0307414_10306483
356 Ga0307411_10002944
357 Ga0307411_10078441
358 Ga0307411_10099977
359 Ga0307415_100118365
360 Ga0307415_100140327
361 Ga0307415_100242459
362 Ga0395899_0010530
363 Ga0395899_0019656
364 Ga0395900_0001365
365 Ga0395900_0064184
366 Ga0395900_0081836
367 Ga0395900_0257833
368 Ga0395898_0057722
369 Ga0395898_0104583
370 Ga0395905_0001726
371 Ga0395905_0003299
372 Ga0395905_0003572
373 Ga0395905_0005518
374 Ga0395905_0026348
375 Ga0395905_0101715
376 Ga0395905_0131721
377 Ga0395905_0205773
378 Ga0395901_0027437
379 Ga0395901_0173550
380 Ga0395901_0391602
381 Ga0466969_0005339
382 Ga0466966_0001379
383 Ga0466961_0005051
384 Ga0466964_0048568
385 Ga0466971_0003007
386 Ga0466970_0017256
387 Ga0466957_0000606
388 Ga0466959_0012186
389 Ga0466958_0006195
390 Ga0466958_0053802
391 Ga0466967_0106290
392 Ga0495668_0147191
393 Ga0496100_0041172
394 Ga0496101_0029674
395 Ga0496106_0003062
396 Ga0496107_0000486
397 Ga0496107_0024312
398 Ga0496109_0018375
399 Ga0496110_0003012
400 Ga0496111_0000826
401 Ga0496112_0000424
402 Ga0496113_0014232
403 Ga0500658_0000106
404 Ga0466962_0006391

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01189

Methyltr_RsmB-F

16S rRNA methyltransferase RsmB/F

194

399

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i9z-assembly1.cif.gz_CP cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state spb4 0.8819 111 383
3a4t-assembly1.cif.gz_A crystal structure of atrm4 from m.jannaschii with sinefungin 0.8786 132 381
2frx-assembly2.cif.gz_B crystal structure of yebu, a m5c rna methyltransferase from e.coli 0.877 121 383
3m6w-assembly1.cif.gz_A multi-site-specific 16s rrna methyltransferase rsmf from thermus thermophilus in space group p21212 in complex with s-adenosyl-l-methionine 0.8705 107 383
6em5-assembly1.cif.gz_q state d architectural model (nsa1-tap flag-ytm1) - visualizing the assembly pathway of nucleolar pre-60s ribosomes 0.8705 110 383
ID Description Score Start End Superfamily
2yxlA04 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9305 186 381 3.40.50.150
af_P40991_338_614_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9103 196 383 3.40.50.150
af_Q9FG73_345_571_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9016 190 383 3.40.50.150
af_Q9TYV5_297_615_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9011 194 381 3.40.50.150
af_A1Z909_427_794_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8969 194 381 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A520X204-F1-model_v4 RsmB/NOP family class I SAM-dependent RNA methyltransferase 0.9799 296 383 GO:0001510
GO:0003723
GO:0008173
AF-A0A4Q3CPH5-F1-model_v4 RsmB/NOP family class I SAM-dependent RNA methyltransferase 0.9776 151 382 GO:0001510
GO:0003723
GO:0008173
AF-A0A3A1P950-F1-model_v4 RsmB/NOP family class I SAM-dependent RNA methyltransferase 0.9717 288 382 GO:0001510
GO:0003723
GO:0008173
AF-A0A4Q5SY30-F1-model_v4 RsmB/NOP family class I SAM-dependent RNA methyltransferase 0.9709 168 382 GO:0001510
GO:0003723
GO:0008173
AF-A0A520X204-F1-model_v4 RsmB/NOP family class I SAM-dependent RNA methyltransferase 0.938 296 383 GO:0001510
GO:0003723
GO:0008173

Map